I: pbuilder: network access will be disabled during build I: Current time: Thu Apr 27 00:09:50 -12 2023 I: pbuilder-time-stamp: 1682597390 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bookworm-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 02:08:01 2022 -12 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/1315977/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='amd64' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=15' DISTRIBUTION='bookworm' HOME='/root' HOST_ARCH='amd64' IFS=' ' INVOCATION_ID='90a8761269f44436b0c70129862dd22b' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='1315977' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.kJZ53rrw/pbuilderrc_DaEv --distribution bookworm --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.kJZ53rrw/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='110' SUDO_UID='105' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://78.137.99.97:3128' I: uname -a Linux ionos1-amd64 5.10.0-21-amd64 #1 SMP Debian 5.10.162-1 (2023-01-21) x86_64 GNU/Linux I: ls -l /bin total 5632 -rwxr-xr-x 1 root root 1265648 Apr 23 09:23 bash -rwxr-xr-x 3 root root 39224 Sep 18 2022 bunzip2 -rwxr-xr-x 3 root root 39224 Sep 18 2022 bzcat lrwxrwxrwx 1 root root 6 Sep 18 2022 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Sep 18 2022 bzdiff lrwxrwxrwx 1 root root 6 Sep 18 2022 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4893 Nov 27 2021 bzexe lrwxrwxrwx 1 root root 6 Sep 18 2022 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Sep 18 2022 bzgrep -rwxr-xr-x 3 root root 39224 Sep 18 2022 bzip2 -rwxr-xr-x 1 root root 14568 Sep 18 2022 bzip2recover lrwxrwxrwx 1 root root 6 Sep 18 2022 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Sep 18 2022 bzmore -rwxr-xr-x 1 root root 44016 Sep 20 2022 cat -rwxr-xr-x 1 root root 68656 Sep 20 2022 chgrp -rwxr-xr-x 1 root root 64496 Sep 20 2022 chmod -rwxr-xr-x 1 root root 72752 Sep 20 2022 chown -rwxr-xr-x 1 root root 151152 Sep 20 2022 cp -rwxr-xr-x 1 root root 125640 Jan 5 01:20 dash -rwxr-xr-x 1 root root 121904 Sep 20 2022 date -rwxr-xr-x 1 root root 89240 Sep 20 2022 dd -rwxr-xr-x 1 root root 102200 Sep 20 2022 df -rwxr-xr-x 1 root root 151344 Sep 20 2022 dir -rwxr-xr-x 1 root root 88656 Mar 22 22:02 dmesg lrwxrwxrwx 1 root root 8 Dec 19 01:33 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Dec 19 01:33 domainname -> hostname -rwxr-xr-x 1 root root 43856 Sep 20 2022 echo -rwxr-xr-x 1 root root 41 Jan 24 02:43 egrep -rwxr-xr-x 1 root root 35664 Sep 20 2022 false -rwxr-xr-x 1 root root 41 Jan 24 02:43 fgrep -rwxr-xr-x 1 root root 85600 Mar 22 22:02 findmnt -rwsr-xr-x 1 root root 35128 Mar 22 20:35 fusermount -rwxr-xr-x 1 root root 203152 Jan 24 02:43 grep -rwxr-xr-x 2 root root 2346 Apr 9 2022 gunzip -rwxr-xr-x 1 root root 6447 Apr 9 2022 gzexe -rwxr-xr-x 1 root root 98136 Apr 9 2022 gzip -rwxr-xr-x 1 root root 22680 Dec 19 01:33 hostname -rwxr-xr-x 1 root root 72824 Sep 20 2022 ln -rwxr-xr-x 1 root root 53024 Mar 23 00:40 login -rwxr-xr-x 1 root root 151344 Sep 20 2022 ls -rwxr-xr-x 1 root root 207168 Mar 22 22:02 lsblk -rwxr-xr-x 1 root root 97552 Sep 20 2022 mkdir -rwxr-xr-x 1 root root 72912 Sep 20 2022 mknod -rwxr-xr-x 1 root root 43952 Sep 20 2022 mktemp -rwxr-xr-x 1 root root 59712 Mar 22 22:02 more -rwsr-xr-x 1 root root 59704 Mar 22 22:02 mount -rwxr-xr-x 1 root root 18744 Mar 22 22:02 mountpoint -rwxr-xr-x 1 root root 142968 Sep 20 2022 mv lrwxrwxrwx 1 root root 8 Dec 19 01:33 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 2 18:25 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 43952 Sep 20 2022 pwd lrwxrwxrwx 1 root root 4 Apr 23 09:23 rbash -> bash -rwxr-xr-x 1 root root 52112 Sep 20 2022 readlink -rwxr-xr-x 1 root root 72752 Sep 20 2022 rm -rwxr-xr-x 1 root root 56240 Sep 20 2022 rmdir -rwxr-xr-x 1 root root 27560 Nov 2 04:31 run-parts -rwxr-xr-x 1 root root 126424 Jan 5 07:55 sed lrwxrwxrwx 1 root root 4 Jan 5 01:20 sh -> dash -rwxr-xr-x 1 root root 43888 Sep 20 2022 sleep -rwxr-xr-x 1 root root 85008 Sep 20 2022 stty -rwsr-xr-x 1 root root 72000 Mar 22 22:02 su -rwxr-xr-x 1 root root 39824 Sep 20 2022 sync -rwxr-xr-x 1 root root 531984 Apr 6 02:25 tar -rwxr-xr-x 1 root root 14520 Nov 2 04:31 tempfile -rwxr-xr-x 1 root root 109616 Sep 20 2022 touch -rwxr-xr-x 1 root root 35664 Sep 20 2022 true -rwxr-xr-x 1 root root 14568 Mar 22 20:35 ulockmgr_server -rwsr-xr-x 1 root root 35128 Mar 22 22:02 umount -rwxr-xr-x 1 root root 43888 Sep 20 2022 uname -rwxr-xr-x 2 root root 2346 Apr 9 2022 uncompress -rwxr-xr-x 1 root root 151344 Sep 20 2022 vdir -rwxr-xr-x 1 root root 72024 Mar 22 22:02 wdctl lrwxrwxrwx 1 root root 8 Dec 19 01:33 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Apr 9 2022 zcat -rwxr-xr-x 1 root root 1678 Apr 9 2022 zcmp -rwxr-xr-x 1 root root 6460 Apr 9 2022 zdiff -rwxr-xr-x 1 root root 29 Apr 9 2022 zegrep -rwxr-xr-x 1 root root 29 Apr 9 2022 zfgrep -rwxr-xr-x 1 root root 2081 Apr 9 2022 zforce -rwxr-xr-x 1 root root 8103 Apr 9 2022 zgrep -rwxr-xr-x 1 root root 2206 Apr 9 2022 zless -rwxr-xr-x 1 root root 1842 Apr 9 2022 zmore -rwxr-xr-x 1 root root 4577 Apr 9 2022 znew I: user script /srv/workspace/pbuilder/1315977/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: amd64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19596 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-intel1{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm15{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libncurses6{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpciaccess0{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} libregexp-ipv6-perl{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpm2 libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 338 newly installed, 0 to remove and 0 not upgraded. Need to get 473 MB of archives. After unpacking 961 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bookworm/main amd64 libpython3.11-minimal amd64 3.11.2-6 [813 kB] Get: 2 http://deb.debian.org/debian bookworm/main amd64 libexpat1 amd64 2.5.0-1 [99.3 kB] Get: 3 http://deb.debian.org/debian bookworm/main amd64 python3.11-minimal amd64 3.11.2-6 [2064 kB] Get: 4 http://deb.debian.org/debian bookworm/main amd64 python3-minimal amd64 3.11.2-1+b1 [26.3 kB] Get: 5 http://deb.debian.org/debian bookworm/main amd64 media-types all 10.0.0 [26.1 kB] Get: 6 http://deb.debian.org/debian bookworm/main amd64 readline-common all 8.2-1.3 [69.0 kB] Get: 7 http://deb.debian.org/debian bookworm/main amd64 libreadline8 amd64 8.2-1.3 [166 kB] Get: 8 http://deb.debian.org/debian bookworm/main amd64 libpython3.11-stdlib amd64 3.11.2-6 [1796 kB] Get: 9 http://deb.debian.org/debian bookworm/main amd64 python3.11 amd64 3.11.2-6 [572 kB] Get: 10 http://deb.debian.org/debian bookworm/main amd64 libpython3-stdlib amd64 3.11.2-1+b1 [9312 B] Get: 11 http://deb.debian.org/debian bookworm/main amd64 python3 amd64 3.11.2-1+b1 [26.3 kB] Get: 12 http://deb.debian.org/debian bookworm/main amd64 netbase all 6.4 [12.8 kB] Get: 13 http://deb.debian.org/debian bookworm/main amd64 sensible-utils all 0.0.17+nmu1 [19.0 kB] Get: 14 http://deb.debian.org/debian bookworm/main amd64 openssl amd64 3.0.8-1 [1407 kB] Get: 15 http://deb.debian.org/debian bookworm/main amd64 ca-certificates all 20230311 [153 kB] Get: 16 http://deb.debian.org/debian bookworm/main amd64 libmagic-mgc amd64 1:5.44-3 [305 kB] Get: 17 http://deb.debian.org/debian bookworm/main amd64 libmagic1 amd64 1:5.44-3 [104 kB] Get: 18 http://deb.debian.org/debian bookworm/main amd64 file amd64 1:5.44-3 [42.5 kB] Get: 19 http://deb.debian.org/debian bookworm/main amd64 gettext-base amd64 0.21-12 [160 kB] Get: 20 http://deb.debian.org/debian bookworm/main amd64 libuchardet0 amd64 0.0.7-1 [67.8 kB] Get: 21 http://deb.debian.org/debian bookworm/main amd64 groff-base amd64 1.22.4-10 [916 kB] Get: 22 http://deb.debian.org/debian bookworm/main amd64 bsdextrautils amd64 2.38.1-5+b1 [86.6 kB] Get: 23 http://deb.debian.org/debian bookworm/main amd64 libpipeline1 amd64 1.5.7-1 [38.5 kB] Get: 24 http://deb.debian.org/debian bookworm/main amd64 man-db amd64 2.11.2-2 [1386 kB] Get: 25 http://deb.debian.org/debian bookworm/main amd64 hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 26 http://deb.debian.org/debian bookworm/main amd64 libgdk-pixbuf2.0-common all 2.42.10+dfsg-1 [306 kB] Get: 27 http://deb.debian.org/debian bookworm/main amd64 libglib2.0-0 amd64 2.74.6-2 [1398 kB] Get: 28 http://deb.debian.org/debian bookworm/main amd64 libicu72 amd64 72.1-3 [9376 kB] Get: 29 http://deb.debian.org/debian bookworm/main amd64 libxml2 amd64 2.9.14+dfsg-1.2 [687 kB] Get: 30 http://deb.debian.org/debian bookworm/main amd64 shared-mime-info amd64 2.2-1 [729 kB] Get: 31 http://deb.debian.org/debian bookworm/main amd64 libjpeg62-turbo amd64 1:2.1.5-2 [166 kB] Get: 32 http://deb.debian.org/debian bookworm/main amd64 libpng16-16 amd64 1.6.39-2 [276 kB] Get: 33 http://deb.debian.org/debian bookworm/main amd64 libdeflate0 amd64 1.14-1 [61.4 kB] Get: 34 http://deb.debian.org/debian bookworm/main amd64 libjbig0 amd64 2.1-6.1 [31.7 kB] Get: 35 http://deb.debian.org/debian bookworm/main amd64 liblerc4 amd64 4.0.0+ds-2 [170 kB] Get: 36 http://deb.debian.org/debian bookworm/main amd64 libwebp7 amd64 1.2.4-0.1 [285 kB] Get: 37 http://deb.debian.org/debian bookworm/main amd64 libtiff6 amd64 4.5.0-5 [316 kB] Get: 38 http://deb.debian.org/debian bookworm/main amd64 libgdk-pixbuf-2.0-0 amd64 2.42.10+dfsg-1+b1 [139 kB] Get: 39 http://deb.debian.org/debian bookworm/main amd64 gtk-update-icon-cache amd64 3.24.37-2 [43.3 kB] Get: 40 http://deb.debian.org/debian bookworm/main amd64 adwaita-icon-theme all 43-1 [5124 kB] Get: 41 http://deb.debian.org/debian bookworm/main amd64 ca-certificates-java all 20230103 [11.4 kB] Get: 42 http://deb.debian.org/debian bookworm/main amd64 java-common all 0.74 [6388 B] Get: 43 http://deb.debian.org/debian bookworm/main amd64 libavahi-common-data amd64 0.8-10 [107 kB] Get: 44 http://deb.debian.org/debian bookworm/main amd64 libavahi-common3 amd64 0.8-10 [41.6 kB] Get: 45 http://deb.debian.org/debian bookworm/main amd64 libdbus-1-3 amd64 1.14.6-1 [200 kB] Get: 46 http://deb.debian.org/debian bookworm/main amd64 libavahi-client3 amd64 0.8-10 [45.5 kB] Get: 47 http://deb.debian.org/debian bookworm/main amd64 libcups2 amd64 2.4.2-3 [244 kB] Get: 48 http://deb.debian.org/debian bookworm/main amd64 liblcms2-2 amd64 2.14-2 [154 kB] Get: 49 http://deb.debian.org/debian bookworm/main amd64 libbrotli1 amd64 1.0.9-2+b6 [275 kB] Get: 50 http://deb.debian.org/debian bookworm/main amd64 libfreetype6 amd64 2.12.1+dfsg-4 [399 kB] Get: 51 http://deb.debian.org/debian bookworm/main amd64 fonts-dejavu-core all 2.37-6 [1068 kB] Get: 52 http://deb.debian.org/debian bookworm/main amd64 fontconfig-config amd64 2.14.1-4 [315 kB] Get: 53 http://deb.debian.org/debian bookworm/main amd64 libfontconfig1 amd64 2.14.1-4 [386 kB] Get: 54 http://deb.debian.org/debian bookworm/main amd64 libnspr4 amd64 2:4.35-1 [113 kB] Get: 55 http://deb.debian.org/debian bookworm/main amd64 libnss3 amd64 2:3.87.1-1 [1331 kB] Get: 56 http://deb.debian.org/debian bookworm/main amd64 libasound2-data all 1.2.8-1 [20.5 kB] Get: 57 http://deb.debian.org/debian bookworm/main amd64 libasound2 amd64 1.2.8-1+b1 [362 kB] Get: 58 http://deb.debian.org/debian bookworm/main amd64 libgraphite2-3 amd64 1.3.14-1 [81.2 kB] Get: 59 http://deb.debian.org/debian bookworm/main amd64 libharfbuzz0b amd64 6.0.0+dfsg-3 [1945 kB] Get: 60 http://deb.debian.org/debian bookworm/main amd64 libpcsclite1 amd64 1.9.9-2 [49.7 kB] Get: 61 http://deb.debian.org/debian bookworm/main amd64 openjdk-17-jre-headless amd64 17.0.6+10-1 [43.6 MB] Get: 62 http://deb.debian.org/debian bookworm/main amd64 default-jre-headless amd64 2:1.17-74 [2936 B] Get: 63 http://deb.debian.org/debian bookworm/main amd64 ant all 1.10.13-1 [2161 kB] Get: 64 http://deb.debian.org/debian bookworm/main amd64 ant-optional all 1.10.13-1 [449 kB] Get: 65 http://deb.debian.org/debian bookworm/main amd64 libantlr-java all 2.7.7+dfsg-12 [458 kB] Get: 66 http://deb.debian.org/debian bookworm/main amd64 antlr all 2.7.7+dfsg-12 [14.3 kB] Get: 67 http://deb.debian.org/debian bookworm/main amd64 at-spi2-common all 2.46.0-5 [162 kB] Get: 68 http://deb.debian.org/debian bookworm/main amd64 m4 amd64 1.4.19-3 [287 kB] Get: 69 http://deb.debian.org/debian bookworm/main amd64 autoconf all 2.71-3 [332 kB] Get: 70 http://deb.debian.org/debian bookworm/main amd64 autotools-dev all 20220109.1 [51.6 kB] Get: 71 http://deb.debian.org/debian bookworm/main amd64 automake all 1:1.16.5-1.3 [823 kB] Get: 72 http://deb.debian.org/debian bookworm/main amd64 autopoint all 0.21-12 [495 kB] Get: 73 http://deb.debian.org/debian bookworm/main amd64 unzip amd64 6.0-28 [166 kB] Get: 74 http://deb.debian.org/debian bookworm/main amd64 java-wrappers all 0.4 [8916 B] Get: 75 http://deb.debian.org/debian bookworm/main amd64 libhamcrest-java all 2.2-1 [121 kB] Get: 76 http://deb.debian.org/debian bookworm/main amd64 junit4 all 4.13.2-3 [348 kB] Get: 77 http://deb.debian.org/debian bookworm/main amd64 libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 78 http://deb.debian.org/debian bookworm/main amd64 libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 79 http://deb.debian.org/debian bookworm/main amd64 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 80 http://deb.debian.org/debian bookworm/main amd64 libosgi-core-java all 8.0.0-2 [182 kB] Get: 81 http://deb.debian.org/debian bookworm/main amd64 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 82 http://deb.debian.org/debian bookworm/main amd64 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 83 http://deb.debian.org/debian bookworm/main amd64 libjansi-native-java all 1.8-1 [26.0 kB] Get: 84 http://deb.debian.org/debian bookworm/main amd64 libjansi1-java all 1.18-3 [66.5 kB] Get: 85 http://deb.debian.org/debian bookworm/main amd64 libjline2-java all 2.14.6-5 [151 kB] Get: 86 http://deb.debian.org/debian bookworm/main amd64 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 87 http://deb.debian.org/debian bookworm/main amd64 libslf4j-java all 1.7.32-1 [144 kB] Get: 88 http://deb.debian.org/debian bookworm/main amd64 libxz-java all 1.9-1 [143 kB] Get: 89 http://deb.debian.org/debian bookworm/main amd64 libyaml-snake-java all 1.33-2 [321 kB] Get: 90 http://deb.debian.org/debian bookworm/main amd64 bnd all 5.0.1-3 [9915 kB] Get: 91 http://deb.debian.org/debian bookworm/main amd64 dctrl-tools amd64 2.24-3+b1 [104 kB] Get: 92 http://deb.debian.org/debian bookworm/main amd64 libdebhelper-perl all 13.11.4 [81.2 kB] Get: 93 http://deb.debian.org/debian bookworm/main amd64 libtool all 2.4.7-5 [517 kB] Get: 94 http://deb.debian.org/debian bookworm/main amd64 dh-autoreconf all 20 [17.1 kB] Get: 95 http://deb.debian.org/debian bookworm/main amd64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 96 http://deb.debian.org/debian bookworm/main amd64 libsub-override-perl all 0.09-4 [9304 B] Get: 97 http://deb.debian.org/debian bookworm/main amd64 libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 98 http://deb.debian.org/debian bookworm/main amd64 dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 99 http://deb.debian.org/debian bookworm/main amd64 libelf1 amd64 0.188-2.1 [174 kB] Get: 100 http://deb.debian.org/debian bookworm/main amd64 dwz amd64 0.15-1 [109 kB] Get: 101 http://deb.debian.org/debian bookworm/main amd64 gettext amd64 0.21-12 [1300 kB] Get: 102 http://deb.debian.org/debian bookworm/main amd64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 103 http://deb.debian.org/debian bookworm/main amd64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 104 http://deb.debian.org/debian bookworm/main amd64 debhelper all 13.11.4 [942 kB] Get: 105 http://deb.debian.org/debian bookworm/main amd64 libgtk2.0-common all 2.24.33-2 [2700 kB] Get: 106 http://deb.debian.org/debian bookworm/main amd64 libatk1.0-0 amd64 2.46.0-5 [49.6 kB] Get: 107 http://deb.debian.org/debian bookworm/main amd64 libpixman-1-0 amd64 0.42.2-1 [546 kB] Get: 108 http://deb.debian.org/debian bookworm/main amd64 libxau6 amd64 1:1.0.9-1 [19.7 kB] Get: 109 http://deb.debian.org/debian bookworm/main amd64 libbsd0 amd64 0.11.7-2 [117 kB] Get: 110 http://deb.debian.org/debian bookworm/main amd64 libxdmcp6 amd64 1:1.1.2-3 [26.3 kB] Get: 111 http://deb.debian.org/debian bookworm/main amd64 libxcb1 amd64 1.15-1 [144 kB] Get: 112 http://deb.debian.org/debian bookworm/main amd64 libx11-data all 2:1.8.4-2 [292 kB] Get: 113 http://deb.debian.org/debian bookworm/main amd64 libx11-6 amd64 2:1.8.4-2 [759 kB] Get: 114 http://deb.debian.org/debian bookworm/main amd64 libxcb-render0 amd64 1.15-1 [115 kB] Get: 115 http://deb.debian.org/debian bookworm/main amd64 libxcb-shm0 amd64 1.15-1 [105 kB] Get: 116 http://deb.debian.org/debian bookworm/main amd64 libxext6 amd64 2:1.3.4-1+b1 [52.9 kB] Get: 117 http://deb.debian.org/debian bookworm/main amd64 libxrender1 amd64 1:0.9.10-1.1 [33.2 kB] Get: 118 http://deb.debian.org/debian bookworm/main amd64 libcairo2 amd64 1.16.0-7 [575 kB] Get: 119 http://deb.debian.org/debian bookworm/main amd64 fontconfig amd64 2.14.1-4 [449 kB] Get: 120 http://deb.debian.org/debian bookworm/main amd64 libfribidi0 amd64 1.0.8-2.1 [65.0 kB] Get: 121 http://deb.debian.org/debian bookworm/main amd64 libthai-data all 0.1.29-1 [176 kB] Get: 122 http://deb.debian.org/debian bookworm/main amd64 libdatrie1 amd64 0.2.13-2+b1 [43.3 kB] Get: 123 http://deb.debian.org/debian bookworm/main amd64 libthai0 amd64 0.1.29-1 [57.5 kB] Get: 124 http://deb.debian.org/debian bookworm/main amd64 libpango-1.0-0 amd64 1.50.12+ds-1 [212 kB] Get: 125 http://deb.debian.org/debian bookworm/main amd64 libpangoft2-1.0-0 amd64 1.50.12+ds-1 [47.4 kB] Get: 126 http://deb.debian.org/debian bookworm/main amd64 libpangocairo-1.0-0 amd64 1.50.12+ds-1 [34.2 kB] Get: 127 http://deb.debian.org/debian bookworm/main amd64 libxcomposite1 amd64 1:0.4.5-1 [16.6 kB] Get: 128 http://deb.debian.org/debian bookworm/main amd64 libxfixes3 amd64 1:6.0.0-2 [22.7 kB] Get: 129 http://deb.debian.org/debian bookworm/main amd64 libxcursor1 amd64 1:1.2.1-1 [40.9 kB] Get: 130 http://deb.debian.org/debian bookworm/main amd64 libxdamage1 amd64 1:1.1.6-1 [15.1 kB] Get: 131 http://deb.debian.org/debian bookworm/main amd64 libxi6 amd64 2:1.8-1+b1 [84.2 kB] Get: 132 http://deb.debian.org/debian bookworm/main amd64 libxinerama1 amd64 2:1.1.4-3 [17.8 kB] Get: 133 http://deb.debian.org/debian bookworm/main amd64 libxrandr2 amd64 2:1.5.2-2+b1 [39.2 kB] Get: 134 http://deb.debian.org/debian bookworm/main amd64 libgtk2.0-0 amd64 2.24.33-2 [1855 kB] Get: 135 http://deb.debian.org/debian bookworm/main amd64 libglvnd0 amd64 1.6.0-1 [51.8 kB] Get: 136 http://deb.debian.org/debian bookworm/main amd64 libdrm-common all 2.4.114-1 [7112 B] Get: 137 http://deb.debian.org/debian bookworm/main amd64 libdrm2 amd64 2.4.114-1+b1 [37.5 kB] Get: 138 http://deb.debian.org/debian bookworm/main amd64 libglapi-mesa amd64 22.3.6-1+deb12u1 [35.7 kB] Get: 139 http://deb.debian.org/debian bookworm/main amd64 libx11-xcb1 amd64 2:1.8.4-2 [192 kB] Get: 140 http://deb.debian.org/debian bookworm/main amd64 libxcb-dri2-0 amd64 1.15-1 [107 kB] Get: 141 http://deb.debian.org/debian bookworm/main amd64 libxcb-dri3-0 amd64 1.15-1 [107 kB] Get: 142 http://deb.debian.org/debian bookworm/main amd64 libxcb-glx0 amd64 1.15-1 [122 kB] Get: 143 http://deb.debian.org/debian bookworm/main amd64 libxcb-present0 amd64 1.15-1 [105 kB] Get: 144 http://deb.debian.org/debian bookworm/main amd64 libxcb-randr0 amd64 1.15-1 [117 kB] Get: 145 http://deb.debian.org/debian bookworm/main amd64 libxcb-sync1 amd64 1.15-1 [109 kB] Get: 146 http://deb.debian.org/debian bookworm/main amd64 libxcb-xfixes0 amd64 1.15-1 [109 kB] Get: 147 http://deb.debian.org/debian bookworm/main amd64 libxshmfence1 amd64 1.3-1 [8820 B] Get: 148 http://deb.debian.org/debian bookworm/main amd64 libxxf86vm1 amd64 1:1.1.4-1+b2 [20.8 kB] Get: 149 http://deb.debian.org/debian bookworm/main amd64 libdrm-amdgpu1 amd64 2.4.114-1+b1 [20.9 kB] Get: 150 http://deb.debian.org/debian bookworm/main amd64 libpciaccess0 amd64 0.17-2 [51.4 kB] Get: 151 http://deb.debian.org/debian bookworm/main amd64 libdrm-intel1 amd64 2.4.114-1+b1 [64.0 kB] Get: 152 http://deb.debian.org/debian bookworm/main amd64 libdrm-nouveau2 amd64 2.4.114-1+b1 [19.1 kB] Get: 153 http://deb.debian.org/debian bookworm/main amd64 libdrm-radeon1 amd64 2.4.114-1+b1 [21.8 kB] Get: 154 http://deb.debian.org/debian bookworm/main amd64 libedit2 amd64 3.1-20221030-2 [93.0 kB] Get: 155 http://deb.debian.org/debian bookworm/main amd64 libz3-4 amd64 4.8.12-3.1 [7216 kB] Get: 156 http://deb.debian.org/debian bookworm/main amd64 libllvm15 amd64 1:15.0.6-4+b1 [23.1 MB] Get: 157 http://deb.debian.org/debian bookworm/main amd64 libsensors-config all 1:3.6.0-7.1 [14.3 kB] Get: 158 http://deb.debian.org/debian bookworm/main amd64 libsensors5 amd64 1:3.6.0-7.1 [34.2 kB] Get: 159 http://deb.debian.org/debian bookworm/main amd64 libgl1-mesa-dri amd64 22.3.6-1+deb12u1 [7239 kB] Get: 160 http://deb.debian.org/debian bookworm/main amd64 libglx-mesa0 amd64 22.3.6-1+deb12u1 [147 kB] Get: 161 http://deb.debian.org/debian bookworm/main amd64 libglx0 amd64 1.6.0-1 [34.4 kB] Get: 162 http://deb.debian.org/debian bookworm/main amd64 libgl1 amd64 1.6.0-1 [88.4 kB] Get: 163 http://deb.debian.org/debian bookworm/main amd64 libgif7 amd64 5.2.1-2.5 [46.9 kB] Get: 164 http://deb.debian.org/debian bookworm/main amd64 x11-common all 1:7.7+23 [252 kB] Get: 165 http://deb.debian.org/debian bookworm/main amd64 libxtst6 amd64 2:1.2.3-1.1 [28.0 kB] Get: 166 http://deb.debian.org/debian bookworm/main amd64 openjdk-17-jre amd64 17.0.6+10-1 [168 kB] Get: 167 http://deb.debian.org/debian bookworm/main amd64 default-jre amd64 2:1.17-74 [1056 B] Get: 168 http://deb.debian.org/debian bookworm/main amd64 openjdk-17-jdk-headless amd64 17.0.6+10-1 [230 MB] Get: 169 http://deb.debian.org/debian bookworm/main amd64 default-jdk-headless amd64 2:1.17-74 [1108 B] Get: 170 http://deb.debian.org/debian bookworm/main amd64 openjdk-17-jdk amd64 17.0.6+10-1 [4577 kB] Get: 171 http://deb.debian.org/debian bookworm/main amd64 default-jdk amd64 2:1.17-74 [1068 B] Get: 172 http://deb.debian.org/debian bookworm/main amd64 libassuan0 amd64 2.5.5-5 [48.5 kB] Get: 173 http://deb.debian.org/debian bookworm/main amd64 gpgconf amd64 2.2.40-1.1 [564 kB] Get: 174 http://deb.debian.org/debian bookworm/main amd64 libksba8 amd64 1.6.3-2 [128 kB] Get: 175 http://deb.debian.org/debian bookworm/main amd64 libsasl2-modules-db amd64 2.1.28+dfsg-10 [20.3 kB] Get: 176 http://deb.debian.org/debian bookworm/main amd64 libsasl2-2 amd64 2.1.28+dfsg-10 [59.7 kB] Get: 177 http://deb.debian.org/debian bookworm/main amd64 libldap-2.5-0 amd64 2.5.13+dfsg-5 [183 kB] Get: 178 http://deb.debian.org/debian bookworm/main amd64 libnpth0 amd64 1.6-3 [19.0 kB] Get: 179 http://deb.debian.org/debian bookworm/main amd64 dirmngr amd64 2.2.40-1.1 [792 kB] Get: 180 http://deb.debian.org/debian bookworm/main amd64 gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 181 http://deb.debian.org/debian bookworm/main amd64 gnupg-utils amd64 2.2.40-1.1 [927 kB] Get: 182 http://deb.debian.org/debian bookworm/main amd64 gpg amd64 2.2.40-1.1 [949 kB] Get: 183 http://deb.debian.org/debian bookworm/main amd64 pinentry-curses amd64 1.2.1-1 [77.4 kB] Get: 184 http://deb.debian.org/debian bookworm/main amd64 gpg-agent amd64 2.2.40-1.1 [695 kB] Get: 185 http://deb.debian.org/debian bookworm/main amd64 gpg-wks-client amd64 2.2.40-1.1 [541 kB] Get: 186 http://deb.debian.org/debian bookworm/main amd64 gpg-wks-server amd64 2.2.40-1.1 [531 kB] Get: 187 http://deb.debian.org/debian bookworm/main amd64 gpgsm amd64 2.2.40-1.1 [671 kB] Get: 188 http://deb.debian.org/debian bookworm/main amd64 gnupg all 2.2.40-1.1 [846 kB] Get: 189 http://deb.debian.org/debian bookworm/main amd64 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 190 http://deb.debian.org/debian bookworm/main amd64 libfile-which-perl all 1.27-2 [15.1 kB] Get: 191 http://deb.debian.org/debian bookworm/main amd64 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 192 http://deb.debian.org/debian bookworm/main amd64 libfile-touch-perl all 0.12-2 [8816 B] Get: 193 http://deb.debian.org/debian bookworm/main amd64 libio-pty-perl amd64 1:1.17-1 [34.9 kB] Get: 194 http://deb.debian.org/debian bookworm/main amd64 libipc-run-perl all 20220807.0-1 [104 kB] Get: 195 http://deb.debian.org/debian bookworm/main amd64 libclass-method-modifiers-perl all 2.14-1 [18.1 kB] Get: 196 http://deb.debian.org/debian bookworm/main amd64 libclass-xsaccessor-perl amd64 1.19-4+b1 [36.4 kB] Get: 197 http://deb.debian.org/debian bookworm/main amd64 libb-hooks-op-check-perl amd64 0.22-2+b1 [10.5 kB] Get: 198 http://deb.debian.org/debian bookworm/main amd64 libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 199 http://deb.debian.org/debian bookworm/main amd64 libdevel-callchecker-perl amd64 0.008-2 [15.8 kB] Get: 200 http://deb.debian.org/debian bookworm/main amd64 libparams-classify-perl amd64 0.015-2+b1 [23.1 kB] Get: 201 http://deb.debian.org/debian bookworm/main amd64 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 202 http://deb.debian.org/debian bookworm/main amd64 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 203 http://deb.debian.org/debian bookworm/main amd64 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 204 http://deb.debian.org/debian bookworm/main amd64 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 205 http://deb.debian.org/debian bookworm/main amd64 libmoo-perl all 2.005005-1 [58.0 kB] Get: 206 http://deb.debian.org/debian bookworm/main amd64 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 207 http://deb.debian.org/debian bookworm/main amd64 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 208 http://deb.debian.org/debian bookworm/main amd64 libhttp-date-perl all 6.05-2 [10.5 kB] Get: 209 http://deb.debian.org/debian bookworm/main amd64 libfile-listing-perl all 6.15-1 [12.6 kB] Get: 210 http://deb.debian.org/debian bookworm/main amd64 libhtml-tagset-perl all 3.20-6 [11.7 kB] Get: 211 http://deb.debian.org/debian bookworm/main amd64 libregexp-ipv6-perl all 0.03-3 [5212 B] Get: 212 http://deb.debian.org/debian bookworm/main amd64 liburi-perl all 5.17-1 [90.4 kB] Get: 213 http://deb.debian.org/debian bookworm/main amd64 libhtml-parser-perl amd64 3.81-1 [101 kB] Get: 214 http://deb.debian.org/debian bookworm/main amd64 libhtml-tree-perl all 5.07-3 [211 kB] Get: 215 http://deb.debian.org/debian bookworm/main amd64 libclone-perl amd64 0.46-1 [13.7 kB] Get: 216 http://deb.debian.org/debian bookworm/main amd64 libio-html-perl all 1.004-3 [16.2 kB] Get: 217 http://deb.debian.org/debian bookworm/main amd64 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 218 http://deb.debian.org/debian bookworm/main amd64 libhttp-message-perl all 6.44-1 [81.7 kB] Get: 219 http://deb.debian.org/debian bookworm/main amd64 libhttp-cookies-perl all 6.10-1 [19.6 kB] Get: 220 http://deb.debian.org/debian bookworm/main amd64 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 221 http://deb.debian.org/debian bookworm/main amd64 perl-openssl-defaults amd64 7+b1 [7924 B] Get: 222 http://deb.debian.org/debian bookworm/main amd64 libnet-ssleay-perl amd64 1.92-2+b1 [317 kB] Get: 223 http://deb.debian.org/debian bookworm/main amd64 libio-socket-ssl-perl all 2.081-2 [219 kB] Get: 224 http://deb.debian.org/debian bookworm/main amd64 libnet-http-perl all 6.22-1 [25.3 kB] Get: 225 http://deb.debian.org/debian bookworm/main amd64 liblwp-protocol-https-perl all 6.10-1 [12.2 kB] Get: 226 http://deb.debian.org/debian bookworm/main amd64 libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 227 http://deb.debian.org/debian bookworm/main amd64 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 228 http://deb.debian.org/debian bookworm/main amd64 libwww-perl all 6.68-1 [186 kB] Get: 229 http://deb.debian.org/debian bookworm/main amd64 patchutils amd64 0.4.2-1 [77.5 kB] Get: 230 http://deb.debian.org/debian bookworm/main amd64 wdiff amd64 1.2.2-5 [119 kB] Get: 231 http://deb.debian.org/debian bookworm/main amd64 devscripts amd64 2.23.3 [1072 kB] Get: 232 http://deb.debian.org/debian bookworm/main amd64 ivy all 2.5.1-2 [1288 kB] Get: 233 http://deb.debian.org/debian bookworm/main amd64 libasm-java all 9.4-1 [389 kB] Get: 234 http://deb.debian.org/debian bookworm/main amd64 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 235 http://deb.debian.org/debian bookworm/main amd64 libcommons-cli-java all 1.5.0-1 [60.0 kB] Get: 236 http://deb.debian.org/debian bookworm/main amd64 libapache-pom-java all 29-2 [5276 B] Get: 237 http://deb.debian.org/debian bookworm/main amd64 libcommons-parent-java all 56-1 [10.8 kB] Get: 238 http://deb.debian.org/debian bookworm/main amd64 libcommons-logging-java all 1.2-3 [62.4 kB] Get: 239 http://deb.debian.org/debian bookworm/main amd64 libjansi-java all 2.4.0-2 [105 kB] Get: 240 http://deb.debian.org/debian bookworm/main amd64 libqdox-java all 1.12.1-3 [172 kB] Get: 241 http://deb.debian.org/debian bookworm/main amd64 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 242 http://deb.debian.org/debian bookworm/main amd64 libxpp3-java all 1.1.4c-3 [292 kB] Get: 243 http://deb.debian.org/debian bookworm/main amd64 libxstream-java all 1.4.20-1 [565 kB] Get: 244 http://deb.debian.org/debian bookworm/main amd64 groovy all 2.4.21-7 [12.9 MB] Get: 245 http://deb.debian.org/debian bookworm/main amd64 libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 246 http://deb.debian.org/debian bookworm/main amd64 libcommons-collections3-java all 3.2.2-2 [526 kB] Get: 247 http://deb.debian.org/debian bookworm/main amd64 libcommons-compress-java all 1.22-1 [615 kB] Get: 248 http://deb.debian.org/debian bookworm/main amd64 libcommons-io-java all 2.11.0-2 [319 kB] Get: 249 http://deb.debian.org/debian bookworm/main amd64 libcommons-lang-java all 2.6-10 [273 kB] Get: 250 http://deb.debian.org/debian bookworm/main amd64 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 251 http://deb.debian.org/debian bookworm/main amd64 libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 252 http://deb.debian.org/debian bookworm/main amd64 libguava-java all 31.1-1 [2613 kB] Get: 253 http://deb.debian.org/debian bookworm/main amd64 libcommons-codec-java all 1.15-1 [292 kB] Get: 254 http://deb.debian.org/debian bookworm/main amd64 libhttpcore-java all 4.4.16-1 [636 kB] Get: 255 http://deb.debian.org/debian bookworm/main amd64 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 256 http://deb.debian.org/debian bookworm/main amd64 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 257 http://deb.debian.org/debian bookworm/main amd64 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 258 http://deb.debian.org/debian bookworm/main amd64 libjna-jni amd64 5.13.0-2 [63.3 kB] Get: 259 http://deb.debian.org/debian bookworm/main amd64 libjna-java all 5.13.0-2 [236 kB] Get: 260 http://deb.debian.org/debian bookworm/main amd64 libjzlib-java all 1.1.3-2 [80.0 kB] Get: 261 http://deb.debian.org/debian bookworm/main amd64 libjsch-java all 0.1.55-1 [298 kB] Get: 262 http://deb.debian.org/debian bookworm/main amd64 libminlog-java all 1.3.0-1.1 [7928 B] Get: 263 http://deb.debian.org/debian bookworm/main amd64 libobjenesis-java all 3.3-3 [41.3 kB] Get: 264 http://deb.debian.org/debian bookworm/main amd64 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 265 http://deb.debian.org/debian bookworm/main amd64 libkryo-java all 2.20-7 [158 kB] Get: 266 http://deb.debian.org/debian bookworm/main amd64 liblogback-java all 1:1.2.11-2 [700 kB] Get: 267 http://deb.debian.org/debian bookworm/main amd64 libncurses6 amd64 6.4-2 [103 kB] Get: 268 http://deb.debian.org/debian bookworm/main amd64 libnative-platform-jni amd64 0.14-5 [13.0 kB] Get: 269 http://deb.debian.org/debian bookworm/main amd64 libnative-platform-java all 0.14-5 [71.0 kB] Get: 270 http://deb.debian.org/debian bookworm/main amd64 libxml-commons-external-java all 1.4.01-5 [240 kB] Get: 271 http://deb.debian.org/debian bookworm/main amd64 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 272 http://deb.debian.org/debian bookworm/main amd64 libxerces2-java all 2.12.2-1 [1440 kB] Get: 273 http://deb.debian.org/debian bookworm/main amd64 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 274 http://deb.debian.org/debian bookworm/main amd64 libxbean-reflect-java all 4.5-8 [133 kB] Get: 275 http://deb.debian.org/debian bookworm/main amd64 libgradle-core-java all 4.4.1-18 [4286 kB] Get: 276 http://deb.debian.org/debian bookworm/main amd64 libbcprov-java all 1.72-2 [8225 kB] Get: 277 http://deb.debian.org/debian bookworm/main amd64 libbcpg-java all 1.72-2 [383 kB] Get: 278 http://deb.debian.org/debian bookworm/main amd64 libbsh-java all 2.0b4-20 [291 kB] Get: 279 http://deb.debian.org/debian bookworm/main amd64 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 280 http://deb.debian.org/debian bookworm/main amd64 libjaxen-java all 1.1.6-4 [214 kB] Get: 281 http://deb.debian.org/debian bookworm/main amd64 libdom4j-java all 2.1.3-2 [310 kB] Get: 282 http://deb.debian.org/debian bookworm/main amd64 libbcel-java all 6.5.0-2 [634 kB] Get: 283 http://deb.debian.org/debian bookworm/main amd64 libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 284 http://deb.debian.org/debian bookworm/main amd64 libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 285 http://deb.debian.org/debian bookworm/main amd64 libgoogle-gson-java all 2.10-1 [261 kB] Get: 286 http://deb.debian.org/debian bookworm/main amd64 libaopalliance-java all 20070526-7 [8572 B] Get: 287 http://deb.debian.org/debian bookworm/main amd64 libguice-java all 4.2.3-2 [1435 kB] Get: 288 http://deb.debian.org/debian bookworm/main amd64 libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 289 http://deb.debian.org/debian bookworm/main amd64 libjcifs-java all 1.3.19-2 [394 kB] Get: 290 http://deb.debian.org/debian bookworm/main amd64 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 291 http://deb.debian.org/debian bookworm/main amd64 libjavaewah-java all 1.1.7-1 [156 kB] Get: 292 http://deb.debian.org/debian bookworm/main amd64 libel-api-java all 3.0.0-3 [64.9 kB] Get: 293 http://deb.debian.org/debian bookworm/main amd64 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 294 http://deb.debian.org/debian bookworm/main amd64 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 295 http://deb.debian.org/debian bookworm/main amd64 libjetty9-java all 9.4.50-3 [2962 kB] Get: 296 http://deb.debian.org/debian bookworm/main amd64 libjgit-java all 4.11.9-2 [2534 kB] Get: 297 http://deb.debian.org/debian bookworm/main amd64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 298 http://deb.debian.org/debian bookworm/main amd64 libcommons-lang3-java all 3.12.0-2 [561 kB] Get: 299 http://deb.debian.org/debian bookworm/main amd64 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 300 http://deb.debian.org/debian bookworm/main amd64 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 301 http://deb.debian.org/debian bookworm/main amd64 libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 302 http://deb.debian.org/debian bookworm/main amd64 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 303 http://deb.debian.org/debian bookworm/main amd64 libmaven-parent-java all 35-1 [6140 B] Get: 304 http://deb.debian.org/debian bookworm/main amd64 libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 305 http://deb.debian.org/debian bookworm/main amd64 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 306 http://deb.debian.org/debian bookworm/main amd64 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 307 http://deb.debian.org/debian bookworm/main amd64 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 308 http://deb.debian.org/debian bookworm/main amd64 libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 309 http://deb.debian.org/debian bookworm/main amd64 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 310 http://deb.debian.org/debian bookworm/main amd64 libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 311 http://deb.debian.org/debian bookworm/main amd64 libcdi-api-java all 1.2-3 [54.3 kB] Get: 312 http://deb.debian.org/debian bookworm/main amd64 libsisu-inject-java all 0.3.4-2 [347 kB] Get: 313 http://deb.debian.org/debian bookworm/main amd64 libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 314 http://deb.debian.org/debian bookworm/main amd64 libmaven3-core-java all 3.8.7-1 [1572 kB] Get: 315 http://deb.debian.org/debian bookworm/main amd64 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 316 http://deb.debian.org/debian bookworm/main amd64 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 317 http://deb.debian.org/debian bookworm/main amd64 librhino-java all 1.7.14-2.1 [1357 kB] Get: 318 http://deb.debian.org/debian bookworm/main amd64 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 319 http://deb.debian.org/debian bookworm/main amd64 libwagon-file-java all 3.5.3-1 [8388 B] Get: 320 http://deb.debian.org/debian bookworm/main amd64 libjsoup-java all 1.15.3-1 [431 kB] Get: 321 http://deb.debian.org/debian bookworm/main amd64 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 322 http://deb.debian.org/debian bookworm/main amd64 libjcommander-java all 1.71-4 [73.0 kB] Get: 323 http://deb.debian.org/debian bookworm/main amd64 testng all 6.9.12-4 [795 kB] Get: 324 http://deb.debian.org/debian bookworm/main amd64 libgradle-plugins-java all 4.4.1-18 [5212 kB] Get: 325 http://deb.debian.org/debian bookworm/main amd64 gradle all 4.4.1-18 [398 kB] Get: 326 http://deb.debian.org/debian bookworm/main amd64 maven-repo-helper all 1.11 [142 kB] Get: 327 http://deb.debian.org/debian bookworm/main amd64 gradle-debian-helper all 2.4 [24.5 kB] Get: 328 http://deb.debian.org/debian bookworm/main amd64 javahelper all 0.78 [97.2 kB] Get: 329 http://deb.debian.org/debian bookworm/main amd64 libbyte-buddy-java all 1.12.21-1 [4393 kB] Get: 330 http://deb.debian.org/debian bookworm/main amd64 libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 331 http://deb.debian.org/debian bookworm/main amd64 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 332 http://deb.debian.org/debian bookworm/main amd64 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 333 http://deb.debian.org/debian bookworm/main amd64 libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 334 http://deb.debian.org/debian bookworm/main amd64 liblz4-jni amd64 1.8.0-3 [9656 B] Get: 335 http://deb.debian.org/debian bookworm/main amd64 liblz4-java all 1.8.0-3 [114 kB] Get: 336 http://deb.debian.org/debian bookworm/main amd64 libmockito-java all 2.23.0-2 [479 kB] Get: 337 http://deb.debian.org/debian bookworm/main amd64 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 338 http://deb.debian.org/debian bookworm/main amd64 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 473 MB in 6s (77.6 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:amd64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19596 files and directories currently installed.) Preparing to unpack .../libpython3.11-minimal_3.11.2-6_amd64.deb ... Unpacking libpython3.11-minimal:amd64 (3.11.2-6) ... Selecting previously unselected package libexpat1:amd64. Preparing to unpack .../libexpat1_2.5.0-1_amd64.deb ... Unpacking libexpat1:amd64 (2.5.0-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.2-6_amd64.deb ... Unpacking python3.11-minimal (3.11.2-6) ... Setting up libpython3.11-minimal:amd64 (3.11.2-6) ... Setting up libexpat1:amd64 (2.5.0-1) ... Setting up python3.11-minimal (3.11.2-6) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19912 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.2-1+b1_amd64.deb ... Unpacking python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.0.0_all.deb ... Unpacking media-types (10.0.0) ... Selecting previously unselected package readline-common. Preparing to unpack .../2-readline-common_8.2-1.3_all.deb ... Unpacking readline-common (8.2-1.3) ... Selecting previously unselected package libreadline8:amd64. Preparing to unpack .../3-libreadline8_8.2-1.3_amd64.deb ... Unpacking libreadline8:amd64 (8.2-1.3) ... Selecting previously unselected package libpython3.11-stdlib:amd64. Preparing to unpack .../4-libpython3.11-stdlib_3.11.2-6_amd64.deb ... Unpacking libpython3.11-stdlib:amd64 (3.11.2-6) ... Selecting previously unselected package python3.11. Preparing to unpack .../5-python3.11_3.11.2-6_amd64.deb ... Unpacking python3.11 (3.11.2-6) ... Selecting previously unselected package libpython3-stdlib:amd64. Preparing to unpack .../6-libpython3-stdlib_3.11.2-1+b1_amd64.deb ... Unpacking libpython3-stdlib:amd64 (3.11.2-1+b1) ... Setting up python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20346 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.2-1+b1_amd64.deb ... Unpacking python3 (3.11.2-1+b1) ... Selecting previously unselected package netbase. Preparing to unpack .../001-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../002-sensible-utils_0.0.17+nmu1_all.deb ... Unpacking sensible-utils (0.0.17+nmu1) ... Selecting previously unselected package openssl. Preparing to unpack .../003-openssl_3.0.8-1_amd64.deb ... Unpacking openssl (3.0.8-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../004-ca-certificates_20230311_all.deb ... Unpacking ca-certificates (20230311) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../005-libmagic-mgc_1%3a5.44-3_amd64.deb ... Unpacking libmagic-mgc (1:5.44-3) ... Selecting previously unselected package libmagic1:amd64. Preparing to unpack .../006-libmagic1_1%3a5.44-3_amd64.deb ... Unpacking libmagic1:amd64 (1:5.44-3) ... Selecting previously unselected package file. Preparing to unpack .../007-file_1%3a5.44-3_amd64.deb ... Unpacking file (1:5.44-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../008-gettext-base_0.21-12_amd64.deb ... Unpacking gettext-base (0.21-12) ... Selecting previously unselected package libuchardet0:amd64. Preparing to unpack .../009-libuchardet0_0.0.7-1_amd64.deb ... Unpacking libuchardet0:amd64 (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../010-groff-base_1.22.4-10_amd64.deb ... Unpacking groff-base (1.22.4-10) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../011-bsdextrautils_2.38.1-5+b1_amd64.deb ... Unpacking bsdextrautils (2.38.1-5+b1) ... Selecting previously unselected package libpipeline1:amd64. Preparing to unpack .../012-libpipeline1_1.5.7-1_amd64.deb ... Unpacking libpipeline1:amd64 (1.5.7-1) ... Selecting previously unselected package man-db. Preparing to unpack .../013-man-db_2.11.2-2_amd64.deb ... Unpacking man-db (2.11.2-2) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../014-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.10+dfsg-1_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Selecting previously unselected package libglib2.0-0:amd64. Preparing to unpack .../016-libglib2.0-0_2.74.6-2_amd64.deb ... Unpacking libglib2.0-0:amd64 (2.74.6-2) ... Selecting previously unselected package libicu72:amd64. Preparing to unpack .../017-libicu72_72.1-3_amd64.deb ... Unpacking libicu72:amd64 (72.1-3) ... Selecting previously unselected package libxml2:amd64. Preparing to unpack .../018-libxml2_2.9.14+dfsg-1.2_amd64.deb ... Unpacking libxml2:amd64 (2.9.14+dfsg-1.2) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.2-1_amd64.deb ... Unpacking shared-mime-info (2.2-1) ... Selecting previously unselected package libjpeg62-turbo:amd64. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-2_amd64.deb ... Unpacking libjpeg62-turbo:amd64 (1:2.1.5-2) ... Selecting previously unselected package libpng16-16:amd64. Preparing to unpack .../021-libpng16-16_1.6.39-2_amd64.deb ... Unpacking libpng16-16:amd64 (1.6.39-2) ... Selecting previously unselected package libdeflate0:amd64. Preparing to unpack .../022-libdeflate0_1.14-1_amd64.deb ... Unpacking libdeflate0:amd64 (1.14-1) ... Selecting previously unselected package libjbig0:amd64. Preparing to unpack .../023-libjbig0_2.1-6.1_amd64.deb ... Unpacking libjbig0:amd64 (2.1-6.1) ... Selecting previously unselected package liblerc4:amd64. Preparing to unpack .../024-liblerc4_4.0.0+ds-2_amd64.deb ... Unpacking liblerc4:amd64 (4.0.0+ds-2) ... Selecting previously unselected package libwebp7:amd64. Preparing to unpack .../025-libwebp7_1.2.4-0.1_amd64.deb ... Unpacking libwebp7:amd64 (1.2.4-0.1) ... Selecting previously unselected package libtiff6:amd64. Preparing to unpack .../026-libtiff6_4.5.0-5_amd64.deb ... Unpacking libtiff6:amd64 (4.5.0-5) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:amd64. Preparing to unpack .../027-libgdk-pixbuf-2.0-0_2.42.10+dfsg-1+b1_amd64.deb ... Unpacking libgdk-pixbuf-2.0-0:amd64 (2.42.10+dfsg-1+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../028-gtk-update-icon-cache_3.24.37-2_amd64.deb ... Unpacking gtk-update-icon-cache (3.24.37-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../029-adwaita-icon-theme_43-1_all.deb ... Unpacking adwaita-icon-theme (43-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../030-ca-certificates-java_20230103_all.deb ... Unpacking ca-certificates-java (20230103) ... Selecting previously unselected package java-common. Preparing to unpack .../031-java-common_0.74_all.deb ... Unpacking java-common (0.74) ... Selecting previously unselected package libavahi-common-data:amd64. Preparing to unpack .../032-libavahi-common-data_0.8-10_amd64.deb ... Unpacking libavahi-common-data:amd64 (0.8-10) ... Selecting previously unselected package libavahi-common3:amd64. Preparing to unpack .../033-libavahi-common3_0.8-10_amd64.deb ... Unpacking libavahi-common3:amd64 (0.8-10) ... Selecting previously unselected package libdbus-1-3:amd64. Preparing to unpack .../034-libdbus-1-3_1.14.6-1_amd64.deb ... Unpacking libdbus-1-3:amd64 (1.14.6-1) ... Selecting previously unselected package libavahi-client3:amd64. Preparing to unpack .../035-libavahi-client3_0.8-10_amd64.deb ... Unpacking libavahi-client3:amd64 (0.8-10) ... Selecting previously unselected package libcups2:amd64. Preparing to unpack .../036-libcups2_2.4.2-3_amd64.deb ... Unpacking libcups2:amd64 (2.4.2-3) ... Selecting previously unselected package liblcms2-2:amd64. Preparing to unpack .../037-liblcms2-2_2.14-2_amd64.deb ... Unpacking liblcms2-2:amd64 (2.14-2) ... Selecting previously unselected package libbrotli1:amd64. Preparing to unpack .../038-libbrotli1_1.0.9-2+b6_amd64.deb ... Unpacking libbrotli1:amd64 (1.0.9-2+b6) ... Selecting previously unselected package libfreetype6:amd64. Preparing to unpack .../039-libfreetype6_2.12.1+dfsg-4_amd64.deb ... Unpacking libfreetype6:amd64 (2.12.1+dfsg-4) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-6_all.deb ... Unpacking fonts-dejavu-core (2.37-6) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.14.1-4_amd64.deb ... Unpacking fontconfig-config (2.14.1-4) ... Selecting previously unselected package libfontconfig1:amd64. Preparing to unpack .../042-libfontconfig1_2.14.1-4_amd64.deb ... Unpacking libfontconfig1:amd64 (2.14.1-4) ... Selecting previously unselected package libnspr4:amd64. Preparing to unpack .../043-libnspr4_2%3a4.35-1_amd64.deb ... Unpacking libnspr4:amd64 (2:4.35-1) ... Selecting previously unselected package libnss3:amd64. Preparing to unpack .../044-libnss3_2%3a3.87.1-1_amd64.deb ... Unpacking libnss3:amd64 (2:3.87.1-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.8-1_all.deb ... Unpacking libasound2-data (1.2.8-1) ... Selecting previously unselected package libasound2:amd64. Preparing to unpack .../046-libasound2_1.2.8-1+b1_amd64.deb ... Unpacking libasound2:amd64 (1.2.8-1+b1) ... Selecting previously unselected package libgraphite2-3:amd64. Preparing to unpack .../047-libgraphite2-3_1.3.14-1_amd64.deb ... Unpacking libgraphite2-3:amd64 (1.3.14-1) ... Selecting previously unselected package libharfbuzz0b:amd64. Preparing to unpack .../048-libharfbuzz0b_6.0.0+dfsg-3_amd64.deb ... Unpacking libharfbuzz0b:amd64 (6.0.0+dfsg-3) ... Selecting previously unselected package libpcsclite1:amd64. Preparing to unpack .../049-libpcsclite1_1.9.9-2_amd64.deb ... Unpacking libpcsclite1:amd64 (1.9.9-2) ... Selecting previously unselected package openjdk-17-jre-headless:amd64. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.6+10-1_amd64.deb ... Unpacking openjdk-17-jre-headless:amd64 (17.0.6+10-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-74_amd64.deb ... Unpacking default-jre-headless (2:1.17-74) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.13-1_all.deb ... Unpacking ant (1.10.13-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.13-1_all.deb ... Unpacking ant-optional (1.10.13-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-12_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-12) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-12_all.deb ... Unpacking antlr (2.7.7+dfsg-12) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.46.0-5_all.deb ... Unpacking at-spi2-common (2.46.0-5) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-3_amd64.deb ... Unpacking m4 (1.4.19-3) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-12_all.deb ... Unpacking autopoint (0.21-12) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_amd64.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-1_all.deb ... Unpacking libhamcrest-java (2.2-1) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-3_all.deb ... Unpacking junit4 (4.13.2-3) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-1_all.deb ... Unpacking libjansi-native-java (1.8-1) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-3_all.deb ... Unpacking bnd (5.0.1-3) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3+b1_amd64.deb ... Unpacking dctrl-tools (2.24-3+b1) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.11.4_all.deb ... Unpacking libdebhelper-perl (13.11.4) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-5_all.deb ... Unpacking libtool (2.4.7-5) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.09-4_all.deb ... Unpacking libsub-override-perl (0.09-4) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:amd64. Preparing to unpack .../088-libelf1_0.188-2.1_amd64.deb ... Unpacking libelf1:amd64 (0.188-2.1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_amd64.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-12_amd64.deb ... Unpacking gettext (0.21-12) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.11.4_all.deb ... Unpacking debhelper (13.11.4) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-2_all.deb ... Unpacking libgtk2.0-common (2.24.33-2) ... Selecting previously unselected package libatk1.0-0:amd64. Preparing to unpack .../095-libatk1.0-0_2.46.0-5_amd64.deb ... Unpacking libatk1.0-0:amd64 (2.46.0-5) ... Selecting previously unselected package libpixman-1-0:amd64. Preparing to unpack .../096-libpixman-1-0_0.42.2-1_amd64.deb ... Unpacking libpixman-1-0:amd64 (0.42.2-1) ... Selecting previously unselected package libxau6:amd64. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_amd64.deb ... Unpacking libxau6:amd64 (1:1.0.9-1) ... Selecting previously unselected package libbsd0:amd64. Preparing to unpack .../098-libbsd0_0.11.7-2_amd64.deb ... Unpacking libbsd0:amd64 (0.11.7-2) ... Selecting previously unselected package libxdmcp6:amd64. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_amd64.deb ... Unpacking libxdmcp6:amd64 (1:1.1.2-3) ... Selecting previously unselected package libxcb1:amd64. Preparing to unpack .../100-libxcb1_1.15-1_amd64.deb ... Unpacking libxcb1:amd64 (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.4-2_all.deb ... Unpacking libx11-data (2:1.8.4-2) ... Selecting previously unselected package libx11-6:amd64. Preparing to unpack .../102-libx11-6_2%3a1.8.4-2_amd64.deb ... Unpacking libx11-6:amd64 (2:1.8.4-2) ... Selecting previously unselected package libxcb-render0:amd64. Preparing to unpack .../103-libxcb-render0_1.15-1_amd64.deb ... Unpacking libxcb-render0:amd64 (1.15-1) ... Selecting previously unselected package libxcb-shm0:amd64. Preparing to unpack .../104-libxcb-shm0_1.15-1_amd64.deb ... Unpacking libxcb-shm0:amd64 (1.15-1) ... Selecting previously unselected package libxext6:amd64. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_amd64.deb ... Unpacking libxext6:amd64 (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:amd64. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_amd64.deb ... Unpacking libxrender1:amd64 (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:amd64. Preparing to unpack .../107-libcairo2_1.16.0-7_amd64.deb ... Unpacking libcairo2:amd64 (1.16.0-7) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.14.1-4_amd64.deb ... Unpacking fontconfig (2.14.1-4) ... Selecting previously unselected package libfribidi0:amd64. Preparing to unpack .../109-libfribidi0_1.0.8-2.1_amd64.deb ... Unpacking libfribidi0:amd64 (1.0.8-2.1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-1_all.deb ... Unpacking libthai-data (0.1.29-1) ... Selecting previously unselected package libdatrie1:amd64. Preparing to unpack .../111-libdatrie1_0.2.13-2+b1_amd64.deb ... Unpacking libdatrie1:amd64 (0.2.13-2+b1) ... Selecting previously unselected package libthai0:amd64. Preparing to unpack .../112-libthai0_0.1.29-1_amd64.deb ... Unpacking libthai0:amd64 (0.1.29-1) ... Selecting previously unselected package libpango-1.0-0:amd64. Preparing to unpack .../113-libpango-1.0-0_1.50.12+ds-1_amd64.deb ... Unpacking libpango-1.0-0:amd64 (1.50.12+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:amd64. Preparing to unpack .../114-libpangoft2-1.0-0_1.50.12+ds-1_amd64.deb ... Unpacking libpangoft2-1.0-0:amd64 (1.50.12+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:amd64. Preparing to unpack .../115-libpangocairo-1.0-0_1.50.12+ds-1_amd64.deb ... Unpacking libpangocairo-1.0-0:amd64 (1.50.12+ds-1) ... Selecting previously unselected package libxcomposite1:amd64. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_amd64.deb ... Unpacking libxcomposite1:amd64 (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:amd64. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_amd64.deb ... Unpacking libxfixes3:amd64 (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:amd64. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_amd64.deb ... Unpacking libxcursor1:amd64 (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:amd64. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_amd64.deb ... Unpacking libxdamage1:amd64 (1:1.1.6-1) ... Selecting previously unselected package libxi6:amd64. Preparing to unpack .../120-libxi6_2%3a1.8-1+b1_amd64.deb ... Unpacking libxi6:amd64 (2:1.8-1+b1) ... Selecting previously unselected package libxinerama1:amd64. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_amd64.deb ... Unpacking libxinerama1:amd64 (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:amd64. Preparing to unpack .../122-libxrandr2_2%3a1.5.2-2+b1_amd64.deb ... Unpacking libxrandr2:amd64 (2:1.5.2-2+b1) ... Selecting previously unselected package libgtk2.0-0:amd64. Preparing to unpack .../123-libgtk2.0-0_2.24.33-2_amd64.deb ... Unpacking libgtk2.0-0:amd64 (2.24.33-2) ... Selecting previously unselected package libglvnd0:amd64. Preparing to unpack .../124-libglvnd0_1.6.0-1_amd64.deb ... Unpacking libglvnd0:amd64 (1.6.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.114-1_all.deb ... Unpacking libdrm-common (2.4.114-1) ... Selecting previously unselected package libdrm2:amd64. Preparing to unpack .../126-libdrm2_2.4.114-1+b1_amd64.deb ... Unpacking libdrm2:amd64 (2.4.114-1+b1) ... Selecting previously unselected package libglapi-mesa:amd64. Preparing to unpack .../127-libglapi-mesa_22.3.6-1+deb12u1_amd64.deb ... Unpacking libglapi-mesa:amd64 (22.3.6-1+deb12u1) ... Selecting previously unselected package libx11-xcb1:amd64. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.4-2_amd64.deb ... Unpacking libx11-xcb1:amd64 (2:1.8.4-2) ... Selecting previously unselected package libxcb-dri2-0:amd64. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_amd64.deb ... Unpacking libxcb-dri2-0:amd64 (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:amd64. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_amd64.deb ... Unpacking libxcb-dri3-0:amd64 (1.15-1) ... Selecting previously unselected package libxcb-glx0:amd64. Preparing to unpack .../131-libxcb-glx0_1.15-1_amd64.deb ... Unpacking libxcb-glx0:amd64 (1.15-1) ... Selecting previously unselected package libxcb-present0:amd64. Preparing to unpack .../132-libxcb-present0_1.15-1_amd64.deb ... Unpacking libxcb-present0:amd64 (1.15-1) ... Selecting previously unselected package libxcb-randr0:amd64. Preparing to unpack .../133-libxcb-randr0_1.15-1_amd64.deb ... Unpacking libxcb-randr0:amd64 (1.15-1) ... Selecting previously unselected package libxcb-sync1:amd64. Preparing to unpack .../134-libxcb-sync1_1.15-1_amd64.deb ... Unpacking libxcb-sync1:amd64 (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:amd64. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_amd64.deb ... Unpacking libxcb-xfixes0:amd64 (1.15-1) ... Selecting previously unselected package libxshmfence1:amd64. Preparing to unpack .../136-libxshmfence1_1.3-1_amd64.deb ... Unpacking libxshmfence1:amd64 (1.3-1) ... Selecting previously unselected package libxxf86vm1:amd64. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_amd64.deb ... Unpacking libxxf86vm1:amd64 (1:1.1.4-1+b2) ... Selecting previously unselected package libdrm-amdgpu1:amd64. Preparing to unpack .../138-libdrm-amdgpu1_2.4.114-1+b1_amd64.deb ... Unpacking libdrm-amdgpu1:amd64 (2.4.114-1+b1) ... Selecting previously unselected package libpciaccess0:amd64. Preparing to unpack .../139-libpciaccess0_0.17-2_amd64.deb ... Unpacking libpciaccess0:amd64 (0.17-2) ... Selecting previously unselected package libdrm-intel1:amd64. Preparing to unpack .../140-libdrm-intel1_2.4.114-1+b1_amd64.deb ... Unpacking libdrm-intel1:amd64 (2.4.114-1+b1) ... Selecting previously unselected package libdrm-nouveau2:amd64. Preparing to unpack .../141-libdrm-nouveau2_2.4.114-1+b1_amd64.deb ... Unpacking libdrm-nouveau2:amd64 (2.4.114-1+b1) ... Selecting previously unselected package libdrm-radeon1:amd64. Preparing to unpack .../142-libdrm-radeon1_2.4.114-1+b1_amd64.deb ... Unpacking libdrm-radeon1:amd64 (2.4.114-1+b1) ... Selecting previously unselected package libedit2:amd64. Preparing to unpack .../143-libedit2_3.1-20221030-2_amd64.deb ... Unpacking libedit2:amd64 (3.1-20221030-2) ... Selecting previously unselected package libz3-4:amd64. Preparing to unpack .../144-libz3-4_4.8.12-3.1_amd64.deb ... Unpacking libz3-4:amd64 (4.8.12-3.1) ... Selecting previously unselected package libllvm15:amd64. Preparing to unpack .../145-libllvm15_1%3a15.0.6-4+b1_amd64.deb ... Unpacking libllvm15:amd64 (1:15.0.6-4+b1) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../146-libsensors-config_1%3a3.6.0-7.1_all.deb ... Unpacking libsensors-config (1:3.6.0-7.1) ... Selecting previously unselected package libsensors5:amd64. Preparing to unpack .../147-libsensors5_1%3a3.6.0-7.1_amd64.deb ... Unpacking libsensors5:amd64 (1:3.6.0-7.1) ... Selecting previously unselected package libgl1-mesa-dri:amd64. Preparing to unpack .../148-libgl1-mesa-dri_22.3.6-1+deb12u1_amd64.deb ... Unpacking libgl1-mesa-dri:amd64 (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx-mesa0:amd64. Preparing to unpack .../149-libglx-mesa0_22.3.6-1+deb12u1_amd64.deb ... Unpacking libglx-mesa0:amd64 (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx0:amd64. Preparing to unpack .../150-libglx0_1.6.0-1_amd64.deb ... Unpacking libglx0:amd64 (1.6.0-1) ... Selecting previously unselected package libgl1:amd64. Preparing to unpack .../151-libgl1_1.6.0-1_amd64.deb ... Unpacking libgl1:amd64 (1.6.0-1) ... Selecting previously unselected package libgif7:amd64. Preparing to unpack .../152-libgif7_5.2.1-2.5_amd64.deb ... Unpacking libgif7:amd64 (5.2.1-2.5) ... Selecting previously unselected package x11-common. Preparing to unpack .../153-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:amd64. Preparing to unpack .../154-libxtst6_2%3a1.2.3-1.1_amd64.deb ... Unpacking libxtst6:amd64 (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:amd64. Preparing to unpack .../155-openjdk-17-jre_17.0.6+10-1_amd64.deb ... Unpacking openjdk-17-jre:amd64 (17.0.6+10-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../156-default-jre_2%3a1.17-74_amd64.deb ... Unpacking default-jre (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk-headless:amd64. Preparing to unpack .../157-openjdk-17-jdk-headless_17.0.6+10-1_amd64.deb ... Unpacking openjdk-17-jdk-headless:amd64 (17.0.6+10-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../158-default-jdk-headless_2%3a1.17-74_amd64.deb ... Unpacking default-jdk-headless (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk:amd64. Preparing to unpack .../159-openjdk-17-jdk_17.0.6+10-1_amd64.deb ... Unpacking openjdk-17-jdk:amd64 (17.0.6+10-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../160-default-jdk_2%3a1.17-74_amd64.deb ... Unpacking default-jdk (2:1.17-74) ... Selecting previously unselected package libassuan0:amd64. Preparing to unpack .../161-libassuan0_2.5.5-5_amd64.deb ... Unpacking libassuan0:amd64 (2.5.5-5) ... Selecting previously unselected package gpgconf. Preparing to unpack .../162-gpgconf_2.2.40-1.1_amd64.deb ... Unpacking gpgconf (2.2.40-1.1) ... Selecting previously unselected package libksba8:amd64. Preparing to unpack .../163-libksba8_1.6.3-2_amd64.deb ... Unpacking libksba8:amd64 (1.6.3-2) ... Selecting previously unselected package libsasl2-modules-db:amd64. Preparing to unpack .../164-libsasl2-modules-db_2.1.28+dfsg-10_amd64.deb ... Unpacking libsasl2-modules-db:amd64 (2.1.28+dfsg-10) ... Selecting previously unselected package libsasl2-2:amd64. Preparing to unpack .../165-libsasl2-2_2.1.28+dfsg-10_amd64.deb ... Unpacking libsasl2-2:amd64 (2.1.28+dfsg-10) ... Selecting previously unselected package libldap-2.5-0:amd64. Preparing to unpack .../166-libldap-2.5-0_2.5.13+dfsg-5_amd64.deb ... Unpacking libldap-2.5-0:amd64 (2.5.13+dfsg-5) ... Selecting previously unselected package libnpth0:amd64. Preparing to unpack .../167-libnpth0_1.6-3_amd64.deb ... Unpacking libnpth0:amd64 (1.6-3) ... Selecting previously unselected package dirmngr. Preparing to unpack .../168-dirmngr_2.2.40-1.1_amd64.deb ... Unpacking dirmngr (2.2.40-1.1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../169-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../170-gnupg-utils_2.2.40-1.1_amd64.deb ... Unpacking gnupg-utils (2.2.40-1.1) ... Selecting previously unselected package gpg. Preparing to unpack .../171-gpg_2.2.40-1.1_amd64.deb ... Unpacking gpg (2.2.40-1.1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../172-pinentry-curses_1.2.1-1_amd64.deb ... Unpacking pinentry-curses (1.2.1-1) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../173-gpg-agent_2.2.40-1.1_amd64.deb ... Unpacking gpg-agent (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../174-gpg-wks-client_2.2.40-1.1_amd64.deb ... Unpacking gpg-wks-client (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../175-gpg-wks-server_2.2.40-1.1_amd64.deb ... Unpacking gpg-wks-server (2.2.40-1.1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../176-gpgsm_2.2.40-1.1_amd64.deb ... Unpacking gpgsm (2.2.40-1.1) ... Selecting previously unselected package gnupg. Preparing to unpack .../177-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../178-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../179-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../180-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../181-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../182-libio-pty-perl_1%3a1.17-1_amd64.deb ... Unpacking libio-pty-perl (1:1.17-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../183-libipc-run-perl_20220807.0-1_all.deb ... Unpacking libipc-run-perl (20220807.0-1) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../184-libclass-method-modifiers-perl_2.14-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.14-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../185-libclass-xsaccessor-perl_1.19-4+b1_amd64.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b1) ... Selecting previously unselected package libb-hooks-op-check-perl:amd64. Preparing to unpack .../186-libb-hooks-op-check-perl_0.22-2+b1_amd64.deb ... Unpacking libb-hooks-op-check-perl:amd64 (0.22-2+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../187-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:amd64. Preparing to unpack .../188-libdevel-callchecker-perl_0.008-2_amd64.deb ... Unpacking libdevel-callchecker-perl:amd64 (0.008-2) ... Selecting previously unselected package libparams-classify-perl:amd64. Preparing to unpack .../189-libparams-classify-perl_0.015-2+b1_amd64.deb ... Unpacking libparams-classify-perl:amd64 (0.015-2+b1) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../190-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../191-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../192-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../193-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../194-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../195-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../196-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../197-libhttp-date-perl_6.05-2_all.deb ... Unpacking libhttp-date-perl (6.05-2) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../198-libfile-listing-perl_6.15-1_all.deb ... Unpacking libfile-listing-perl (6.15-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../199-libhtml-tagset-perl_3.20-6_all.deb ... Unpacking libhtml-tagset-perl (3.20-6) ... Selecting previously unselected package libregexp-ipv6-perl. Preparing to unpack .../200-libregexp-ipv6-perl_0.03-3_all.deb ... Unpacking libregexp-ipv6-perl (0.03-3) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../201-liburi-perl_5.17-1_all.deb ... Unpacking liburi-perl (5.17-1) ... Selecting previously unselected package libhtml-parser-perl:amd64. Preparing to unpack .../202-libhtml-parser-perl_3.81-1_amd64.deb ... Unpacking libhtml-parser-perl:amd64 (3.81-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../203-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:amd64. Preparing to unpack .../204-libclone-perl_0.46-1_amd64.deb ... Unpacking libclone-perl:amd64 (0.46-1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../205-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../206-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../207-libhttp-message-perl_6.44-1_all.deb ... Unpacking libhttp-message-perl (6.44-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../208-libhttp-cookies-perl_6.10-1_all.deb ... Unpacking libhttp-cookies-perl (6.10-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../209-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:amd64. Preparing to unpack .../210-perl-openssl-defaults_7+b1_amd64.deb ... Unpacking perl-openssl-defaults:amd64 (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:amd64. Preparing to unpack .../211-libnet-ssleay-perl_1.92-2+b1_amd64.deb ... Unpacking libnet-ssleay-perl:amd64 (1.92-2+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../212-libio-socket-ssl-perl_2.081-2_all.deb ... Unpacking libio-socket-ssl-perl (2.081-2) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../213-libnet-http-perl_6.22-1_all.deb ... Unpacking libnet-http-perl (6.22-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../214-liblwp-protocol-https-perl_6.10-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.10-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../215-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../216-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../217-libwww-perl_6.68-1_all.deb ... Unpacking libwww-perl (6.68-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../218-patchutils_0.4.2-1_amd64.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../219-wdiff_1.2.2-5_amd64.deb ... Unpacking wdiff (1.2.2-5) ... Selecting previously unselected package devscripts. Preparing to unpack .../220-devscripts_2.23.3_amd64.deb ... Unpacking devscripts (2.23.3) ... Selecting previously unselected package ivy. Preparing to unpack .../221-ivy_2.5.1-2_all.deb ... Unpacking ivy (2.5.1-2) ... Selecting previously unselected package libasm-java. Preparing to unpack .../222-libasm-java_9.4-1_all.deb ... Unpacking libasm-java (9.4-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../223-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../224-libcommons-cli-java_1.5.0-1_all.deb ... Unpacking libcommons-cli-java (1.5.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../225-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../226-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../227-libcommons-logging-java_1.2-3_all.deb ... Unpacking libcommons-logging-java (1.2-3) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../228-libjansi-java_2.4.0-2_all.deb ... Unpacking libjansi-java (2.4.0-2) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../229-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../230-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../231-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../232-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../233-groovy_2.4.21-7_all.deb ... Unpacking groovy (2.4.21-7) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../234-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../235-libcommons-collections3-java_3.2.2-2_all.deb ... Unpacking libcommons-collections3-java (3.2.2-2) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../236-libcommons-compress-java_1.22-1_all.deb ... Unpacking libcommons-compress-java (1.22-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../237-libcommons-io-java_2.11.0-2_all.deb ... Unpacking libcommons-io-java (2.11.0-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../238-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../239-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../240-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../241-libguava-java_31.1-1_all.deb ... Unpacking libguava-java (31.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../242-libcommons-codec-java_1.15-1_all.deb ... Unpacking libcommons-codec-java (1.15-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../243-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../244-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../245-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../246-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../247-libjna-jni_5.13.0-2_amd64.deb ... Unpacking libjna-jni (5.13.0-2) ... Selecting previously unselected package libjna-java. Preparing to unpack .../248-libjna-java_5.13.0-2_all.deb ... Unpacking libjna-java (5.13.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../249-libjzlib-java_1.1.3-2_all.deb ... Unpacking libjzlib-java (1.1.3-2) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../250-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../251-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../252-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../253-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../254-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../255-liblogback-java_1%3a1.2.11-2_all.deb ... Unpacking liblogback-java (1:1.2.11-2) ... Selecting previously unselected package libncurses6:amd64. Preparing to unpack .../256-libncurses6_6.4-2_amd64.deb ... Unpacking libncurses6:amd64 (6.4-2) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../257-libnative-platform-jni_0.14-5_amd64.deb ... Unpacking libnative-platform-jni (0.14-5) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../258-libnative-platform-java_0.14-5_all.deb ... Unpacking libnative-platform-java (0.14-5) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../259-libxml-commons-external-java_1.4.01-5_all.deb ... Unpacking libxml-commons-external-java (1.4.01-5) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../260-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../261-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../262-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../263-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../264-libgradle-core-java_4.4.1-18_all.deb ... Unpacking libgradle-core-java (4.4.1-18) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../265-libbcprov-java_1.72-2_all.deb ... Unpacking libbcprov-java (1.72-2) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../266-libbcpg-java_1.72-2_all.deb ... Unpacking libbcpg-java (1.72-2) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../267-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../268-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../269-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../270-libdom4j-java_2.1.3-2_all.deb ... Unpacking libdom4j-java (2.1.3-2) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../271-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../272-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../273-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../274-libgoogle-gson-java_2.10-1_all.deb ... Unpacking libgoogle-gson-java (2.10-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../275-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../276-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../277-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../278-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../279-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../280-libjavaewah-java_1.1.7-1_all.deb ... Unpacking libjavaewah-java (1.1.7-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../281-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../282-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../283-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../284-libjetty9-java_9.4.50-3_all.deb ... Unpacking libjetty9-java (9.4.50-3) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../285-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../286-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../287-libcommons-lang3-java_3.12.0-2_all.deb ... Unpacking libcommons-lang3-java (3.12.0-2) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../288-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../289-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../290-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../291-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../292-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../293-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../294-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../295-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../296-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../297-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../298-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../299-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../300-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../301-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../302-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../303-libmaven3-core-java_3.8.7-1_all.deb ... Unpacking libmaven3-core-java (3.8.7-1) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../304-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../305-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../306-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../307-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../308-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../309-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../310-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../311-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../312-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../313-libgradle-plugins-java_4.4.1-18_all.deb ... Unpacking libgradle-plugins-java (4.4.1-18) ... Selecting previously unselected package gradle. Preparing to unpack .../314-gradle_4.4.1-18_all.deb ... Unpacking gradle (4.4.1-18) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../315-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../316-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package javahelper. Preparing to unpack .../317-javahelper_0.78_all.deb ... Unpacking javahelper (0.78) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../318-libbyte-buddy-java_1.12.21-1_all.deb ... Unpacking libbyte-buddy-java (1.12.21-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../319-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../320-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../321-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../322-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../323-liblz4-jni_1.8.0-3_amd64.deb ... Unpacking liblz4-jni (1.8.0-3) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../324-liblz4-java_1.8.0-3_all.deb ... Unpacking liblz4-java (1.8.0-3) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../325-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../326-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../327-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.72-2) ... Setting up libksba8:amd64 (1.6.3-2) ... Setting up media-types (10.0.0) ... Setting up libpipeline1:amd64 (1.5.7-1) ... Setting up libgraphite2-3:amd64 (1.3.14-1) ... Setting up liblcms2-2:amd64 (2.14-2) ... Setting up libpixman-1-0:amd64 (0.42.2-1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-5) ... Setting up libpciaccess0:amd64 (0.17-2) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:amd64 (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:amd64 (72.1-3) ... Setting up liblerc4:amd64 (4.0.0+ds-2) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.38.1-5+b1) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.74) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:amd64 (0.2.13-2+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.14-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.5.0-1) ... Setting up libio-pty-perl (1:1.17-1) ... Setting up libmagic-mgc (1:5.44-3) ... Setting up liblogback-java (1:1.2.11-2) ... Setting up libclone-perl:amd64 (0.46-1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:amd64 (2.74.6-2) ... No schema files found: doing nothing. Setting up libglvnd0:amd64 (1.6.0-1) ... Setting up libgoogle-gson-java (2.10-1) ... Setting up libhtml-tagset-perl (3.20-6) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.11.4) ... Setting up libbrotli1:amd64 (1.0.9-2+b6) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Setting up libasm-java (9.4-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-7.1) ... Setting up libmagic1:amd64 (1:5.44-3) ... Setting up libdeflate0:amd64 (1.14-1) ... Setting up perl-openssl-defaults:amd64 (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-12) ... Setting up m4 (1.4.19-3) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:amd64 (1.6-3) ... Setting up file (1:5.44-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:amd64 (2.5.5-5) ... Setting up libjzlib-java (1.1.3-2) ... Setting up libjbig0:amd64 (2.1-6.1) ... Setting up libsasl2-modules-db:amd64 (2.1.28+dfsg-10) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-2) ... Setting up libasound2-data (1.2.8-1) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:amd64 (4.8.12-3.1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.1.7-1) ... Setting up libjpeg62-turbo:amd64 (1:2.1.5-2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.4-2) ... Setting up libnspr4:amd64 (2:4.35-1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.0-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:amd64 (0.8-10) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libncurses6:amd64 (6.4-2) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:amd64 (1.14.6-1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:amd64 (1.0.8-2.1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up libpng16-16:amd64 (1.6.39-2) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.13.0-2) ... Setting up autopoint (0.21-12) ... Setting up libb-hooks-op-check-perl:amd64 (0.22-2+b1) ... Setting up fonts-dejavu-core (2.37-6) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20220807.0-1) ... Setting up libpcsclite1:amd64 (1.9.9-2) ... Setting up libsensors5:amd64 (1:3.6.0-7.1) ... Setting up libhamcrest-java (2.2-1) ... Setting up libglapi-mesa:amd64 (22.3.6-1+deb12u1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:amd64 (2.1.28+dfsg-10) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:amd64 (1.2.4-0.1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libregexp-ipv6-perl (0.03-3) ... Setting up libgif7:amd64 (5.2.1-2.5) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.17+nmu1) ... Setting up libxshmfence1:amd64 (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.46.0-5) ... Setting up libtiff6:amd64 (4.5.0-5) ... Setting up libuchardet0:amd64 (0.0.7-1) ... Setting up libxml-commons-external-java (1.4.01-5) ... Setting up libjna-java (5.13.0-2) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:amd64 (1.2.8-1+b1) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.09-4) ... Setting up libthai-data (0.1.29-1) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-5) ... Setting up libclass-xsaccessor-perl (1.19-4+b1) ... Setting up libgtk2.0-common (2.24.33-2) ... Setting up libatk1.0-0:amd64 (2.46.0-5) ... Setting up liblz4-jni (1.8.0-3) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.72-2) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-12) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.0.8-1) ... Setting up libbsd0:amd64 (0.11.7-2) ... Setting up libdrm-common (2.4.114-1) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:amd64 (0.188-2.1) ... Setting up readline-common (8.2-1.3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:amd64 (2.9.14+dfsg-1.2) ... Setting up liburi-perl (5.17-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3+b1) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:amd64 (1.92-2+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-1) ... Setting up libdom4j-java (2.1.3-2) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-5) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.05-2) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:amd64 (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-3) ... Setting up libxcb1:amd64 (1.15-1) ... Setting up gettext (0.21-12) ... Setting up libjetty9-java (9.4.50-3) ... Setting up libxcb-xfixes0:amd64 (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.15-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libtool (2.4.7-5) ... Setting up libxcb-render0:amd64 (1.15-1) ... Setting up fontconfig-config (2.14.1-4) ... Setting up libxcb-glx0:amd64 (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:amd64 (3.1-20221030-2) ... Setting up libreadline8:amd64 (8.2-1.3) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:amd64 (0.8-10) ... Setting up libcommons-logging-java (1.2-3) ... Setting up libnet-http-perl (6.22-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:amd64 (2:3.87.1-1) ... Setting up libxcb-shm0:amd64 (1.15-1) ... Setting up libdevel-callchecker-perl:amd64 (0.008-2) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:amd64 (2.5.13+dfsg-5) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:amd64 (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:amd64 (0.1.29-1) ... Setting up ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 140 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:amd64 (2.12.1+dfsg-4) ... Setting up libxcb-sync1:amd64 (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.2-1) ... Setting up libcommons-lang3-java (3.12.0-2) ... Setting up libxcb-dri2-0:amd64 (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:amd64 (2.4.114-1+b1) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-1) ... Setting up groff-base (1.22.4-10) ... Setting up libxcb-randr0:amd64 (1.15-1) ... Setting up libhtml-parser-perl:amd64 (3.81-1) ... Setting up libllvm15:amd64 (1:15.0.6-4+b1) ... Setting up gpgconf (2.2.40-1.1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:amd64 (2:1.8.4-2) ... Setting up libharfbuzz0b:amd64 (6.0.0+dfsg-3) ... Setting up libgdk-pixbuf-2.0-0:amd64 (2.42.10+dfsg-1+b1) ... Setting up libfontconfig1:amd64 (2.14.1-4) ... Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.15-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libxcomposite1:amd64 (1:0.4.5-1) ... Setting up libavahi-client3:amd64 (0.8-10) ... Setting up libio-socket-ssl-perl (2.081-2) ... Setting up gpg (2.2.40-1.1) ... Setting up gnupg-utils (2.2.40-1.1) ... Setting up libhttp-message-perl (6.44-1) ... Setting up libdrm-amdgpu1:amd64 (2.4.114-1+b1) ... Setting up libxcb-dri3-0:amd64 (1.15-1) ... Setting up gtk-update-icon-cache (3.24.37-2) ... Setting up libx11-xcb1:amd64 (2:1.8.4-2) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.14.1-4) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:amd64 (2.4.114-1+b1) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:amd64 (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1) ... Setting up libxrender1:amd64 (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.22-1) ... Setting up libhttp-cookies-perl (6.10-1) ... Setting up libcommons-io-java (2.11.0-2) ... Setting up libdrm-radeon1:amd64 (2.4.114-1+b1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:amd64 (3.11.2-6) ... Setting up libparams-classify-perl:amd64 (0.015-2+b1) ... Setting up gpgsm (2.2.40-1.1) ... Setting up libpango-1.0-0:amd64 (1.50.12+ds-1) ... Setting up libdrm-intel1:amd64 (2.4.114-1+b1) ... Setting up libgl1-mesa-dri:amd64 (22.3.6-1+deb12u1) ... Setting up libxext6:amd64 (2:1.3.4-1+b1) ... Setting up man-db (2.11.2-2) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:amd64 (1.16.0-7) ... Setting up libxxf86vm1:amd64 (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (43-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:amd64 (1:6.0.0-2) ... Setting up libxinerama1:amd64 (2:1.1.4-3) ... Setting up libxrandr2:amd64 (2:1.5.2-2+b1) ... Setting up gpg-wks-server (2.2.40-1.1) ... Setting up libcups2:amd64 (2.4.2-3) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:amd64 (1.50.12+ds-1) ... Setting up libpangocairo-1.0-0:amd64 (1.50.12+ds-1) ... Setting up libpython3-stdlib:amd64 (3.11.2-1+b1) ... Setting up python3.11 (3.11.2-6) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:amd64 (22.3.6-1+deb12u1) ... Setting up libxi6:amd64 (2:1.8-1+b1) ... Setting up gpg-wks-client (2.2.40-1.1) ... Setting up libglx0:amd64 (1.6.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:amd64 (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:amd64 (1:1.2.1-1) ... Setting up debhelper (13.11.4) ... Setting up python3 (3.11.2-1+b1) ... Setting up libgl1:amd64 (1.6.0-1) ... Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:amd64 (2.24.33-2) ... Setting up openjdk-17-jre-headless:amd64 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up ca-certificates-java (20230103) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068_2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:E-Tugra_Certification_Authority.pem Adding debian:E-Tugra_Global_Root_CA_ECC_v3.pem Adding debian:E-Tugra_Global_Root_CA_RSA_v3.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustCor_ECA-1.pem Adding debian:TrustCor_RootCert_CA-1.pem Adding debian:TrustCor_RootCert_CA-2.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up junit4 (4.13.2-3) ... Setting up liblwp-protocol-https-perl (6.10-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up default-jre-headless (2:1.17-74) ... Setting up libwww-perl (6.68-1) ... Setting up openjdk-17-jre:amd64 (17.0.6+10-1) ... Setting up maven-repo-helper (1.11) ... Setting up default-jre (2:1.17-74) ... Setting up antlr (2.7.7+dfsg-12) ... Setting up bnd (5.0.1-3) ... Setting up devscripts (2.23.3) ... Setting up libguava-java (31.1-1) ... Setting up openjdk-17-jdk-headless:amd64 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.1-2) ... Setting up ant (1.10.13-1) ... Setting up javahelper (0.78) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up groovy (2.4.21-7) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up openjdk-17-jdk:amd64 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up libguice-java (4.2.3-2) ... Setting up ant-optional (1.10.13-1) ... Setting up default-jdk-headless (2:1.17-74) ... Setting up libgradle-core-java (4.4.1-18) ... Setting up libmaven3-core-java (3.8.7-1) ... Setting up default-jdk (2:1.17-74) ... Setting up libgradle-plugins-java (4.4.1-18) ... Setting up gradle (4.4.1-18) ... Setting up libbyte-buddy-java (1.12.21-1) ... Setting up libmockito-java (2.23.0-2) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for libc-bin (2.36-9) ... Processing triggers for ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20230103) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture amd64 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=15 jar openjdk version "17.0.6" 2023-01-17 OpenJDK Runtime Environment (build 17.0.6+10-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.6+10-Debian-1, mixed mode, sharing) Initialized native services in: /build/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-amd64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 2.476 secs. The client will now receive all logging from the daemon (pid: 1356772). The daemon log file: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-1356772.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 15 worker leases. Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@55d51e95 Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@55d51e95 Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@4448cce5 Starting Build Compiling initialization script '/build/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@50c0ec0b Compiling initialization script '/build/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@525f5328 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@4448cce5 Creating new cache for taskHistory, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@50f24ecd Creating new cache for outputFiles, path /build/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@686baa21 :compileJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.009 secs. Creating new cache for metadata-2.36/module-metadata, path /build/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e64a589 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:833) Up-to-date check for task ':compileJava' took 4.415 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 21.583 secs. :processResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.026 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.131 secs. :classes (Thread[Task worker for ':' Thread 2,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.001 secs. :debianMavenPom (Thread[Task worker for ':' Thread 2,5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.001 secs. It is not up-to-date because: No history is available. Generating pom file /build/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.278 secs. :jar (Thread[Task worker for ':' Thread 2,5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.061 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.586 secs. BUILD SUCCESSFUL in 36s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=15 test openjdk version "17.0.6" 2023-01-17 OpenJDK Runtime Environment (build 17.0.6+10-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.6+10-Debian-1, mixed mode, sharing) Initialized native services in: /build/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-amd64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 2.818 secs. The client will now receive all logging from the daemon (pid: 1360954). The daemon log file: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-1360954.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 15 worker leases. Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@55d51e95 Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@55d51e95 Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@4448cce5 Starting Build Creating new cache for metadata-1.1/results, path /build/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@2993ab98 Settings evaluated using settings file '/build/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@7eb2c11 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@4448cce5 Creating new cache for taskHistory, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@23b2098f Creating new cache for outputFiles, path /build/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1cbdaac :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.016 secs. Creating new cache for metadata-2.36/module-metadata, path /build/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@31d7d61a Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 7.037 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':',5,main]) completed. Took 7.163 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.015 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.022 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':',5,main]) completed. Took 0.003 secs. :compileTestJava (Thread[Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 6.151 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 16.606 secs. :processTestResources (Thread[Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.043 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.13 secs. :testClasses (Thread[Task worker for ':',5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':',5,main]) completed. Took 0.001 secs. :test (Thread[Task worker for ':',5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 1.578 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-amd64/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath12573731822801063011txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 5608636 Write time: 735.73ms O. Stats: Wall clock time: 743.74ms Total CPU time: 852.23ms User wait time: 571.22ms Serialization time: 467.88ms (54.9%) Checksum calculation time: 265.23ms (31.12%) Compression time: 62.77ms (7.36%) Total IO delay: 356.04ms Concurrency overhead: 187.59ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 15.02MiB/s Concurrency adjusted uncompressed speed: 37.7MiB/s Actual uncompressed speed: 24.81MiB/s Actual speed: 7.2MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 418.56ms Total CPU time: 275ms Serialization time: 195.68ms (71.16%) Checksum calculation time: 8.97ms (3.26%) Compression time: 60.56ms (22.02%) Total IO delay: 276.7ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 19.38MiB/s Concurrency adjusted uncompressed speed: 134.58MiB/s Actual uncompressed speed: 44.11MiB/s Actual speed: 12.8MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 800.72ms Total CPU time: 489.61ms Serialization time: 241.03ms (49.23%) Checksum calculation time: 17.87ms (3.65%) Compression time: 211.43ms (43.18%) Total IO delay: 531.87ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 20.15MiB/s Concurrency adjusted uncompressed speed: 144.6MiB/s Actual uncompressed speed: 46.09MiB/s Actual speed: 13.37MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 5588298 Write time: 234.64ms O. Stats: Wall clock time: 235.92ms Total CPU time: 254.48ms User wait time: 194.9ms Serialization time: 125.72ms (49.4%) Checksum calculation time: 17.22ms (6.77%) Compression time: 95.32ms (37.46%) Total IO delay: 105.64ms Concurrency overhead: 25.06ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 50.76MiB/s Concurrency adjusted uncompressed speed: 160.32MiB/s Actual uncompressed speed: 78.45MiB/s Actual speed: 22.68MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 214.21ms Total CPU time: 193.48ms Serialization time: 99.85ms (51.61%) Checksum calculation time: 17.69ms (9.14%) Compression time: 74.69ms (38.6%) Total IO delay: 114.79ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 46.75MiB/s Concurrency adjusted uncompressed speed: 239.44MiB/s Actual uncompressed speed: 86.15MiB/s Actual speed: 24.9MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 534.81ms Total CPU time: 396.63ms Serialization time: 197.1ms (49.69%) Checksum calculation time: 36.8ms (9.28%) Compression time: 159.95ms (40.33%) Total IO delay: 258.54ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 41.31MiB/s Concurrency adjusted uncompressed speed: 226.22MiB/s Actual uncompressed speed: 69.05MiB/s Actual speed: 19.96MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5608636 Write time: 981.77ms O. Stats: Wall clock time: 983.59ms Total CPU time: 159.1ms User wait time: 882.88ms Serialization time: 72.19ms (45.37%) Checksum calculation time: 8.82ms (5.54%) Compression time: 57.67ms (36.25%) Total IO delay: 195.88ms Concurrency overhead: 246.49ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 27.43MiB/s Concurrency adjusted uncompressed speed: 30.68MiB/s Actual uncompressed speed: 18.76MiB/s Actual speed: 5.44MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 326.84ms Total CPU time: 147.74ms Serialization time: 60.45ms (40.92%) Checksum calculation time: 8.38ms (5.67%) Compression time: 70.99ms (48.05%) Total IO delay: 303.34ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 17.65MiB/s Concurrency adjusted uncompressed speed: 40.88MiB/s Actual uncompressed speed: 56.55MiB/s Actual speed: 16.41MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 599.09ms Total CPU time: 288.67ms Serialization time: 123.52ms (42.79%) Checksum calculation time: 17.09ms (5.92%) Compression time: 135.37ms (46.89%) Total IO delay: 463.76ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 23.11MiB/s Concurrency adjusted uncompressed speed: 49.03MiB/s Actual uncompressed speed: 61.56MiB/s Actual speed: 17.86MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5588298 Write time: 701.64ms O. Stats: Wall clock time: 703.11ms Total CPU time: 253.13ms User wait time: 606.72ms Serialization time: 107.34ms (42.41%) Checksum calculation time: 9.53ms (3.76%) Compression time: 122.12ms (48.25%) Total IO delay: 146.53ms Concurrency overhead: 81.56ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 36.5MiB/s Concurrency adjusted uncompressed speed: 38.33MiB/s Actual uncompressed speed: 26.23MiB/s Actual speed: 7.58MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 252.58ms Total CPU time: 194.48ms Serialization time: 94.53ms (48.61%) Checksum calculation time: 13.84ms (7.11%) Compression time: 84.84ms (43.63%) Total IO delay: 150.91ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 35.53MiB/s Concurrency adjusted uncompressed speed: 53.44MiB/s Actual uncompressed speed: 73.16MiB/s Actual speed: 21.15MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 564.78ms Total CPU time: 374.09ms Serialization time: 175.68ms (46.96%) Checksum calculation time: 29.4ms (7.86%) Compression time: 166.39ms (44.48%) Total IO delay: 297.09ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 35.89MiB/s Concurrency adjusted uncompressed speed: 54.95MiB/s Actual uncompressed speed: 65.38MiB/s Actual speed: 18.9MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 0 / 2 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 3.58s O. Stats: Wall clock time: 3.58s Total CPU time: 9s User wait time: 3.29s Serialization time: 90.58ms (1.01%) Checksum calculation time: 8.66ms (0.1%) Compression time: 8.88s (98.65%) Total IO delay: 176.95ms Concurrency overhead: 165.36ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 22.52MiB/s Concurrency adjusted uncompressed speed: 7.49MiB/s Actual uncompressed speed: 5.15MiB/s Actual speed: 1.11MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 1 / 0 I. Stats 1: Wall clock time: 375.21ms Total CPU time: 185.73ms Serialization time: 109.35ms (58.87%) Checksum calculation time: 8.51ms (4.58%) Compression time: 61.52ms (33.12%) Total IO delay: 360.51ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 11.01MiB/s Concurrency adjusted uncompressed speed: 135.57MiB/s Actual uncompressed speed: 49.17MiB/s Actual speed: 10.57MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 767.35ms Total CPU time: 290.47ms Serialization time: 141.5ms (48.71%) Checksum calculation time: 16.91ms (5.82%) Compression time: 119.86ms (41.27%) Total IO delay: 672.87ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 11.8MiB/s Concurrency adjusted uncompressed speed: 153.64MiB/s Actual uncompressed speed: 48.08MiB/s Actual speed: 10.34MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 4.38s O. Stats: Wall clock time: 4.38s Total CPU time: 7.45s User wait time: 3.97s Serialization time: 55.26ms (0.74%) Checksum calculation time: 13.78ms (0.18%) Compression time: 7.37s (99%) Total IO delay: 81.44ms Concurrency overhead: 33.62ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 48.26MiB/s Concurrency adjusted uncompressed speed: 9.63MiB/s Actual uncompressed speed: 4.21MiB/s Actual speed: 913.42KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 170.07ms Total CPU time: 117.74ms Serialization time: 34.92ms (29.66%) Checksum calculation time: 9.34ms (7.93%) Compression time: 72.37ms (61.47%) Total IO delay: 119.51ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 32.85MiB/s Concurrency adjusted uncompressed speed: 312.49MiB/s Actual uncompressed speed: 108.45MiB/s Actual speed: 22.99MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 417.89ms Total CPU time: 226.05ms Serialization time: 66.35ms (29.35%) Checksum calculation time: 22.7ms (10.04%) Compression time: 135.31ms (59.86%) Total IO delay: 263.1ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 29.72MiB/s Concurrency adjusted uncompressed speed: 302.24MiB/s Actual uncompressed speed: 88.43MiB/s Actual speed: 18.75MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 9.96s O. Stats: Wall clock time: 9.96s Total CPU time: 9.35s User wait time: 9.87s Serialization time: 53.89ms (0.58%) Checksum calculation time: 8.69ms (0.09%) Compression time: 9.27s (99.24%) Total IO delay: 187.93ms Concurrency overhead: 153.07ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 21.2MiB/s Concurrency adjusted uncompressed speed: 1.9MiB/s Actual uncompressed speed: 1.85MiB/s Actual speed: 407.6KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 320.27ms Total CPU time: 94.85ms Serialization time: 26.55ms (27.99%) Checksum calculation time: 8.33ms (8.78%) Compression time: 55.31ms (58.31%) Total IO delay: 313.59ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 12.66MiB/s Concurrency adjusted uncompressed speed: 45.19MiB/s Actual uncompressed speed: 57.62MiB/s Actual speed: 12.39MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 692.3ms Total CPU time: 196.05ms Serialization time: 55.81ms (28.47%) Checksum calculation time: 16.81ms (8.57%) Compression time: 113.68ms (57.99%) Total IO delay: 615.09ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 12.89MiB/s Concurrency adjusted uncompressed speed: 45.47MiB/s Actual uncompressed speed: 53.29MiB/s Actual speed: 11.46MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 8.34s O. Stats: Wall clock time: 8.34s Total CPU time: 8.05s User wait time: 8.29s Serialization time: 57.13ms (0.71%) Checksum calculation time: 17.28ms (0.21%) Compression time: 7.97s (99%) Total IO delay: 91.02ms Concurrency overhead: 54.31ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 42.95MiB/s Concurrency adjusted uncompressed speed: 2.25MiB/s Actual uncompressed speed: 2.21MiB/s Actual speed: 480.04KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 197.03ms Total CPU time: 135.31ms Serialization time: 58.83ms (43.48%) Checksum calculation time: 19.03ms (14.07%) Compression time: 56.41ms (41.69%) Total IO delay: 139.91ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 28.12MiB/s Concurrency adjusted uncompressed speed: 67.04MiB/s Actual uncompressed speed: 93.59MiB/s Actual speed: 19.84MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 400.22ms Total CPU time: 256.42ms Serialization time: 92.52ms (36.08%) Checksum calculation time: 41.17ms (16.05%) Compression time: 120.97ms (47.18%) Total IO delay: 232.93ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 33.7MiB/s Concurrency adjusted uncompressed speed: 75.41MiB/s Actual uncompressed speed: 92.18MiB/s Actual speed: 19.54MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 Pending / IO / Serde / Objs: 0 / 1 / 2 / 2000 Pending / IO / Serde / Objs: 1 / 0 / 2 / 3000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 7000 Pending / IO / Serde / Objs: 0 / 0 / 2 / 10000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 15000 Pending / IO / Serde / Objs: 1 / 0 / 1 / 19000 O. Stats: Wall clock time: 15.43s Total CPU time: 19.8s User wait time: 87.79us Serialization time: 10.32s (52.12%) Checksum calculation time: 1.78s (8.97%) Compression time: 3.8s (19.18%) Total IO delay: 7.9s Concurrency overhead: 30.15ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 241.42MiB/s Concurrency adjusted uncompressed speed: 546.23MiB/s Actual uncompressed speed: 123.59MiB/s Actual speed: 123.59MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 2.73us 2.82us 3.22us com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1639 rTrimmed = 1672 lTrimmed = 2892 rTrimmed = 2830 com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 353.06us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 301.57us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 149.80us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 156.95us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=2998;I=0;M=1;ScE=1;R=0.0 AlignmentTime = 605.09us C=2999;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 291.27us C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 244.30us C=2996;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 212.20us com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1856 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Q 117 -> T 85 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Q 168 -> T 111 - -57 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1212 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 72 -> T 64 - -8 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 183 -> T 147 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 281 noHits2: 0 noHits3: 0 wrongTopHit: 45 wrongTopHitS: 30 noCorrectHitInList: 21 Timings: DescriptiveStatistics: n: 100000 min: 10546.0 max: 4.84136626E8 mean: 161288.15345997567 std dev: 3011299.4391927896 median: 100949.0 skewness: 118.48734465387682 kurtosis: 15381.691477491036 Clusters basicSize DescriptiveStatistics: n: 99674 min: 1.0 max: 7.0 mean: 2.8609065553705095 std dev: 1.0986277435883456 median: 3.0 skewness: 0.29507202074971917 kurtosis: -0.6692534652494913 Top Delta DescriptiveStatistics: n: 99698 min: -32.0 max: 0.0 mean: -0.0012236955605935006 std dev: 0.14725559496467125 median: 0.0 skewness: -152.70570566762015 kurtosis: 27448.10243244401 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4966 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 849.18us Processed queries: 50 Bad percent: 0.0 False positive percent: 0.5686713768740307 Scoring error percent: 2.0 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT TGTCTCTGATCTGCGTTCTGTGGGGGGCGCTTGGTCGCGCACCGCCCGTATCTAGATCTAGTAACTATCTCACACTGGCTTGCGCGGGTGAGTCGCGGGAATGTAAAAGACAATTGTGTAATATAGCCACGAGGACTCCAGCGCCTACGACCACAAATTTATCCTATTCTGCTGTAACGCCTAGGCTTGGGTATGTCCTCTTTTAGCATGTCCATACCATAGGGTTTTAGCGCGGTCCCGAAACTTTGCGGTCGGGGTCGGTAGTCATACCCAAACGGCGAAACGCGAAAGCAGCCGGCTGAATTGGGTTGGGACCTGAGCTCGTGAATTTTCATTTGCCTCGTATCCAATACAACGTCCAAATGCTAAAGTCATGACGAGTGTCGGTACACGCAAGATAATACAAGCTTGCAGAGAGACCCTGTAATGTATAGCAACAGCATGTGTAACTAGCGATGAGTGCAGCTACTGGGTTACGACCGTCAGACCAGCTTTCTTAAGTCCAGTGAGATTCTCCGGAGGCAAATCCTGTCGACGGCAAGGCTGTTCGCGAAGTTTGCTGCTCCTGAACTTCAGAGCGCAGAGCGCAATCAAATAACTCGGGCATAGGTCGAT TGTCTCTGATCTGCGTTCTGTGAGGGGCGCTTGGTCGCCACCGCCCGTAGTCTAGACTAGTAACTGTCTCACACTGCTTGCGCGGGTGAGTCGCGGGAATGTATAGACAATTGTGTATATAGCCACGAGACTCCAGCGCTACGACCACAAATTTTCTATTCGCGTAACGCCTAGGCTTGTGTATGTCCTCTTTTGCATGTCCATACCGTAGGGTTTTGCGCGGTCCCAAACTTTGCTTCGGGGTCGTAGTCATACCCATACGGCGAAACGCGATAAGCAGCCGGCTGATTGGGTTTGGGACCTGAGCTCAGTGAATTTTCATTTGCCTCGTATCCAAATCCAACGTCCAATGGCTAAAGTCATGACAGTGTCGGTACACGCAATATAATTACAAGCTTGCAGAGAGACCTGTAACGTAGTAGCAAACAGATGTGTAACTTAGCGATGAGGCGCTACTGGGTTACGACCGTCGGACCGCTTTTTAAGTCCAAGCGAGATTCTCGTGGAGGCAAATCCTGTCGACGGCTGGCCGTTCGCGAAGTTTGCTGCTCCTGAACTTCAGAGCGCAGAGCGCAATCAGATAACTGCGGCATTAGGTCGA TGTCTCTGACTGCGTTCTGTGAGGGCGCTTGGTCGCCACCGCCCGTAGTCTAGACTAAACTGTCCACACTGCTTGCGGGTGAGTCGCGGGAATGTATAGACAATTGTGTACATAGCCACGAGACTCCGCGCTACGACCACAAATTTTCTATTGCCGTAAGCCTAGGCTTGTGATGATCCTCTTTGCATGTCCATACCGTAGGGCTGCGCGGCCCCAAACTTTGCTTCGGGGTCGTAGTCATACCCATACGGCAAAGCCGTAAGCAGCCGGCTGATTGGGTTTGGGACCTGAGCTCAGTGAATTTCTTTTGCCTCGTATCCAAATCCAACTCCAATGGCTAAAGTCATGACAGTGTCGGTACACCAATATATTGACAGCTGCAGAGATACCTGTAACGAGTAGCAACAGATGTGTTACTTACATGAGGCGTACCGGGTTACGACCGTCTGGACCGTCTTTTTAAGTCCAAGCGAGAGTTCTCGTGGTGGCTAATCCTGTGACGGCTGGCCGTTCGGAAGTTTGTGCTTCTGAACTTCGGCGCAGAGCGCATCAGATAACTCGGAGCATTAGGTCGA 0 TGTCTCTGA-CTGCGTTCTGT-GAGGGCGCTTGGTCGC-CACCGCCCGTAGTCTAGA-CTA--AACTGTC-CACACT-GCTT--GCGGGTGAGTCGCGGGAATGT-ATAGACAATTGTGT-ACATAGCCACGA-GACTCC-GCG-CTACGACCACAAATTT-T-CTA-T-TGCCGTAA-GCCTAGGCTTGTG-ATGATCCTC-TTT-GCATGTCCATACCGTAGGG--CT-GCGCGG-CCCCAAACTTTGC-TTCGGGGTC-GTAGTCATACCCATACGGC-AAA-GCCGTAAGCAGCCGGCTG-ATTGGGTTTGGGACCTGAGCTCAGTGAA-TTTCTTTTGCCTCGTATCCAAATCCAAC-TCC-AATGGCTAAAGTCATGAC-AGTGTCGGTACAC-CAATATATTGAC-AGC-TGCAGAGATA-CCTGTAACG-AGTAGCAACAG-ATGTGTTACTTA-C-ATGAG-GC-G-TACCGGGTTACGACCGTCTGGACC-GTCTTT-TTAAGTCCAAGCGAGAGTTCTCGTGGTGGCTAATCCTGT-GACGGC-TGGCCGTTCG-GAAGTTTG-TGCTTCTGAACTTC-G-GCGCAGAGCGC-ATCAGATAACTCGGAGCATTAGGTCGA- 574 ||||||||| ||||||||||| | |||||||||||||| ||||||||||| |||||| ||| |||| || |||||| |||| ||||||||||||||||||||| | |||||||||||| | |||||||||| |||||| ||| |||||||||||||||| | ||| | ||| |||| ||||||||||| | ||| ||||| ||| ||||||||||||| ||||| | |||||| ||| ||||||||| |||||||| ||||||||||||| ||||| ||| | || ||||||||||||| |||||| ||||||||||||||| ||||| |||| |||||||||||||| ||| |||| ||| ||| |||||||||||||| ||||||||||||| ||| ||| | || ||| |||||||| | ||||||| | | ||||||||| |||||| || || | ||||| || | ||| |||||||||||||| |||| | |||| |||||||| || |||| ||||| || ||| |||||||| |||||| ||| ||||| |||||||| |||| ||||||||| | ||||||||||| |||| ||||||||| ||| |||||||| 0 TGTCTCTGATCTGCGTTCTGTGGGGGGCGCTTGGTCGCGCACCGCCCGTA-TCTAGATCTAGTAACTATCTCACACTGGCTTGCGCGGGTGAGTCGCGGGAATGTAAAAGACAATTGTGTAATATAGCCACGAGGACTCCAGCGCCTACGACCACAAATTTATCCTATTCTGCTGTAACGCCTAGGCTTGGGTATG-TCCTCTTTTAGCATGTCCATACCATAGGGTTTTAGCGCGGTCCCGAAACTTTGCGGTCGGGGTCGGTAGTCATACCCAAACGGCGAAACG-CGAAAGCAGCCGGCTGAATTGGG-TTGGGACCTGAGCTC-GTGAATTTTCATTTGCCTCGTATCC-AATACAACGTCCAAAT-GCTAAAGTCATGACGAGTGTCGGTACACGCAAGATAAT-ACAAGCTTGCAGAGAGACCCTGTAATGTA-TAGCAACAGCATGTGTAAC-TAGCGATGAGTGCAGCTACTGGGTTACGACCGTC-AGACCAG-CTTTCTTAAGTCC-AGTGAGA-TTCTC-CGGAGGCAAATCCTGTCGACGGCAAGGCTGTTCGCGAAGTTTGCTGCTCCTGAACTTCAGAGCGCAGAGCGCAATCAAATAACTCGG-GCA-TAGGTCGAT 614 [I21:G,D24:G,I60:G,S60:G->T,D61:T,I76:G,D77:G,I81:G,I81:C,D84:C,D86:G,I119:A,D120:A,I143:C,D144:C,I162:C,D163:C,I166:T,I167:C,D168:C,D169:T,I171:C,S171:C->T,D172:T,D202:T,S204:A->T,I205:A,I224:T,I224:T,D225:T,D226:T,I235:T,S235:T->C,S238:C->G,D239:G,I259:G,D260:G,I283:C,S283:C->G,D284:G,I301:A,D302:A,I328:T,D330:T,I404:A,D405:A,I408:T,D409:T,I419:C,D421:C,I539:A,D540:A,D600:C,S601:G->C,I602:G] 0 TGTCTCTGATCTGCGTTCTGT-GGGGGGCGCTTGGTCGCGCACCGCCCGTATCTAGATCTA-GTAACTATCTCACACT-GGCTT--GCGCGGGTGAGTCGCGGGAATGTAAAAGACAATTGTGT-AATATAGCCACGAGGACTCCAGCG-CCTACGACCACAAATTTAT-CCTA-T-TCTG-CTGTAACGCCTAGGCTTGGGTATGTCCTCTTTTA-GCATGTCCATACCATAGGG--TTTTAGCGCGG-TCCCGAAACTTTGCGGTCGGGGTC-GGTAGTCATACCCAAACGGCGAAA-CGCGAAAGCAGCCGGCTG-AATTGGGTTGGGACCTGAGCTCGTGAA-TTTTCATTTGCCTCGTATCCAATACAACGTCCAAATGCTAAAGTCATGACGAGTGTCGGTACACGCAAGATAATAC-AAGC-TTGCAGAGAGA-CCCTGTAATGTATAGCAACAGCATGTGTAACTAGCGATGAGTGCAGCTACTGGGTTACGACCGTCAGACCAGCTTTCTTAAGTCCAGTGAGATTCTCCGGAGGCAAATCCTGTCGACGGC-AAGGCTGTTCGCGAAGTTTGCTGCTCCTGAACTTCAGAGCGCAGAGCGCAATCAAATAACTCG-GGCATAGGTCGAT 614 ||||||||||||||||||||| ||| ||||||||||||||||||||||||||||||||||| |||||||||||||| | ||| ||| | |||||||||||||||||||||||||||||||| | |||||||||||||||||||||| | ||||||||||||||||| | || | | | ||||||||||||||||||||||||||||| | ||||||||||||||||||| | |||||||| || ||||||||||||||||||| | |||||||||||||||||||||| |||||||||||||||| | ||||||||||||||||||||||||| || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | || | ||||||||| || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| 0 TGTCTCTGATCTGCGTTCTGTGGGG-GGCGCTTGGTCGCGCACCGCCCGTATCTAGATCTAGT-AACTATCTCACACTGG-CTTGCGCG-G-GTGAGTCGCGGGAATGTAAAAGACAATTGTGTAA-TATAGCCACGAGGACTCCAGCGCC-TACGACCACAAATTTATCC-TATTCT--GCT-GTAACGCCTAGGCTTGGGTATGTCCTCTT-TTAGCATGTCCATACCATAGGGTTT--TAGCGCGGTCCCG-AAACTTTGCGGTCGGGGTCGG-TAGTCATACCCAAACGGCGAAACG-CGAAAGCAGCCGGCTGAA-TTGGGTTGGGACCTGAGCTCGTGAATTT-TCATTTGCCTCGTATCCAATACAACGTCCAAATGCTAAAGTCATGACGAGTGTCGGTACACGCAAGATAATACAA-GCTT-GCAGAGAGACCC-TGTAATGTATAGCAACAGCATGTGTAACTAGCGATGAGTGCAGCTACTGGGTTACGACCGTCAGACCAGCTTTCTTAAGTCCAGTGAGATTCTCCGGAGGCAAATCCTGTCGACGGCAA-GGCTGTTCGCGAAGTTTGCTGCTCCTGAACTTCAGAGCGCAGAGCGCAATCAAATAACT-CGGGCATAGGTCGAT 614 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99946 elements with 366.34KiB in raw nucleotide entropy serialized into 273.39KiB com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 44 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 620 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2489 com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_add9bcf469eedc21ef54ad598e815d00c37c524916771783282530657587.fasta: 0% Indexing milib_add9bcf469eedc21ef54ad598e815d00c37c524916771783282530657587.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_add9bcf469eedc21ef54ad598e815d00c37c524916771783282530657587.fasta: 0% Indexing milib_add9bcf469eedc21ef54ad598e815d00c37c524916771783282530657587.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_821c38e2fb9733b42f0075572397157daa4ff16a5639256964795036447.tmp: 0% Indexing milib_821c38e2fb9733b42f0075572397157daa4ff16a5639256964795036447.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 203ns Addition to hash set (per operation): 659ns Hash set removal (per operation): 391ns b com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_c37a3d9e5b996fd71dfa4bcaa6168a3adec7ce1f18396727564651352189 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_e8d5f0d1888efb3efc8f40d64ea76d55ffe4f5c015323718559211528718.tmp com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_911325a65167f02ff04d1c24bebfe446eeeb0c6116879787919147693979 timeInCollate: 8.64s timeInCollatorInit: 5.3s timeAwaitingO: 2.94ms timeAwaitingI: 1.43s timeInFinalSorting1: 0ns timeInFinalSorting2: 65.82ms timeInFinalSorting3: 55.43ms /16S (5|27|32): objs=50000 size=3.31MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_349a1f31634ab91cfea4c93f109018e2d586f7f34493344604976425951 timeInCollate: 15.69s timeInCollatorInit: 1.02s timeAwaitingO: 883.4ms timeAwaitingI: 3.97s timeInFinalSorting1: 2.26s timeInFinalSorting2: 1.3s timeInFinalSorting3: 908.29ms /0N (5|27|32): objs=160949 size=7.85MiB /1N (5|27|32): objs=152392 size=7.32MiB /2N (5|27|32): objs=156149 size=7.67MiB /3N (5|27|32): objs=161414 size=7.79MiB /4N (5|27|32): objs=163713 size=7.98MiB /5N (5|27|32): objs=149142 size=6.96MiB /6N (5|27|32): objs=162148 size=7.97MiB /7N (5|27|32): objs=162066 size=7.53MiB /8N (5|27|32): objs=159775 size=7.73MiB /9N (5|27|32): objs=161494 size=7.79MiB /10N (5|27|32): objs=152767 size=7.25MiB /11N (5|27|32): objs=154793 size=7.39MiB /12N (5|27|32): objs=163901 size=8.19MiB /13N (5|27|32): objs=156395 size=7.58MiB /14N (5|27|32): objs=154983 size=7.37MiB /15N (5|27|32): objs=155770 size=7.42MiB /16N (5|27|32): objs=153028 size=7.3MiB /17N (5|27|32): objs=151306 size=7.18MiB /18N (5|27|32): objs=152324 size=7.12MiB /19N (5|27|32): objs=160933 size=7.82MiB /20N (5|27|32): objs=159323 size=7.83MiB /21N (5|27|32): objs=151130 size=6.95MiB /22N (5|27|32): objs=145759 size=6.95MiB /23N (5|27|32): objs=146686 size=6.78MiB /24N (5|27|32): objs=163854 size=8.09MiB /25N (5|27|32): objs=158277 size=7.71MiB /26N (5|27|32): objs=158170 size=7.72MiB /27N (5|27|32): objs=153248 size=7.38MiB /28N (5|27|32): objs=157021 size=7.53MiB /29N (5|27|32): objs=158844 size=7.63MiB /30N (5|27|32): objs=153979 size=7.36MiB /31N (5|27|32): objs=148267 size=6.81MiB /0/0N (2|25|36): objs=40711 size=952.61KiB /0/1N (2|25|36): objs=39821 size=853.15KiB /0/2N (2|25|36): objs=35057 size=561.53KiB /0/3S (2|25|36): objs=155 size=119B /0/4N (2|25|36): objs=2623 size=11.02KiB /0/5S (2|25|36): objs=154 size=185B /0/6N (2|25|36): objs=3511 size=15.23KiB /0/7S (2|25|36): objs=139 size=211B /0/8S (2|25|36): objs=151 size=157B /0/9N (2|25|36): objs=455 size=1.56KiB /0/10S (2|25|36): objs=158 size=168B /0/11N (2|25|36): objs=1058 size=4.13KiB /0/12S (2|25|36): objs=181 size=157B /0/13N (2|25|36): objs=1537 size=6.2KiB /0/14S (2|25|36): objs=137 size=145B /0/15N (2|25|36): objs=774 size=2.93KiB /0/16S (2|25|36): objs=149 size=302B /0/17N (2|25|36): objs=4450 size=22.41KiB /0/18S (2|25|36): objs=165 size=311B /0/19N (2|25|36): objs=5515 size=27.47KiB /0/20S (2|25|36): objs=149 size=100B /0/21N (2|25|36): objs=2859 size=12.88KiB /0/22S (2|25|36): objs=155 size=111B /0/23N (2|25|36): objs=2761 size=11.51KiB /0/24S (2|25|36): objs=137 size=159B /0/25N (2|25|36): objs=8012 size=46.32KiB /0/26S (2|25|36): objs=144 size=243B /0/27S (2|25|36): objs=147 size=132B /0/28S (2|25|36): objs=168 size=265B /0/29N (2|25|36): objs=1373 size=5.69KiB /0/30S (2|25|36): objs=132 size=267B /0/31N (2|25|36): objs=1367 size=5.6KiB /0/32S (2|25|36): objs=143 size=131B /0/33N (2|25|36): objs=1086 size=4.27KiB /0/34S (2|25|36): objs=152 size=242B /0/35N (2|25|36): objs=5263 size=24.13KiB /1/0N (2|25|36): objs=36127 size=696.97KiB /1/1N (2|25|36): objs=39006 size=840.99KiB /1/2N (2|25|36): objs=38080 size=735.98KiB /1/3N (2|25|36): objs=12345 size=70.45KiB /1/4S (2|25|36): objs=147 size=109B /1/5S (2|25|36): objs=142 size=279B /1/6S (2|25|36): objs=171 size=286B /1/7S (2|25|36): objs=149 size=183B /1/8S (2|25|36): objs=154 size=191B /1/9N (2|25|36): objs=2336 size=9.88KiB /1/10S (2|25|36): objs=161 size=92B /1/11N (2|25|36): objs=3807 size=16.9KiB /1/12S (2|25|36): objs=183 size=219B /1/13S (2|25|36): objs=142 size=273B /1/14S (2|25|36): objs=173 size=92B /1/15N (2|25|36): objs=1075 size=4.38KiB /1/16S (2|25|36): objs=153 size=119B /1/17N (2|25|36): objs=1184 size=4.96KiB /1/18S (2|25|36): objs=154 size=190B /1/19N (2|25|36): objs=1066 size=4.4KiB /1/20S (2|25|36): objs=152 size=155B /1/21N (2|25|36): objs=765 size=2.92KiB /1/22S (2|25|36): objs=145 size=99B /1/23S (2|25|36): objs=152 size=304B /1/24S (2|25|36): objs=158 size=325B /1/25N (2|25|36): objs=2385 size=10.19KiB /1/26S (2|25|36): objs=147 size=215B /1/27N (2|25|36): objs=1177 size=4.96KiB /1/28S (2|25|36): objs=145 size=246B /1/29N (2|25|36): objs=2539 size=10.95KiB /1/30S (2|25|36): objs=170 size=150B /1/31N (2|25|36): objs=3973 size=17.17KiB /1/32S (2|25|36): objs=144 size=175B /1/33N (2|25|36): objs=883 size=3.69KiB /1/34S (2|25|36): objs=168 size=355B /1/35N (2|25|36): objs=2534 size=10.52KiB /2/0N (2|25|36): objs=39330 size=830.13KiB /2/1N (2|25|36): objs=38429 size=855.69KiB /2/2N (2|25|36): objs=24801 size=240.11KiB /2/3S (2|25|36): objs=147 size=323B /2/4N (2|25|36): objs=13755 size=86.77KiB /2/5N (2|25|36): objs=5465 size=25.94KiB /2/6S (2|25|36): objs=152 size=117B /2/7N (2|25|36): objs=1265 size=4.91KiB /2/8S (2|25|36): objs=151 size=164B /2/9N (2|25|36): objs=3662 size=15.67KiB /2/10S (2|25|36): objs=162 size=222B /2/11N (2|25|36): objs=899 size=3.56KiB /2/12S (2|25|36): objs=155 size=208B /2/13N (2|25|36): objs=3259 size=14.36KiB /2/14S (2|25|36): objs=176 size=238B /2/15N (2|25|36): objs=3610 size=15.88KiB /2/16S (2|25|36): objs=163 size=309B /2/17N (2|25|36): objs=1851 size=7.73KiB /2/18S (2|25|36): objs=150 size=198B /2/19N (2|25|36): objs=6087 size=27.19KiB /2/20S (2|25|36): objs=170 size=242B /2/22S (2|25|36): objs=145 size=194B /2/23N (2|25|36): objs=1414 size=5.71KiB /2/24S (2|25|36): objs=147 size=150B /2/25N (2|25|36): objs=3351 size=17.58KiB /2/26S (2|25|36): objs=147 size=182B /2/27N (2|25|36): objs=818 size=3.29KiB /2/28S (2|25|36): objs=135 size=128B /2/30S (2|25|36): objs=138 size=158B /2/31N (2|25|36): objs=577 size=2.18KiB /2/32S (2|25|36): objs=153 size=211B /2/33N (2|25|36): objs=1220 size=5.14KiB /2/34S (2|25|36): objs=159 size=127B /2/35N (2|25|36): objs=3906 size=17.62KiB /3/0N (2|25|36): objs=37930 size=825.48KiB /3/1N (2|25|36): objs=37773 size=651.03KiB /3/2N (2|25|36): objs=43768 size=1.04MiB /3/3N (2|25|36): objs=7215 size=34.79KiB /3/4S (2|25|36): objs=145 size=275B /3/5N (2|25|36): objs=733 size=2.87KiB /3/6S (2|25|36): objs=163 size=254B /3/7N (2|25|36): objs=3697 size=16.02KiB /3/8S (2|25|36): objs=143 size=173B /3/9N (2|25|36): objs=289 size=781B /3/10S (2|25|36): objs=173 size=322B /3/12S (2|25|36): objs=167 size=163B /3/13N (2|25|36): objs=4297 size=19.47KiB /3/14S (2|25|36): objs=158 size=288B /3/15N (2|25|36): objs=587 size=2.24KiB /3/16S (2|25|36): objs=144 size=121B /3/17N (2|25|36): objs=779 size=2.75KiB /3/18S (2|25|36): objs=160 size=162B /3/19N (2|25|36): objs=4532 size=22.76KiB /3/20S (2|25|36): objs=174 size=178B /3/21N (2|25|36): objs=3245 size=13.47KiB /3/22S (2|25|36): objs=164 size=335B /3/23N (2|25|36): objs=304 size=804B /3/24S (2|25|36): objs=146 size=315B /3/25N (2|25|36): objs=1525 size=6.46KiB /3/26S (2|25|36): objs=140 size=165B /3/27N (2|25|36): objs=3563 size=16.57KiB /3/28S (2|25|36): objs=147 size=118B /3/30S (2|25|36): objs=147 size=140B /3/31N (2|25|36): objs=4684 size=23.16KiB /3/32S (2|25|36): objs=128 size=197B /3/33N (2|25|36): objs=3740 size=16.91KiB /3/34S (2|25|36): objs=133 size=322B /3/35N (2|25|36): objs=321 size=926B /4/0N (2|25|36): objs=40740 size=896.08KiB /4/1N (2|25|36): objs=41769 size=949.47KiB /4/2N (2|25|36): objs=43549 size=1013.53KiB /4/3N (2|25|36): objs=8495 size=41.18KiB /4/4S (2|25|36): objs=163 size=217B /4/5N (2|25|36): objs=1961 size=8.33KiB /4/6S (2|25|36): objs=174 size=199B /4/7N (2|25|36): objs=308 size=1.03KiB /4/8S (2|25|36): objs=178 size=358B /4/9N (2|25|36): objs=785 size=2.76KiB /4/10S (2|25|36): objs=155 size=180B /4/11N (2|25|36): objs=1969 size=8.14KiB /4/12S (2|25|36): objs=147 size=102B /4/13N (2|25|36): objs=610 size=2.43KiB /4/14S (2|25|36): objs=164 size=255B /4/15N (2|25|36): objs=3995 size=17.85KiB /4/16S (2|25|36): objs=162 size=117B /4/17N (2|25|36): objs=4255 size=18.67KiB /4/18S (2|25|36): objs=141 size=300B /4/19S (2|25|36): objs=133 size=124B /4/20S (2|25|36): objs=155 size=239B /4/21N (2|25|36): objs=829 size=3.02KiB /4/22S (2|25|36): objs=149 size=287B /4/23N (2|25|36): objs=1528 size=6.35KiB /4/24S (2|25|36): objs=157 size=279B /4/25N (2|25|36): objs=1835 size=7.68KiB /4/26S (2|25|36): objs=166 size=338B /4/27N (2|25|36): objs=2758 size=12.36KiB /4/28S (2|25|36): objs=151 size=171B /4/29N (2|25|36): objs=321 size=966B /4/30S (2|25|36): objs=148 size=132B /4/31N (2|25|36): objs=1503 size=6.45KiB /4/32S (2|25|36): objs=152 size=295B /4/33N (2|25|36): objs=2275 size=10.17KiB /4/34S (2|25|36): objs=142 size=302B /4/35N (2|25|36): objs=1591 size=6.72KiB /5/0N (2|25|36): objs=38962 size=679.76KiB /5/1N (2|25|36): objs=38878 size=801.6KiB /5/2N (2|25|36): objs=34493 size=571.21KiB /5/3N (2|25|36): objs=762 size=2.9KiB /5/4S (2|25|36): objs=156 size=119B /5/5N (2|25|36): objs=2363 size=9.94KiB /5/6S (2|25|36): objs=141 size=86B /5/7N (2|25|36): objs=8604 size=49.5KiB /5/8S (2|25|36): objs=141 size=88B /5/10S (2|25|36): objs=162 size=208B /5/11N (2|25|36): objs=1545 size=6.39KiB /5/12S (2|25|36): objs=152 size=319B /5/13N (2|25|36): objs=5446 size=27.47KiB /5/14S (2|25|36): objs=159 size=207B /5/15N (2|25|36): objs=1998 size=8.39KiB /5/16S (2|25|36): objs=141 size=197B /5/18S (2|25|36): objs=159 size=137B /5/19N (2|25|36): objs=901 size=3.63KiB /5/20S (2|25|36): objs=175 size=176B /5/21N (2|25|36): objs=440 size=1.63KiB /5/22S (2|25|36): objs=187 size=106B /5/23N (2|25|36): objs=1474 size=6.1KiB /5/24S (2|25|36): objs=147 size=160B /5/25N (2|25|36): objs=2024 size=8.52KiB /5/26S (2|25|36): objs=177 size=155B /5/27N (2|25|36): objs=2207 size=9.24KiB /5/28S (2|25|36): objs=152 size=347B /5/29N (2|25|36): objs=2169 size=8.9KiB /5/30S (2|25|36): objs=154 size=121B /5/31N (2|25|36): objs=1005 size=4KiB /5/32S (2|25|36): objs=171 size=262B /5/33N (2|25|36): objs=3327 size=15.05KiB /5/34S (2|25|36): objs=170 size=269B /6/0N (2|25|36): objs=37845 size=808.72KiB /6/1N (2|25|36): objs=44960 size=1.08MiB /6/2N (2|25|36): objs=41241 size=839.89KiB /6/3N (2|25|36): objs=3618 size=16.38KiB /6/4S (2|25|36): objs=149 size=97B /6/5N (2|25|36): objs=1259 size=5.06KiB /6/6S (2|25|36): objs=142 size=279B /6/7N (2|25|36): objs=782 size=3.11KiB /6/8S (2|25|36): objs=138 size=293B /6/9N (2|25|36): objs=1073 size=4.25KiB /6/10S (2|25|36): objs=151 size=103B /6/11N (2|25|36): objs=1528 size=6.4KiB /6/12S (2|25|36): objs=173 size=314B /6/13N (2|25|36): objs=311 size=941B /6/14S (2|25|36): objs=142 size=279B /6/15S (2|25|36): objs=155 size=278B /6/16S (2|25|36): objs=149 size=298B /6/17N (2|25|36): objs=1121 size=4.46KiB /6/18S (2|25|36): objs=172 size=175B /6/19N (2|25|36): objs=11855 size=60.85KiB /6/20S (2|25|36): objs=155 size=271B /6/21N (2|25|36): objs=1034 size=4.13KiB /6/22S (2|25|36): objs=144 size=224B /6/23N (2|25|36): objs=283 size=1003B /6/24S (2|25|36): objs=155 size=269B /6/25N (2|25|36): objs=1176 size=4.79KiB /6/26S (2|25|36): objs=170 size=170B /6/27N (2|25|36): objs=7697 size=41.96KiB /6/28S (2|25|36): objs=163 size=221B /6/30S (2|25|36): objs=169 size=108B /6/31S (2|25|36): objs=161 size=97B /6/32S (2|25|36): objs=125 size=173B /6/33N (2|25|36): objs=761 size=3.03KiB /6/34S (2|25|36): objs=142 size=202B /6/35N (2|25|36): objs=2849 size=12.96KiB /7/0N (2|25|36): objs=42751 size=892.29KiB /7/1N (2|25|36): objs=40113 size=806.87KiB /7/2N (2|25|36): objs=40169 size=782.94KiB /7/3N (2|25|36): objs=4508 size=21.39KiB /7/4S (2|25|36): objs=133 size=291B /7/5N (2|25|36): objs=6015 size=30.73KiB /7/6S (2|25|36): objs=157 size=341B /7/7S (2|25|36): objs=166 size=271B /7/8S (2|25|36): objs=139 size=248B /7/9N (2|25|36): objs=4691 size=20.41KiB /7/10S (2|25|36): objs=179 size=125B /7/11N (2|25|36): objs=2088 size=9.05KiB /7/12S (2|25|36): objs=149 size=139B /7/13N (2|25|36): objs=913 size=3.54KiB /7/14S (2|25|36): objs=149 size=126B /7/15N (2|25|36): objs=1433 size=5.76KiB /7/16S (2|25|36): objs=154 size=95B /7/17N (2|25|36): objs=1116 size=4.51KiB /7/18S (2|25|36): objs=151 size=176B /7/19N (2|25|36): objs=1065 size=4.17KiB /7/20S (2|25|36): objs=149 size=114B /7/21N (2|25|36): objs=747 size=2.92KiB /7/22S (2|25|36): objs=124 size=211B /7/24S (2|25|36): objs=137 size=206B /7/25N (2|25|36): objs=601 size=2.22KiB /7/26S (2|25|36): objs=157 size=127B /7/27N (2|25|36): objs=2858 size=12KiB /7/28S (2|25|36): objs=171 size=188B /7/29N (2|25|36): objs=325 size=967B /7/30S (2|25|36): objs=141 size=203B /7/31N (2|25|36): objs=4217 size=18.76KiB /7/32S (2|25|36): objs=159 size=207B /7/33N (2|25|36): objs=3498 size=15.55KiB /7/34S (2|25|36): objs=158 size=300B /7/35N (2|25|36): objs=2385 size=9.95KiB /8/0N (2|25|36): objs=40580 size=722.84KiB /8/1N (2|25|36): objs=3654 size=16.14KiB /8/2S (2|25|36): objs=174 size=288B /8/3N (2|25|36): objs=34407 size=600.29KiB /8/4N (2|25|36): objs=39423 size=850.41KiB /8/5N (2|25|36): objs=5788 size=26.43KiB /8/6S (2|25|36): objs=163 size=352B /8/7N (2|25|36): objs=2370 size=10.61KiB /8/8S (2|25|36): objs=161 size=255B /8/9N (2|25|36): objs=295 size=875B /8/10S (2|25|36): objs=141 size=137B /8/11N (2|25|36): objs=734 size=2.9KiB /8/12S (2|25|36): objs=160 size=332B /8/14S (2|25|36): objs=143 size=261B /8/15N (2|25|36): objs=3974 size=17.88KiB /8/16S (2|25|36): objs=147 size=322B /8/17N (2|25|36): objs=1619 size=6.64KiB /8/18S (2|25|36): objs=175 size=187B /8/19N (2|25|36): objs=1683 size=6.82KiB /8/20S (2|25|36): objs=142 size=187B /8/21N (2|25|36): objs=7550 size=40.81KiB /8/22S (2|25|36): objs=167 size=124B /8/23N (2|25|36): objs=2787 size=11.98KiB /8/24S (2|25|36): objs=155 size=204B /8/25N (2|25|36): objs=769 size=2.72KiB /8/26S (2|25|36): objs=154 size=120B /8/27N (2|25|36): objs=1404 size=5.74KiB /8/28S (2|25|36): objs=175 size=212B /8/29N (2|25|36): objs=632 size=2.45KiB /8/30S (2|25|36): objs=161 size=293B /8/31N (2|25|36): objs=2932 size=12.41KiB /8/32S (2|25|36): objs=165 size=224B /8/33N (2|25|36): objs=5074 size=23.87KiB /8/34S (2|25|36): objs=174 size=281B /8/35N (2|25|36): objs=1543 size=6.38KiB /9/0N (2|25|36): objs=38419 size=740.71KiB /9/1N (2|25|36): objs=36732 size=704.53KiB /9/2N (2|25|36): objs=42988 size=976.51KiB /9/3N (2|25|36): objs=2362 size=9.9KiB /9/4S (2|25|36): objs=131 size=306B /9/5N (2|25|36): objs=886 size=3.46KiB /9/6S (2|25|36): objs=133 size=181B /9/7N (2|25|36): objs=5886 size=30.37KiB /9/8S (2|25|36): objs=187 size=129B /9/9N (2|25|36): objs=294 size=886B /9/10S (2|25|36): objs=144 size=302B /9/11N (2|25|36): objs=1510 size=6.09KiB /9/12S (2|25|36): objs=161 size=219B /9/13N (2|25|36): objs=7268 size=35.39KiB /9/14S (2|25|36): objs=149 size=188B /9/15N (2|25|36): objs=1245 size=4.86KiB /9/16S (2|25|36): objs=133 size=327B /9/17N (2|25|36): objs=322 size=933B /9/18S (2|25|36): objs=137 size=88B /9/19N (2|25|36): objs=1489 size=6.16KiB /9/20S (2|25|36): objs=156 size=170B /9/21N (2|25|36): objs=1400 size=5.92KiB /9/22S (2|25|36): objs=138 size=162B /9/23N (2|25|36): objs=8391 size=45.48KiB /9/24S (2|25|36): objs=154 size=275B /9/25N (2|25|36): objs=3097 size=13.28KiB /9/26S (2|25|36): objs=167 size=91B /9/27N (2|25|36): objs=486 size=1.73KiB /9/28S (2|25|36): objs=139 size=137B /9/29S (2|25|36): objs=140 size=282B /9/30S (2|25|36): objs=150 size=335B /9/31N (2|25|36): objs=1661 size=6.82KiB /9/32S (2|25|36): objs=154 size=155B /9/33N (2|25|36): objs=1227 size=4.95KiB /9/34S (2|25|36): objs=166 size=240B /9/35N (2|25|36): objs=3292 size=14.71KiB /10/0N (2|25|36): objs=35242 size=696.43KiB /10/1N (2|25|36): objs=39624 size=809.73KiB /10/2N (2|25|36): objs=39660 size=907.99KiB /10/3N (2|25|36): objs=739 size=2.99KiB /10/4S (2|25|36): objs=164 size=305B /10/5N (2|25|36): objs=2329 size=9.68KiB /10/6S (2|25|36): objs=145 size=231B /10/7N (2|25|36): objs=2419 size=10.22KiB /10/8S (2|25|36): objs=161 size=236B /10/9N (2|25|36): objs=2575 size=10.55KiB /10/10S (2|25|36): objs=168 size=122B /10/11N (2|25|36): objs=3489 size=14.96KiB /10/12S (2|25|36): objs=158 size=189B /10/13N (2|25|36): objs=1022 size=4.02KiB /10/14S (2|25|36): objs=141 size=250B /10/15N (2|25|36): objs=4382 size=19.65KiB /10/16S (2|25|36): objs=142 size=197B /10/17N (2|25|36): objs=2675 size=11.25KiB /10/18S (2|25|36): objs=147 size=268B /10/19N (2|25|36): objs=2853 size=12KiB /10/20S (2|25|36): objs=149 size=281B /10/21N (2|25|36): objs=1057 size=4.13KiB /10/22S (2|25|36): objs=147 size=174B /10/23N (2|25|36): objs=475 size=1.63KiB /10/24S (2|25|36): objs=178 size=330B /10/25N (2|25|36): objs=625 size=2.32KiB /10/26S (2|25|36): objs=145 size=187B /10/27S (2|25|36): objs=160 size=264B /10/28S (2|25|36): objs=149 size=197B /10/29N (2|25|36): objs=425 size=1.46KiB /10/30S (2|25|36): objs=151 size=123B /10/31N (2|25|36): objs=912 size=3.84KiB /10/32S (2|25|36): objs=153 size=111B /10/33N (2|25|36): objs=4953 size=23.24KiB /10/34S (2|25|36): objs=173 size=154B /10/35N (2|25|36): objs=4680 size=21.03KiB /11/0N (2|25|36): objs=42601 size=1.02MiB /11/1N (2|25|36): objs=39770 size=741.34KiB /11/2N (2|25|36): objs=34648 size=630.81KiB /11/3S (2|25|36): objs=172 size=225B /11/4N (2|25|36): objs=3054 size=14.01KiB /11/5N (2|25|36): objs=4458 size=23.15KiB /11/6S (2|25|36): objs=143 size=218B /11/7N (2|25|36): objs=306 size=923B /11/8S (2|25|36): objs=159 size=269B /11/10S (2|25|36): objs=165 size=156B /11/11N (2|25|36): objs=777 size=2.89KiB /11/12S (2|25|36): objs=169 size=250B /11/13N (2|25|36): objs=3418 size=15.15KiB /11/14S (2|25|36): objs=151 size=335B /11/15N (2|25|36): objs=320 size=783B /11/16S (2|25|36): objs=158 size=239B /11/17N (2|25|36): objs=647 size=2.45KiB /11/18S (2|25|36): objs=126 size=138B /11/19N (2|25|36): objs=879 size=3.47KiB /11/20S (2|25|36): objs=147 size=88B /11/21N (2|25|36): objs=450 size=1.48KiB /11/22S (2|25|36): objs=149 size=319B /11/23N (2|25|36): objs=1103 size=4.27KiB /11/24S (2|25|36): objs=160 size=292B /11/25N (2|25|36): objs=2094 size=8.97KiB /11/26S (2|25|36): objs=148 size=200B /11/27N (2|25|36): objs=3211 size=13.75KiB /11/28S (2|25|36): objs=165 size=256B /11/29N (2|25|36): objs=4166 size=19.82KiB /11/30S (2|25|36): objs=157 size=347B /11/31N (2|25|36): objs=1949 size=8.09KiB /11/32S (2|25|36): objs=159 size=238B /11/33N (2|25|36): objs=5325 size=25.46KiB /11/34S (2|25|36): objs=154 size=221B /11/35N (2|25|36): objs=3135 size=14.89KiB /12/0N (2|25|36): objs=43179 size=1.07MiB /12/1N (2|25|36): objs=40168 size=877.02KiB /12/2N (2|25|36): objs=38668 size=849.36KiB /12/3N (2|25|36): objs=5487 size=23.44KiB /12/4S (2|25|36): objs=138 size=231B /12/5N (2|25|36): objs=470 size=1.35KiB /12/6S (2|25|36): objs=147 size=125B /12/7N (2|25|36): objs=4827 size=20.65KiB /12/8S (2|25|36): objs=158 size=195B /12/9N (2|25|36): objs=1201 size=5.17KiB /12/10S (2|25|36): objs=151 size=180B /12/11N (2|25|36): objs=1344 size=5.51KiB /12/12S (2|25|36): objs=141 size=179B /12/13N (2|25|36): objs=7511 size=41.57KiB /12/14S (2|25|36): objs=166 size=346B /12/15N (2|25|36): objs=474 size=1.43KiB /12/16S (2|25|36): objs=156 size=181B /12/17N (2|25|36): objs=1396 size=5.47KiB /12/18S (2|25|36): objs=160 size=236B /12/19N (2|25|36): objs=598 size=2.15KiB /12/20S (2|25|36): objs=155 size=277B /12/21N (2|25|36): objs=2104 size=8.91KiB /12/22S (2|25|36): objs=149 size=204B /12/23N (2|25|36): objs=2615 size=11.64KiB /12/24S (2|25|36): objs=172 size=93B /12/25N (2|25|36): objs=612 size=2.41KiB /12/26S (2|25|36): objs=152 size=94B /12/28S (2|25|36): objs=167 size=322B /12/29N (2|25|36): objs=5296 size=23.01KiB /12/30S (2|25|36): objs=155 size=312B /12/31N (2|25|36): objs=4764 size=23.34KiB /12/32S (2|25|36): objs=136 size=199B /12/33N (2|25|36): objs=616 size=2.16KiB /12/34S (2|25|36): objs=132 size=239B /12/35S (2|25|36): objs=136 size=320B /13/0N (2|25|36): objs=38735 size=800.77KiB /13/1N (2|25|36): objs=36642 size=611.51KiB /13/2N (2|25|36): objs=41462 size=908.33KiB /13/3N (2|25|36): objs=10405 size=55.14KiB /13/4S (2|25|36): objs=167 size=314B /13/5N (2|25|36): objs=2011 size=9.34KiB /13/6S (2|25|36): objs=151 size=220B /13/7N (2|25|36): objs=764 size=2.94KiB /13/8S (2|25|36): objs=141 size=215B /13/9N (2|25|36): objs=10657 size=53.46KiB /13/10S (2|25|36): objs=159 size=183B /13/11N (2|25|36): objs=1105 size=4.55KiB /13/12S (2|25|36): objs=139 size=133B /13/13N (2|25|36): objs=1872 size=7.89KiB /13/14S (2|25|36): objs=138 size=154B /13/15N (2|25|36): objs=455 size=1.71KiB /13/16S (2|25|36): objs=171 size=181B /13/18S (2|25|36): objs=165 size=271B /13/19N (2|25|36): objs=592 size=2.12KiB /13/20S (2|25|36): objs=156 size=171B /13/21N (2|25|36): objs=1518 size=6.03KiB /13/22S (2|25|36): objs=153 size=208B /13/23S (2|25|36): objs=148 size=325B /13/24S (2|25|36): objs=165 size=186B /13/25N (2|25|36): objs=2637 size=11.05KiB /13/26S (2|25|36): objs=148 size=182B /13/27N (2|25|36): objs=745 size=2.8KiB /13/28S (2|25|36): objs=135 size=297B /13/29N (2|25|36): objs=881 size=3.53KiB /13/30S (2|25|36): objs=148 size=210B /13/31N (2|25|36): objs=977 size=3.65KiB /13/32S (2|25|36): objs=161 size=172B /13/33N (2|25|36): objs=793 size=2.96KiB /13/34S (2|25|36): objs=148 size=275B /13/35N (2|25|36): objs=1551 size=6.28KiB /14/0N (2|25|36): objs=39644 size=835.14KiB /14/1N (2|25|36): objs=36228 size=612.86KiB /14/2N (2|25|36): objs=40762 size=861.16KiB /14/3N (2|25|36): objs=16629 size=117.99KiB /14/4S (2|25|36): objs=146 size=140B /14/5N (2|25|36): objs=742 size=3.06KiB /14/6S (2|25|36): objs=154 size=333B /14/8S (2|25|36): objs=159 size=189B /14/10S (2|25|36): objs=165 size=194B /14/12S (2|25|36): objs=147 size=278B /14/13N (2|25|36): objs=1428 size=5.65KiB /14/14S (2|25|36): objs=140 size=86B /14/15N (2|25|36): objs=946 size=3.69KiB /14/16S (2|25|36): objs=153 size=130B /14/17N (2|25|36): objs=4521 size=20.18KiB /14/18S (2|25|36): objs=173 size=213B /14/19S (2|25|36): objs=151 size=301B /14/20S (2|25|36): objs=145 size=294B /14/21N (2|25|36): objs=5162 size=22.85KiB /14/22S (2|25|36): objs=142 size=111B /14/23N (2|25|36): objs=1389 size=5.75KiB /14/24S (2|25|36): objs=145 size=174B /14/25N (2|25|36): objs=976 size=3.87KiB /14/26S (2|25|36): objs=139 size=267B /14/27N (2|25|36): objs=1681 size=6.78KiB /14/28S (2|25|36): objs=160 size=163B /14/30S (2|25|36): objs=169 size=212B /14/31S (2|25|36): objs=154 size=211B /14/32S (2|25|36): objs=141 size=173B /14/33N (2|25|36): objs=1246 size=4.88KiB /14/34S (2|25|36): objs=156 size=289B /14/35N (2|25|36): objs=890 size=3.5KiB /15/0N (2|25|36): objs=38239 size=882.9KiB /15/1N (2|25|36): objs=37145 size=792.72KiB /15/2N (2|25|36): objs=41358 size=808.48KiB /15/3S (2|25|36): objs=154 size=216B /15/4S (2|25|36): objs=138 size=131B /15/5N (2|25|36): objs=1532 size=6.36KiB /15/6S (2|25|36): objs=154 size=242B /15/7N (2|25|36): objs=4868 size=22.77KiB /15/8S (2|25|36): objs=154 size=246B /15/9N (2|25|36): objs=2854 size=11.9KiB /15/10S (2|25|36): objs=159 size=140B /15/11N (2|25|36): objs=1067 size=4.05KiB /15/12S (2|25|36): objs=141 size=182B /15/13N (2|25|36): objs=916 size=3.29KiB /15/14S (2|25|36): objs=141 size=283B /15/15N (2|25|36): objs=3290 size=14.56KiB /15/16S (2|25|36): objs=144 size=239B /15/17N (2|25|36): objs=2037 size=8.78KiB /15/18S (2|25|36): objs=153 size=291B /15/19N (2|25|36): objs=4585 size=20.99KiB /15/20S (2|25|36): objs=131 size=231B /15/21N (2|25|36): objs=1070 size=4.24KiB /15/22S (2|25|36): objs=177 size=319B /15/23N (2|25|36): objs=297 size=866B /15/24S (2|25|36): objs=127 size=126B /15/25N (2|25|36): objs=1835 size=7.48KiB /15/26S (2|25|36): objs=149 size=292B /15/27N (2|25|36): objs=618 size=2.06KiB /15/28S (2|25|36): objs=175 size=169B /15/29N (2|25|36): objs=2581 size=11.66KiB /15/30S (2|25|36): objs=165 size=202B /15/32S (2|25|36): objs=155 size=295B /15/33N (2|25|36): objs=1511 size=6.1KiB /15/34S (2|25|36): objs=157 size=278B /15/35N (2|25|36): objs=7393 size=33.28KiB /16/0N (2|25|36): objs=38548 size=739.73KiB /16/1N (2|25|36): objs=35297 size=673.15KiB /16/2N (2|25|36): objs=37907 size=701.27KiB /16/3N (2|25|36): objs=4559 size=20.52KiB /16/4S (2|25|36): objs=176 size=137B /16/5N (2|25|36): objs=3147 size=13.2KiB /16/6S (2|25|36): objs=160 size=177B /16/7N (2|25|36): objs=771 size=2.74KiB /16/8S (2|25|36): objs=152 size=119B /16/10S (2|25|36): objs=132 size=281B /16/11N (2|25|36): objs=1356 size=5.62KiB /16/12S (2|25|36): objs=165 size=275B /16/13N (2|25|36): objs=4085 size=19.34KiB /16/14S (2|25|36): objs=151 size=118B /16/15N (2|25|36): objs=1501 size=6.32KiB /16/16S (2|25|36): objs=149 size=164B /16/17N (2|25|36): objs=3790 size=17.54KiB /16/18S (2|25|36): objs=151 size=269B /16/19N (2|25|36): objs=1520 size=6.1KiB /16/20S (2|25|36): objs=162 size=254B /16/21N (2|25|36): objs=1159 size=4.73KiB /16/22S (2|25|36): objs=163 size=196B /16/23N (2|25|36): objs=5862 size=26.45KiB /16/24S (2|25|36): objs=156 size=311B /16/25N (2|25|36): objs=1878 size=7.82KiB /16/26S (2|25|36): objs=166 size=316B /16/27N (2|25|36): objs=457 size=1.51KiB /16/28S (2|25|36): objs=154 size=166B /16/29N (2|25|36): objs=2974 size=13.22KiB /16/30S (2|25|36): objs=161 size=126B /16/31N (2|25|36): objs=642 size=2.3KiB /16/32S (2|25|36): objs=153 size=172B /16/33N (2|25|36): objs=3676 size=17.28KiB /16/34S (2|25|36): objs=135 size=106B /16/35N (2|25|36): objs=1413 size=6.02KiB /17/0N (2|25|36): objs=40309 size=803.47KiB /17/1N (2|25|36): objs=36587 size=741.96KiB /17/2N (2|25|36): objs=35484 size=647.87KiB /17/3S (2|25|36): objs=144 size=263B /17/4N (2|25|36): objs=2734 size=11.59KiB /17/5S (2|25|36): objs=157 size=220B /17/6N (2|25|36): objs=422 size=1.53KiB /17/7N (2|25|36): objs=4140 size=17.73KiB /17/8S (2|25|36): objs=134 size=141B /17/9N (2|25|36): objs=5834 size=26KiB /17/10S (2|25|36): objs=158 size=178B /17/11N (2|25|36): objs=4010 size=17.88KiB /17/12S (2|25|36): objs=151 size=148B /17/13N (2|25|36): objs=622 size=2.11KiB /17/14S (2|25|36): objs=162 size=130B /17/15N (2|25|36): objs=466 size=1.37KiB /17/16S (2|25|36): objs=160 size=100B /17/17N (2|25|36): objs=279 size=747B /17/18S (2|25|36): objs=152 size=148B /17/19S (2|25|36): objs=166 size=345B /17/20S (2|25|36): objs=155 size=333B /17/21N (2|25|36): objs=595 size=1.95KiB /17/22S (2|25|36): objs=145 size=118B /17/23N (2|25|36): objs=2402 size=9.99KiB /17/24S (2|25|36): objs=177 size=262B /17/25N (2|25|36): objs=6715 size=31.62KiB /17/26S (2|25|36): objs=167 size=118B /17/27N (2|25|36): objs=2203 size=9.21KiB /17/28S (2|25|36): objs=139 size=314B /17/30S (2|25|36): objs=156 size=314B /17/31N (2|25|36): objs=1093 size=4.34KiB /17/32S (2|25|36): objs=150 size=98B /17/33N (2|25|36): objs=2683 size=11.97KiB /17/34S (2|25|36): objs=145 size=245B /17/35N (2|25|36): objs=2110 size=8.79KiB /18/0N (2|25|36): objs=37441 size=775.92KiB /18/1N (2|25|36): objs=36464 size=662.42KiB /18/2N (2|25|36): objs=37700 size=699.23KiB /18/3S (2|25|36): objs=146 size=241B /18/4N (2|25|36): objs=2889 size=13.34KiB /18/5N (2|25|36): objs=1519 size=6.22KiB /18/6S (2|25|36): objs=149 size=312B /18/7N (2|25|36): objs=6967 size=33.45KiB /18/8S (2|25|36): objs=156 size=276B /18/9N (2|25|36): objs=1272 size=5.06KiB /18/10S (2|25|36): objs=145 size=255B /18/11N (2|25|36): objs=873 size=3.53KiB /18/12S (2|25|36): objs=142 size=170B /18/13N (2|25|36): objs=3109 size=12.95KiB /18/14S (2|25|36): objs=136 size=157B /18/15N (2|25|36): objs=618 size=2.42KiB /18/16S (2|25|36): objs=176 size=207B /18/17N (2|25|36): objs=4386 size=20.79KiB /18/18S (2|25|36): objs=151 size=157B /18/19N (2|25|36): objs=850 size=3.37KiB /18/20S (2|25|36): objs=138 size=299B /18/21S (2|25|36): objs=151 size=293B /18/22S (2|25|36): objs=153 size=86B /18/23N (2|25|36): objs=2054 size=8.48KiB /18/24S (2|25|36): objs=150 size=331B /18/25N (2|25|36): objs=2481 size=11.14KiB /18/26S (2|25|36): objs=156 size=107B /18/27N (2|25|36): objs=2096 size=8.71KiB /18/28S (2|25|36): objs=152 size=158B /18/29N (2|25|36): objs=4294 size=18.23KiB /18/30S (2|25|36): objs=140 size=318B /18/31N (2|25|36): objs=2107 size=9.02KiB /18/32S (2|25|36): objs=136 size=148B /18/33N (2|25|36): objs=2669 size=11.38KiB /18/34S (2|25|36): objs=158 size=163B /19/0N (2|25|36): objs=39914 size=891.66KiB /19/1N (2|25|36): objs=40220 size=812.22KiB /19/2N (2|25|36): objs=38735 size=802.33KiB /19/3N (2|25|36): objs=9456 size=50.73KiB /19/4S (2|25|36): objs=144 size=257B /19/5N (2|25|36): objs=1869 size=8.07KiB /19/6S (2|25|36): objs=154 size=135B /19/7N (2|25|36): objs=762 size=2.7KiB /19/8S (2|25|36): objs=161 size=112B /19/9N (2|25|36): objs=595 size=2.14KiB /19/10S (2|25|36): objs=156 size=114B /19/11S (2|25|36): objs=154 size=165B /19/12S (2|25|36): objs=166 size=174B /19/14S (2|25|36): objs=153 size=265B /19/15N (2|25|36): objs=3069 size=12.89KiB /19/16S (2|25|36): objs=152 size=265B /19/17S (2|25|36): objs=160 size=187B /19/18S (2|25|36): objs=149 size=287B /19/19N (2|25|36): objs=4287 size=20.25KiB /19/20S (2|25|36): objs=152 size=194B /19/21N (2|25|36): objs=1108 size=4.38KiB /19/22S (2|25|36): objs=171 size=232B /19/23N (2|25|36): objs=629 size=2.43KiB /19/24S (2|25|36): objs=150 size=204B /19/25N (2|25|36): objs=9767 size=53.97KiB /19/26S (2|25|36): objs=169 size=348B /19/27N (2|25|36): objs=2763 size=11.49KiB /19/28S (2|25|36): objs=172 size=122B /19/29N (2|25|36): objs=1463 size=6.13KiB /19/30S (2|25|36): objs=139 size=87B /19/31N (2|25|36): objs=423 size=1.39KiB /19/32S (2|25|36): objs=164 size=207B /19/34S (2|25|36): objs=168 size=119B /19/35N (2|25|36): objs=3039 size=12.89KiB /20/0N (2|25|36): objs=41438 size=1005.94KiB /20/1N (2|25|36): objs=43037 size=946.31KiB /20/2N (2|25|36): objs=35232 size=676.93KiB /20/3S (2|25|36): objs=152 size=308B /20/4S (2|25|36): objs=145 size=249B /20/5S (2|25|36): objs=162 size=274B /20/6N (2|25|36): objs=1718 size=6.97KiB /20/7N (2|25|36): objs=2328 size=9.65KiB /20/8S (2|25|36): objs=159 size=225B /20/9N (2|25|36): objs=1229 size=4.98KiB /20/10S (2|25|36): objs=172 size=194B /20/11N (2|25|36): objs=1270 size=5.04KiB /20/12S (2|25|36): objs=164 size=143B /20/13N (2|25|36): objs=4178 size=19.04KiB /20/14S (2|25|36): objs=156 size=315B /20/15N (2|25|36): objs=605 size=2.15KiB /20/16S (2|25|36): objs=159 size=302B /20/17N (2|25|36): objs=311 size=984B /20/18S (2|25|36): objs=151 size=169B /20/19N (2|25|36): objs=5629 size=26.12KiB /20/20S (2|25|36): objs=166 size=179B /20/21N (2|25|36): objs=2008 size=8.17KiB /20/22S (2|25|36): objs=149 size=96B /20/23N (2|25|36): objs=2166 size=9.31KiB /20/24S (2|25|36): objs=163 size=292B /20/25N (2|25|36): objs=1079 size=4.28KiB /20/26S (2|25|36): objs=139 size=315B /20/27N (2|25|36): objs=4687 size=23.28KiB /20/28S (2|25|36): objs=180 size=238B /20/29N (2|25|36): objs=1582 size=6.68KiB /20/30S (2|25|36): objs=146 size=85B /20/31N (2|25|36): objs=5178 size=23.48KiB /20/32S (2|25|36): objs=133 size=269B /20/33N (2|25|36): objs=762 size=2.76KiB /20/34S (2|25|36): objs=144 size=227B /20/35N (2|25|36): objs=2246 size=9.29KiB /21/0N (2|25|36): objs=37435 size=741.18KiB /21/1N (2|25|36): objs=38762 size=734.46KiB /21/2N (2|25|36): objs=33300 size=504.37KiB /21/3S (2|25|36): objs=147 size=174B /21/4N (2|25|36): objs=469 size=1.4KiB /21/5S (2|25|36): objs=177 size=260B /21/6N (2|25|36): objs=1489 size=6.09KiB /21/7S (2|25|36): objs=151 size=154B /21/8N (2|25|36): objs=643 size=2.22KiB /21/9N (2|25|36): objs=3637 size=15.3KiB /21/10S (2|25|36): objs=157 size=146B /21/12S (2|25|36): objs=165 size=231B /21/13N (2|25|36): objs=5416 size=26KiB /21/14S (2|25|36): objs=163 size=220B /21/15N (2|25|36): objs=1369 size=5.44KiB /21/16S (2|25|36): objs=162 size=161B /21/17N (2|25|36): objs=1429 size=5.71KiB /21/18S (2|25|36): objs=145 size=256B /21/19N (2|25|36): objs=323 size=997B /21/20S (2|25|36): objs=146 size=332B /21/21N (2|25|36): objs=1916 size=7.99KiB /21/22S (2|25|36): objs=156 size=241B /21/23N (2|25|36): objs=2866 size=11.94KiB /21/24S (2|25|36): objs=179 size=148B /21/25N (2|25|36): objs=1790 size=7.46KiB /21/26S (2|25|36): objs=141 size=172B /21/27N (2|25|36): objs=2604 size=12.91KiB /21/28S (2|25|36): objs=151 size=93B /21/29N (2|25|36): objs=3120 size=12.78KiB /21/30S (2|25|36): objs=152 size=125B /21/31N (2|25|36): objs=1494 size=6.39KiB /21/32S (2|25|36): objs=153 size=104B /21/33N (2|25|36): objs=10270 size=56.95KiB /21/34S (2|25|36): objs=148 size=301B /21/35N (2|25|36): objs=305 size=1007B /22/0N (2|25|36): objs=37747 size=766.34KiB /22/1N (2|25|36): objs=35313 size=690.65KiB /22/2N (2|25|36): objs=12630 size=78.73KiB /22/3S (2|25|36): objs=149 size=282B /22/4N (2|25|36): objs=23984 size=266.44KiB /22/5N (2|25|36): objs=4743 size=20.3KiB /22/6S (2|25|36): objs=157 size=301B /22/7N (2|25|36): objs=12017 size=71.97KiB /22/8S (2|25|36): objs=143 size=287B /22/9N (2|25|36): objs=830 size=3.19KiB /22/10S (2|25|36): objs=152 size=203B /22/11N (2|25|36): objs=463 size=1.81KiB /22/12S (2|25|36): objs=159 size=226B /22/13N (2|25|36): objs=2936 size=13.36KiB /22/14S (2|25|36): objs=156 size=203B /22/15N (2|25|36): objs=1627 size=6.68KiB /22/16S (2|25|36): objs=150 size=219B /22/17N (2|25|36): objs=2183 size=8.89KiB /22/18S (2|25|36): objs=158 size=287B /22/19N (2|25|36): objs=3917 size=17.23KiB /22/20S (2|25|36): objs=166 size=97B /22/21N (2|25|36): objs=445 size=1.59KiB /22/22S (2|25|36): objs=124 size=276B /22/23S (2|25|36): objs=131 size=192B /22/24S (2|25|36): objs=146 size=330B /22/25N (2|25|36): objs=598 size=2.29KiB /22/26S (2|25|36): objs=152 size=229B /22/27N (2|25|36): objs=770 size=3.06KiB /22/28S (2|25|36): objs=135 size=210B /22/29N (2|25|36): objs=1277 size=5.38KiB /22/30S (2|25|36): objs=148 size=264B /22/31S (2|25|36): objs=153 size=293B /22/32S (2|25|36): objs=177 size=301B /22/33N (2|25|36): objs=1402 size=5.84KiB /22/34S (2|25|36): objs=167 size=112B /22/35S (2|25|36): objs=154 size=114B /23/0N (2|25|36): objs=40136 size=912.33KiB /23/1N (2|25|36): objs=34567 size=452.23KiB /23/2N (2|25|36): objs=31692 size=483.72KiB /23/3N (2|25|36): objs=9443 size=52.33KiB /23/4S (2|25|36): objs=154 size=114B /23/5N (2|25|36): objs=283 size=894B /23/6S (2|25|36): objs=132 size=185B /23/7N (2|25|36): objs=4476 size=20.78KiB /23/8S (2|25|36): objs=143 size=287B /23/9S (2|25|36): objs=151 size=324B /23/10S (2|25|36): objs=163 size=147B /23/11N (2|25|36): objs=1842 size=7.56KiB /23/12S (2|25|36): objs=133 size=228B /23/13N (2|25|36): objs=1223 size=5.14KiB /23/14S (2|25|36): objs=174 size=352B /23/15N (2|25|36): objs=1054 size=4.01KiB /23/16S (2|25|36): objs=141 size=166B /23/17N (2|25|36): objs=4257 size=18.12KiB /23/18S (2|25|36): objs=147 size=90B /23/19N (2|25|36): objs=1461 size=5.89KiB /23/20S (2|25|36): objs=147 size=226B /23/21N (2|25|36): objs=770 size=3.07KiB /23/22S (2|25|36): objs=155 size=202B /23/23N (2|25|36): objs=2558 size=10.61KiB /23/24S (2|25|36): objs=163 size=200B /23/25N (2|25|36): objs=347 size=1.06KiB /23/26S (2|25|36): objs=159 size=108B /23/27S (2|25|36): objs=153 size=133B /23/28S (2|25|36): objs=145 size=193B /23/29N (2|25|36): objs=1202 size=4.87KiB /23/30S (2|25|36): objs=156 size=159B /23/31N (2|25|36): objs=592 size=2.2KiB /23/32S (2|25|36): objs=144 size=132B /23/33N (2|25|36): objs=2409 size=10.11KiB /23/34S (2|25|36): objs=162 size=254B /23/35N (2|25|36): objs=5652 size=24.35KiB /24/0N (2|25|36): objs=40215 size=791.92KiB /24/1N (2|25|36): objs=44119 size=1.05MiB /24/2N (2|25|36): objs=37659 size=753.78KiB /24/3S (2|25|36): objs=146 size=332B /24/4N (2|25|36): objs=2283 size=9.86KiB /24/5S (2|25|36): objs=157 size=93B /24/6S (2|25|36): objs=179 size=283B /24/7N (2|25|36): objs=4595 size=21.46KiB /24/8S (2|25|36): objs=157 size=100B /24/9N (2|25|36): objs=1846 size=7.74KiB /24/10S (2|25|36): objs=132 size=154B /24/11N (2|25|36): objs=4617 size=22.38KiB /24/12S (2|25|36): objs=156 size=110B /24/13N (2|25|36): objs=5816 size=28.97KiB /24/14S (2|25|36): objs=183 size=306B /24/15N (2|25|36): objs=479 size=1.51KiB /24/16S (2|25|36): objs=158 size=352B /24/17N (2|25|36): objs=796 size=2.96KiB /24/18S (2|25|36): objs=164 size=221B /24/19N (2|25|36): objs=766 size=3.03KiB /24/20S (2|25|36): objs=141 size=113B /24/21N (2|25|36): objs=3100 size=12.74KiB /24/22S (2|25|36): objs=146 size=152B /24/23N (2|25|36): objs=480 size=1.5KiB /24/24S (2|25|36): objs=173 size=310B /24/25N (2|25|36): objs=1538 size=6.54KiB /24/26S (2|25|36): objs=157 size=324B /24/27N (2|25|36): objs=1242 size=5.05KiB /24/28S (2|25|36): objs=168 size=360B /24/29N (2|25|36): objs=1523 size=6.36KiB /24/30S (2|25|36): objs=172 size=351B /24/31N (2|25|36): objs=1847 size=7.77KiB /24/32S (2|25|36): objs=150 size=163B /24/33N (2|25|36): objs=4800 size=23.83KiB /24/34S (2|25|36): objs=186 size=322B /24/35N (2|25|36): objs=3408 size=14.32KiB /25/0N (2|25|36): objs=40667 size=924.05KiB /25/1N (2|25|36): objs=38462 size=791.17KiB /25/2N (2|25|36): objs=40161 size=870.04KiB /25/3N (2|25|36): objs=9016 size=43.12KiB /25/4S (2|25|36): objs=175 size=113B /25/5N (2|25|36): objs=634 size=2.39KiB /25/6S (2|25|36): objs=152 size=147B /25/7N (2|25|36): objs=2422 size=10.02KiB /25/8S (2|25|36): objs=170 size=227B /25/10S (2|25|36): objs=164 size=266B /25/11N (2|25|36): objs=3285 size=14.73KiB /25/12S (2|25|36): objs=141 size=276B /25/13N (2|25|36): objs=649 size=2.3KiB /25/14S (2|25|36): objs=167 size=122B /25/15S (2|25|36): objs=150 size=336B /25/16S (2|25|36): objs=151 size=244B /25/17S (2|25|36): objs=132 size=299B /25/18S (2|25|36): objs=144 size=240B /25/19N (2|25|36): objs=443 size=1.56KiB /25/20S (2|25|36): objs=143 size=331B /25/21N (2|25|36): objs=330 size=1.11KiB /25/22S (2|25|36): objs=161 size=160B /25/23N (2|25|36): objs=2637 size=10.91KiB /25/24S (2|25|36): objs=140 size=316B /25/25N (2|25|36): objs=1826 size=7.96KiB /25/26S (2|25|36): objs=152 size=203B /25/27N (2|25|36): objs=5210 size=23.12KiB /25/28S (2|25|36): objs=156 size=338B /25/29N (2|25|36): objs=3217 size=13.84KiB /25/30S (2|25|36): objs=162 size=293B /25/32S (2|25|36): objs=138 size=182B /25/33N (2|25|36): objs=5114 size=27.34KiB /25/34S (2|25|36): objs=172 size=299B /25/35N (2|25|36): objs=1434 size=5.76KiB /26/0N (2|25|36): objs=37310 size=802.33KiB /26/1N (2|25|36): objs=42099 size=960.95KiB /26/2N (2|25|36): objs=39461 size=846.56KiB /26/3N (2|25|36): objs=2828 size=11.96KiB /26/4S (2|25|36): objs=162 size=123B /26/5N (2|25|36): objs=5618 size=27.2KiB /26/6S (2|25|36): objs=160 size=348B /26/7N (2|25|36): objs=4956 size=25.53KiB /26/8S (2|25|36): objs=151 size=328B /26/9S (2|25|36): objs=165 size=289B /26/10S (2|25|36): objs=154 size=150B /26/11N (2|25|36): objs=2538 size=10.96KiB /26/12S (2|25|36): objs=166 size=151B /26/13S (2|25|36): objs=138 size=329B /26/14S (2|25|36): objs=158 size=200B /26/15N (2|25|36): objs=2152 size=9.08KiB /26/16S (2|25|36): objs=160 size=91B /26/17N (2|25|36): objs=1223 size=4.69KiB /26/18S (2|25|36): objs=143 size=263B /26/20S (2|25|36): objs=135 size=186B /26/21N (2|25|36): objs=7334 size=38.47KiB /26/22S (2|25|36): objs=165 size=354B /26/23N (2|25|36): objs=835 size=3.04KiB /26/24S (2|25|36): objs=165 size=319B /26/25S (2|25|36): objs=148 size=105B /26/26S (2|25|36): objs=143 size=327B /26/27N (2|25|36): objs=2900 size=12.42KiB /26/28S (2|25|36): objs=141 size=169B /26/29N (2|25|36): objs=2375 size=9.77KiB /26/30S (2|25|36): objs=149 size=90B /26/31N (2|25|36): objs=1668 size=6.98KiB /26/32S (2|25|36): objs=151 size=212B /26/34S (2|25|36): objs=160 size=177B /26/35N (2|25|36): objs=1959 size=8.01KiB /27/0N (2|25|36): objs=36917 size=652.03KiB /27/1N (2|25|36): objs=41931 size=1.02MiB /27/2N (2|25|36): objs=30791 size=427.07KiB /27/3S (2|25|36): objs=167 size=174B /27/4N (2|25|36): objs=9390 size=51.67KiB /27/5N (2|25|36): objs=3582 size=15.57KiB /27/6S (2|25|36): objs=148 size=280B /27/7N (2|25|36): objs=870 size=3.75KiB /27/8S (2|25|36): objs=166 size=225B /27/9N (2|25|36): objs=3295 size=13.82KiB /27/10S (2|25|36): objs=179 size=268B /27/11N (2|25|36): objs=2609 size=11.08KiB /27/12S (2|25|36): objs=157 size=322B /27/13N (2|25|36): objs=936 size=3.82KiB /27/14S (2|25|36): objs=145 size=317B /27/15N (2|25|36): objs=574 size=2.18KiB /27/16S (2|25|36): objs=152 size=173B /27/18S (2|25|36): objs=139 size=291B /27/20S (2|25|36): objs=154 size=298B /27/21N (2|25|36): objs=615 size=2.24KiB /27/22S (2|25|36): objs=176 size=192B /27/23N (2|25|36): objs=4614 size=21.35KiB /27/24S (2|25|36): objs=141 size=196B /27/25N (2|25|36): objs=1040 size=3.99KiB /27/26S (2|25|36): objs=152 size=326B /27/27N (2|25|36): objs=2541 size=10.58KiB /27/28S (2|25|36): objs=170 size=156B /27/29N (2|25|36): objs=5549 size=25.25KiB /27/30S (2|25|36): objs=155 size=139B /27/31N (2|25|36): objs=3803 size=16.13KiB /27/32S (2|25|36): objs=162 size=352B /27/33N (2|25|36): objs=1364 size=5.74KiB /27/34S (2|25|36): objs=154 size=99B /27/35N (2|25|36): objs=310 size=1.04KiB /28/0N (2|25|36): objs=37009 size=724.16KiB /28/1N (2|25|36): objs=39227 size=820.94KiB /28/2N (2|25|36): objs=37470 size=710.69KiB /28/3N (2|25|36): objs=2010 size=8.48KiB /28/4S (2|25|36): objs=129 size=149B /28/5N (2|25|36): objs=8190 size=41.07KiB /28/6S (2|25|36): objs=160 size=204B /28/7N (2|25|36): objs=1547 size=6.51KiB /28/8S (2|25|36): objs=149 size=208B /28/9N (2|25|36): objs=3229 size=15.16KiB /28/10S (2|25|36): objs=139 size=129B /28/11N (2|25|36): objs=3165 size=14.09KiB /28/12S (2|25|36): objs=138 size=335B /28/13N (2|25|36): objs=1867 size=7.69KiB /28/14S (2|25|36): objs=149 size=325B /28/15N (2|25|36): objs=747 size=3.06KiB /28/16S (2|25|36): objs=129 size=103B /28/17N (2|25|36): objs=2743 size=11.43KiB /28/18S (2|25|36): objs=150 size=267B /28/19N (2|25|36): objs=272 size=767B /28/20S (2|25|36): objs=169 size=262B /28/21N (2|25|36): objs=303 size=876B /28/22S (2|25|36): objs=159 size=323B /28/23N (2|25|36): objs=2100 size=8.72KiB /28/24S (2|25|36): objs=147 size=156B /28/25N (2|25|36): objs=757 size=3.03KiB /28/26S (2|25|36): objs=168 size=333B /28/27S (2|25|36): objs=166 size=341B /28/28S (2|25|36): objs=153 size=155B /28/29N (2|25|36): objs=5591 size=25.87KiB /28/30S (2|25|36): objs=175 size=284B /28/31N (2|25|36): objs=2637 size=11.18KiB /28/32S (2|25|36): objs=164 size=292B /28/33N (2|25|36): objs=2562 size=11.41KiB /28/34S (2|25|36): objs=168 size=94B /28/35N (2|25|36): objs=2983 size=12.88KiB /29/0N (2|25|36): objs=39622 size=842.25KiB /29/1N (2|25|36): objs=41342 size=938.7KiB /29/2N (2|25|36): objs=40125 size=777.69KiB /29/3N (2|25|36): objs=16326 size=121.98KiB /29/4S (2|25|36): objs=160 size=162B /29/6S (2|25|36): objs=148 size=245B /29/7N (2|25|36): objs=1478 size=6.04KiB /29/8S (2|25|36): objs=127 size=210B /29/9N (2|25|36): objs=2867 size=12.9KiB /29/10S (2|25|36): objs=143 size=198B /29/11N (2|25|36): objs=303 size=891B /29/12S (2|25|36): objs=169 size=341B /29/13N (2|25|36): objs=1663 size=7.14KiB /29/14S (2|25|36): objs=177 size=181B /29/16S (2|25|36): objs=141 size=268B /29/17N (2|25|36): objs=1070 size=4.2KiB /29/18S (2|25|36): objs=155 size=155B /29/19N (2|25|36): objs=1059 size=4.04KiB /29/20S (2|25|36): objs=163 size=125B /29/21N (2|25|36): objs=470 size=1.42KiB /29/22S (2|25|36): objs=163 size=244B /29/23N (2|25|36): objs=1701 size=7.16KiB /29/24S (2|25|36): objs=147 size=246B /29/25N (2|25|36): objs=482 size=1.63KiB /29/26S (2|25|36): objs=144 size=135B /29/27N (2|25|36): objs=4439 size=18.5KiB /29/28S (2|25|36): objs=142 size=122B /29/29N (2|25|36): objs=910 size=3.54KiB /29/30S (2|25|36): objs=166 size=216B /29/31N (2|25|36): objs=471 size=1.53KiB /29/32S (2|25|36): objs=154 size=169B /29/33N (2|25|36): objs=1346 size=5.65KiB /29/34S (2|25|36): objs=131 size=316B /29/35N (2|25|36): objs=740 size=2.78KiB /30/0N (2|25|36): objs=37481 size=698.31KiB /30/1N (2|25|36): objs=37469 size=724.87KiB /30/2N (2|25|36): objs=39018 size=824.46KiB /30/3N (2|25|36): objs=8320 size=45.13KiB /30/4S (2|25|36): objs=153 size=102B /30/5S (2|25|36): objs=166 size=342B /30/6S (2|25|36): objs=160 size=335B /30/7N (2|25|36): objs=627 size=2.34KiB /30/8S (2|25|36): objs=135 size=192B /30/9N (2|25|36): objs=4027 size=17.51KiB /30/10S (2|25|36): objs=164 size=326B /30/11N (2|25|36): objs=268 size=772B /30/12S (2|25|36): objs=148 size=220B /30/13N (2|25|36): objs=397 size=1.31KiB /30/14S (2|25|36): objs=142 size=222B /30/16S (2|25|36): objs=157 size=293B /30/17S (2|25|36): objs=130 size=254B /30/18S (2|25|36): objs=151 size=242B /30/20S (2|25|36): objs=132 size=255B /30/21N (2|25|36): objs=5027 size=21.24KiB /30/22S (2|25|36): objs=155 size=222B /30/23N (2|25|36): objs=1394 size=5.68KiB /30/24S (2|25|36): objs=150 size=134B /30/25N (2|25|36): objs=2852 size=12.69KiB /30/26S (2|25|36): objs=151 size=211B /30/27N (2|25|36): objs=2732 size=11.85KiB /30/28S (2|25|36): objs=152 size=247B /30/29N (2|25|36): objs=752 size=2.99KiB /30/30S (2|25|36): objs=172 size=298B /30/31N (2|25|36): objs=1899 size=7.68KiB /30/32S (2|25|36): objs=156 size=253B /30/33N (2|25|36): objs=1965 size=8.04KiB /30/34S (2|25|36): objs=169 size=216B /30/35N (2|25|36): objs=7008 size=31.88KiB /31/0N (2|25|36): objs=38737 size=673.5KiB /31/1N (2|25|36): objs=33040 size=471.63KiB /31/2N (2|25|36): objs=38264 size=740.07KiB /31/3S (2|25|36): objs=180 size=285B /31/4N (2|25|36): objs=1989 size=8.28KiB /31/5S (2|25|36): objs=150 size=183B /31/6S (2|25|36): objs=150 size=207B /31/7S (2|25|36): objs=154 size=211B /31/8S (2|25|36): objs=180 size=308B /31/10S (2|25|36): objs=144 size=225B /31/11N (2|25|36): objs=4562 size=19.69KiB /31/12S (2|25|36): objs=169 size=331B /31/13N (2|25|36): objs=1722 size=7.19KiB /31/14S (2|25|36): objs=170 size=137B /31/15N (2|25|36): objs=11372 size=59.5KiB /31/16S (2|25|36): objs=166 size=268B /31/17N (2|25|36): objs=2303 size=9.64KiB /31/18S (2|25|36): objs=161 size=196B /31/20S (2|25|36): objs=154 size=294B /31/21N (2|25|36): objs=4581 size=21.46KiB /31/22S (2|25|36): objs=160 size=161B /31/23N (2|25|36): objs=773 size=2.72KiB /31/24S (2|25|36): objs=162 size=240B /31/25N (2|25|36): objs=605 size=2.34KiB /31/26S (2|25|36): objs=174 size=135B /31/27S (2|25|36): objs=145 size=314B /31/28S (2|25|36): objs=143 size=147B /31/29N (2|25|36): objs=606 size=2.07KiB /31/30S (2|25|36): objs=162 size=235B /31/31N (2|25|36): objs=3778 size=18.07KiB /31/32S (2|25|36): objs=147 size=175B /31/33N (2|25|36): objs=1527 size=6.41KiB /31/34S (2|25|36): objs=159 size=226B /31/35N (2|25|36): objs=1378 size=5.75KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 280.91ms Sorting: 88.03ms 1 217 41533 99486 100000 com.milaboratory.util.VersionInfoTest > test3 SKIPPED WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Gradle Test Executor 1 finished executing tests. Finished generating test XML results (0.132 secs) into: /build/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.231 secs) into: /build/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':',5,main]) completed. Took 4 mins 52.605 secs. BUILD SUCCESSFUL in 5m 28s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_amd64.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_amd64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/1315977 and its subdirectories I: Current time: Thu Apr 27 00:18:12 -12 2023 I: pbuilder-time-stamp: 1682597892