I: pbuilder: network access will be disabled during build I: Current time: Fri Feb 9 04:55:35 -12 2024 I: pbuilder-time-stamp: 1707497735 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bookworm-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 02:08:01 2022 -12 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/10537/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build/reproducible-path' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='armhf' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=3 ' DISTRIBUTION='bookworm' HOME='/root' HOST_ARCH='armhf' IFS=' ' INVOCATION_ID='340a6a52256546fe800640f5eceb04be' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='10537' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/pbuilderrc_m5Vi --distribution bookworm --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='114' SUDO_UID='108' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://10.0.0.15:3142/' I: uname -a Linux virt64a 6.1.0-17-arm64 #1 SMP Debian 6.1.69-1 (2023-12-30) aarch64 GNU/Linux I: ls -l /bin total 4964 -rwxr-xr-x 1 root root 838488 Apr 23 2023 bash -rwxr-xr-x 3 root root 67144 Sep 18 2022 bunzip2 -rwxr-xr-x 3 root root 67144 Sep 18 2022 bzcat lrwxrwxrwx 1 root root 6 Sep 18 2022 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Sep 18 2022 bzdiff lrwxrwxrwx 1 root root 6 Sep 18 2022 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4893 Nov 27 2021 bzexe lrwxrwxrwx 1 root root 6 Sep 18 2022 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Sep 18 2022 bzgrep -rwxr-xr-x 3 root root 67144 Sep 18 2022 bzip2 -rwxr-xr-x 1 root root 67112 Sep 18 2022 bzip2recover lrwxrwxrwx 1 root root 6 Sep 18 2022 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Sep 18 2022 bzmore -rwxr-xr-x 1 root root 67632 Sep 20 2022 cat -rwxr-xr-x 1 root root 67676 Sep 20 2022 chgrp -rwxr-xr-x 1 root root 67644 Sep 20 2022 chmod -rwxr-xr-x 1 root root 67684 Sep 20 2022 chown -rwxr-xr-x 1 root root 133532 Sep 20 2022 cp -rwxr-xr-x 1 root root 132868 Jan 5 2023 dash -rwxr-xr-x 1 root root 133220 Sep 20 2022 date -rwxr-xr-x 1 root root 67732 Sep 20 2022 dd -rwxr-xr-x 1 root root 68104 Sep 20 2022 df -rwxr-xr-x 1 root root 133632 Sep 20 2022 dir -rwxr-xr-x 1 root root 59128 Mar 22 2023 dmesg lrwxrwxrwx 1 root root 8 Dec 19 2022 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Dec 19 2022 domainname -> hostname -rwxr-xr-x 1 root root 67560 Sep 20 2022 echo -rwxr-xr-x 1 root root 41 Jan 24 2023 egrep -rwxr-xr-x 1 root root 67548 Sep 20 2022 false -rwxr-xr-x 1 root root 41 Jan 24 2023 fgrep -rwxr-xr-x 1 root root 55748 Mar 22 2023 findmnt -rwsr-xr-x 1 root root 26208 Mar 22 2023 fusermount -rwxr-xr-x 1 root root 128608 Jan 24 2023 grep -rwxr-xr-x 2 root root 2346 Apr 9 2022 gunzip -rwxr-xr-x 1 root root 6447 Apr 9 2022 gzexe -rwxr-xr-x 1 root root 64220 Apr 9 2022 gzip -rwxr-xr-x 1 root root 67032 Dec 19 2022 hostname -rwxr-xr-x 1 root root 67720 Sep 20 2022 ln -rwxr-xr-x 1 root root 35132 Mar 22 2023 login -rwxr-xr-x 1 root root 133632 Sep 20 2022 ls -rwxr-xr-x 1 root root 136808 Mar 22 2023 lsblk -rwxr-xr-x 1 root root 67800 Sep 20 2022 mkdir -rwxr-xr-x 1 root root 67764 Sep 20 2022 mknod -rwxr-xr-x 1 root root 67596 Sep 20 2022 mktemp -rwxr-xr-x 1 root root 38504 Mar 22 2023 more -rwsr-xr-x 1 root root 38496 Mar 22 2023 mount -rwxr-xr-x 1 root root 9824 Mar 22 2023 mountpoint -rwxr-xr-x 1 root root 133532 Sep 20 2022 mv lrwxrwxrwx 1 root root 8 Dec 19 2022 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 2 2023 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 67608 Sep 20 2022 pwd lrwxrwxrwx 1 root root 4 Apr 23 2023 rbash -> bash -rwxr-xr-x 1 root root 67600 Sep 20 2022 readlink -rwxr-xr-x 1 root root 67672 Sep 20 2022 rm -rwxr-xr-x 1 root root 67600 Sep 20 2022 rmdir -rwxr-xr-x 1 root root 14152 Jul 28 2023 run-parts -rwxr-xr-x 1 root root 133372 Jan 5 2023 sed lrwxrwxrwx 1 root root 4 Jan 5 2023 sh -> dash -rwxr-xr-x 1 root root 67584 Sep 20 2022 sleep -rwxr-xr-x 1 root root 67644 Sep 20 2022 stty -rwsr-xr-x 1 root root 50800 Mar 22 2023 su -rwxr-xr-x 1 root root 67584 Sep 20 2022 sync -rwxr-xr-x 1 root root 336764 Apr 6 2023 tar -rwxr-xr-x 1 root root 9800 Jul 28 2023 tempfile -rwxr-xr-x 1 root root 133224 Sep 20 2022 touch -rwxr-xr-x 1 root root 67548 Sep 20 2022 true -rwxr-xr-x 1 root root 9768 Mar 22 2023 ulockmgr_server -rwsr-xr-x 1 root root 22108 Mar 22 2023 umount -rwxr-xr-x 1 root root 67572 Sep 20 2022 uname -rwxr-xr-x 2 root root 2346 Apr 9 2022 uncompress -rwxr-xr-x 1 root root 133632 Sep 20 2022 vdir -rwxr-xr-x 1 root root 42608 Mar 22 2023 wdctl lrwxrwxrwx 1 root root 8 Dec 19 2022 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Apr 9 2022 zcat -rwxr-xr-x 1 root root 1678 Apr 9 2022 zcmp -rwxr-xr-x 1 root root 6460 Apr 9 2022 zdiff -rwxr-xr-x 1 root root 29 Apr 9 2022 zegrep -rwxr-xr-x 1 root root 29 Apr 9 2022 zfgrep -rwxr-xr-x 1 root root 2081 Apr 9 2022 zforce -rwxr-xr-x 1 root root 8103 Apr 9 2022 zgrep -rwxr-xr-x 1 root root 2206 Apr 9 2022 zless -rwxr-xr-x 1 root root 1842 Apr 9 2022 zmore -rwxr-xr-x 1 root root 4577 Apr 9 2022 znew I: user script /srv/workspace/pbuilder/10537/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: armhf Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19288 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm15{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libncurses6{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} libregexp-ipv6-perl{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpm2 libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 336 newly installed, 0 to remove and 0 not upgraded. Need to get 295 MB of archives. After unpacking 712 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bookworm/main armhf libpython3.11-minimal armhf 3.11.2-6 [798 kB] Get: 2 http://deb.debian.org/debian bookworm/main armhf libexpat1 armhf 2.5.0-1 [79.9 kB] Get: 3 http://deb.debian.org/debian bookworm/main armhf python3.11-minimal armhf 3.11.2-6 [1714 kB] Get: 4 http://deb.debian.org/debian bookworm/main armhf python3-minimal armhf 3.11.2-1+b1 [26.3 kB] Get: 5 http://deb.debian.org/debian bookworm/main armhf media-types all 10.0.0 [26.1 kB] Get: 6 http://deb.debian.org/debian bookworm/main armhf readline-common all 8.2-1.3 [69.0 kB] Get: 7 http://deb.debian.org/debian bookworm/main armhf libreadline8 armhf 8.2-1.3 [144 kB] Get: 8 http://deb.debian.org/debian bookworm/main armhf libpython3.11-stdlib armhf 3.11.2-6 [1678 kB] Get: 9 http://deb.debian.org/debian bookworm/main armhf python3.11 armhf 3.11.2-6 [572 kB] Get: 10 http://deb.debian.org/debian bookworm/main armhf libpython3-stdlib armhf 3.11.2-1+b1 [9296 B] Get: 11 http://deb.debian.org/debian bookworm/main armhf python3 armhf 3.11.2-1+b1 [26.3 kB] Get: 12 http://deb.debian.org/debian bookworm/main armhf netbase all 6.4 [12.8 kB] Get: 13 http://deb.debian.org/debian bookworm/main armhf sensible-utils all 0.0.17+nmu1 [19.0 kB] Get: 14 http://deb.debian.org/debian bookworm/main armhf openssl armhf 3.0.11-1~deb12u2 [1386 kB] Get: 15 http://deb.debian.org/debian bookworm/main armhf ca-certificates all 20230311 [153 kB] Get: 16 http://deb.debian.org/debian bookworm/main armhf libmagic-mgc armhf 1:5.44-3 [305 kB] Get: 17 http://deb.debian.org/debian bookworm/main armhf libmagic1 armhf 1:5.44-3 [96.5 kB] Get: 18 http://deb.debian.org/debian bookworm/main armhf file armhf 1:5.44-3 [41.6 kB] Get: 19 http://deb.debian.org/debian bookworm/main armhf gettext-base armhf 0.21-12 [157 kB] Get: 20 http://deb.debian.org/debian bookworm/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB] Get: 21 http://deb.debian.org/debian bookworm/main armhf groff-base armhf 1.22.4-10 [825 kB] Get: 22 http://deb.debian.org/debian bookworm/main armhf bsdextrautils armhf 2.38.1-5+b1 [78.6 kB] Get: 23 http://deb.debian.org/debian bookworm/main armhf libpipeline1 armhf 1.5.7-1 [33.6 kB] Get: 24 http://deb.debian.org/debian bookworm/main armhf man-db armhf 2.11.2-2 [1351 kB] Get: 25 http://deb.debian.org/debian bookworm/main armhf hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 26 http://deb.debian.org/debian bookworm/main armhf libgdk-pixbuf2.0-common all 2.42.10+dfsg-1 [306 kB] Get: 27 http://deb.debian.org/debian bookworm/main armhf libglib2.0-0 armhf 2.74.6-2 [1227 kB] Get: 28 http://deb.debian.org/debian bookworm/main armhf libicu72 armhf 72.1-3 [9048 kB] Get: 29 http://deb.debian.org/debian bookworm/main armhf libxml2 armhf 2.9.14+dfsg-1.3~deb12u1 [591 kB] Get: 30 http://deb.debian.org/debian bookworm/main armhf shared-mime-info armhf 2.2-1 [726 kB] Get: 31 http://deb.debian.org/debian bookworm/main armhf libjpeg62-turbo armhf 1:2.1.5-2 [143 kB] Get: 32 http://deb.debian.org/debian bookworm/main armhf libpng16-16 armhf 1.6.39-2 [260 kB] Get: 33 http://deb.debian.org/debian bookworm/main armhf libdeflate0 armhf 1.14-1 [52.2 kB] Get: 34 http://deb.debian.org/debian bookworm/main armhf libjbig0 armhf 2.1-6.1 [27.1 kB] Get: 35 http://deb.debian.org/debian bookworm/main armhf liblerc4 armhf 4.0.0+ds-2 [137 kB] Get: 36 http://deb.debian.org/debian bookworm/main armhf libwebp7 armhf 1.2.4-0.2+deb12u1 [242 kB] Get: 37 http://deb.debian.org/debian bookworm/main armhf libtiff6 armhf 4.5.0-6+deb12u1 [295 kB] Get: 38 http://deb.debian.org/debian bookworm/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.10+dfsg-1+b1 [124 kB] Get: 39 http://deb.debian.org/debian bookworm/main armhf gtk-update-icon-cache armhf 3.24.38-2~deb12u1 [43.1 kB] Get: 40 http://deb.debian.org/debian bookworm/main armhf adwaita-icon-theme all 43-1 [5124 kB] Get: 41 http://deb.debian.org/debian bookworm/main armhf ca-certificates-java all 20230710~deb12u1 [11.9 kB] Get: 42 http://deb.debian.org/debian bookworm/main armhf java-common all 0.74 [6388 B] Get: 43 http://deb.debian.org/debian bookworm/main armhf libavahi-common-data armhf 0.8-10 [107 kB] Get: 44 http://deb.debian.org/debian bookworm/main armhf libavahi-common3 armhf 0.8-10 [38.3 kB] Get: 45 http://deb.debian.org/debian bookworm/main armhf libdbus-1-3 armhf 1.14.10-1~deb12u1 [178 kB] Get: 46 http://deb.debian.org/debian bookworm/main armhf libavahi-client3 armhf 0.8-10 [41.6 kB] Get: 47 http://deb.debian.org/debian bookworm/main armhf libcups2 armhf 2.4.2-3+deb12u5 [210 kB] Get: 48 http://deb.debian.org/debian bookworm/main armhf liblcms2-2 armhf 2.14-2 [125 kB] Get: 49 http://deb.debian.org/debian bookworm/main armhf libbrotli1 armhf 1.0.9-2+b6 [271 kB] Get: 50 http://deb.debian.org/debian bookworm/main armhf libfreetype6 armhf 2.12.1+dfsg-5 [332 kB] Get: 51 http://deb.debian.org/debian bookworm/main armhf fonts-dejavu-core all 2.37-6 [1068 kB] Get: 52 http://deb.debian.org/debian bookworm/main armhf fontconfig-config armhf 2.14.1-4 [315 kB] Get: 53 http://deb.debian.org/debian bookworm/main armhf libfontconfig1 armhf 2.14.1-4 [368 kB] Get: 54 http://deb.debian.org/debian bookworm/main armhf libnspr4 armhf 2:4.35-1 [91.5 kB] Get: 55 http://deb.debian.org/debian bookworm/main armhf libnss3 armhf 2:3.87.1-1 [1122 kB] Get: 56 http://deb.debian.org/debian bookworm/main armhf libasound2-data all 1.2.8-1 [20.5 kB] Get: 57 http://deb.debian.org/debian bookworm/main armhf libasound2 armhf 1.2.8-1+b1 [309 kB] Get: 58 http://deb.debian.org/debian bookworm/main armhf libgraphite2-3 armhf 1.3.14-1 [70.5 kB] Get: 59 http://deb.debian.org/debian bookworm/main armhf libharfbuzz0b armhf 6.0.0+dfsg-3 [1893 kB] Get: 60 http://deb.debian.org/debian bookworm/main armhf libpcsclite1 armhf 1.9.9-2 [46.8 kB] Get: 61 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jre-headless armhf 17.0.9+9-1~deb12u1 [38.1 MB] Get: 62 http://deb.debian.org/debian bookworm/main armhf default-jre-headless armhf 2:1.17-74 [2932 B] Get: 63 http://deb.debian.org/debian bookworm/main armhf ant all 1.10.13-1 [2161 kB] Get: 64 http://deb.debian.org/debian bookworm/main armhf ant-optional all 1.10.13-1 [449 kB] Get: 65 http://deb.debian.org/debian bookworm/main armhf libantlr-java all 2.7.7+dfsg-12 [458 kB] Get: 66 http://deb.debian.org/debian bookworm/main armhf antlr all 2.7.7+dfsg-12 [14.3 kB] Get: 67 http://deb.debian.org/debian bookworm/main armhf at-spi2-common all 2.46.0-5 [162 kB] Get: 68 http://deb.debian.org/debian bookworm/main armhf m4 armhf 1.4.19-3 [265 kB] Get: 69 http://deb.debian.org/debian bookworm/main armhf autoconf all 2.71-3 [332 kB] Get: 70 http://deb.debian.org/debian bookworm/main armhf autotools-dev all 20220109.1 [51.6 kB] Get: 71 http://deb.debian.org/debian bookworm/main armhf automake all 1:1.16.5-1.3 [823 kB] Get: 72 http://deb.debian.org/debian bookworm/main armhf autopoint all 0.21-12 [495 kB] Get: 73 http://deb.debian.org/debian bookworm/main armhf unzip armhf 6.0-28 [152 kB] Get: 74 http://deb.debian.org/debian bookworm/main armhf java-wrappers all 0.4 [8916 B] Get: 75 http://deb.debian.org/debian bookworm/main armhf libhamcrest-java all 2.2-1 [121 kB] Get: 76 http://deb.debian.org/debian bookworm/main armhf junit4 all 4.13.2-3 [348 kB] Get: 77 http://deb.debian.org/debian bookworm/main armhf libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 78 http://deb.debian.org/debian bookworm/main armhf libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 79 http://deb.debian.org/debian bookworm/main armhf libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 80 http://deb.debian.org/debian bookworm/main armhf libosgi-core-java all 8.0.0-2 [182 kB] Get: 81 http://deb.debian.org/debian bookworm/main armhf libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 82 http://deb.debian.org/debian bookworm/main armhf libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 83 http://deb.debian.org/debian bookworm/main armhf libjansi-native-java all 1.8-1 [26.0 kB] Get: 84 http://deb.debian.org/debian bookworm/main armhf libjansi1-java all 1.18-3 [66.5 kB] Get: 85 http://deb.debian.org/debian bookworm/main armhf libjline2-java all 2.14.6-5 [151 kB] Get: 86 http://deb.debian.org/debian bookworm/main armhf libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 87 http://deb.debian.org/debian bookworm/main armhf libslf4j-java all 1.7.32-1 [144 kB] Get: 88 http://deb.debian.org/debian bookworm/main armhf libxz-java all 1.9-1 [143 kB] Get: 89 http://deb.debian.org/debian bookworm/main armhf libyaml-snake-java all 1.33-2 [321 kB] Get: 90 http://deb.debian.org/debian bookworm/main armhf bnd all 5.0.1-3 [9915 kB] Get: 91 http://deb.debian.org/debian bookworm/main armhf dctrl-tools armhf 2.24-3 [96.0 kB] Get: 92 http://deb.debian.org/debian bookworm/main armhf libdebhelper-perl all 13.11.4 [81.2 kB] Get: 93 http://deb.debian.org/debian bookworm/main armhf libtool all 2.4.7-5 [517 kB] Get: 94 http://deb.debian.org/debian bookworm/main armhf dh-autoreconf all 20 [17.1 kB] Get: 95 http://deb.debian.org/debian bookworm/main armhf libarchive-zip-perl all 1.68-1 [104 kB] Get: 96 http://deb.debian.org/debian bookworm/main armhf libsub-override-perl all 0.09-4 [9304 B] Get: 97 http://deb.debian.org/debian bookworm/main armhf libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 98 http://deb.debian.org/debian bookworm/main armhf dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 99 http://deb.debian.org/debian bookworm/main armhf libelf1 armhf 0.188-2.1 [170 kB] Get: 100 http://deb.debian.org/debian bookworm/main armhf dwz armhf 0.15-1 [101 kB] Get: 101 http://deb.debian.org/debian bookworm/main armhf gettext armhf 0.21-12 [1229 kB] Get: 102 http://deb.debian.org/debian bookworm/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 103 http://deb.debian.org/debian bookworm/main armhf po-debconf all 1.0.21+nmu1 [248 kB] Get: 104 http://deb.debian.org/debian bookworm/main armhf debhelper all 13.11.4 [942 kB] Get: 105 http://deb.debian.org/debian bookworm/main armhf libgtk2.0-common all 2.24.33-2 [2700 kB] Get: 106 http://deb.debian.org/debian bookworm/main armhf libatk1.0-0 armhf 2.46.0-5 [42.4 kB] Get: 107 http://deb.debian.org/debian bookworm/main armhf libpixman-1-0 armhf 0.42.2-1 [465 kB] Get: 108 http://deb.debian.org/debian bookworm/main armhf libxau6 armhf 1:1.0.9-1 [19.0 kB] Get: 109 http://deb.debian.org/debian bookworm/main armhf libbsd0 armhf 0.11.7-2 [113 kB] Get: 110 http://deb.debian.org/debian bookworm/main armhf libxdmcp6 armhf 1:1.1.2-3 [24.9 kB] Get: 111 http://deb.debian.org/debian bookworm/main armhf libxcb1 armhf 1.15-1 [140 kB] Get: 112 http://deb.debian.org/debian bookworm/main armhf libx11-data all 2:1.8.4-2+deb12u2 [292 kB] Get: 113 http://deb.debian.org/debian bookworm/main armhf libx11-6 armhf 2:1.8.4-2+deb12u2 [695 kB] Get: 114 http://deb.debian.org/debian bookworm/main armhf libxcb-render0 armhf 1.15-1 [114 kB] Get: 115 http://deb.debian.org/debian bookworm/main armhf libxcb-shm0 armhf 1.15-1 [106 kB] Get: 116 http://deb.debian.org/debian bookworm/main armhf libxext6 armhf 2:1.3.4-1+b1 [47.8 kB] Get: 117 http://deb.debian.org/debian bookworm/main armhf libxrender1 armhf 1:0.9.10-1.1 [30.1 kB] Get: 118 http://deb.debian.org/debian bookworm/main armhf libcairo2 armhf 1.16.0-7 [493 kB] Get: 119 http://deb.debian.org/debian bookworm/main armhf fontconfig armhf 2.14.1-4 [448 kB] Get: 120 http://deb.debian.org/debian bookworm/main armhf libfribidi0 armhf 1.0.8-2.1 [63.1 kB] Get: 121 http://deb.debian.org/debian bookworm/main armhf libthai-data all 0.1.29-1 [176 kB] Get: 122 http://deb.debian.org/debian bookworm/main armhf libdatrie1 armhf 0.2.13-2+b1 [39.9 kB] Get: 123 http://deb.debian.org/debian bookworm/main armhf libthai0 armhf 0.1.29-1 [54.3 kB] Get: 124 http://deb.debian.org/debian bookworm/main armhf libpango-1.0-0 armhf 1.50.12+ds-1 [188 kB] Get: 125 http://deb.debian.org/debian bookworm/main armhf libpangoft2-1.0-0 armhf 1.50.12+ds-1 [40.9 kB] Get: 126 http://deb.debian.org/debian bookworm/main armhf libpangocairo-1.0-0 armhf 1.50.12+ds-1 [30.3 kB] Get: 127 http://deb.debian.org/debian bookworm/main armhf libxcomposite1 armhf 1:0.4.5-1 [16.1 kB] Get: 128 http://deb.debian.org/debian bookworm/main armhf libxfixes3 armhf 1:6.0.0-2 [21.1 kB] Get: 129 http://deb.debian.org/debian bookworm/main armhf libxcursor1 armhf 1:1.2.1-1 [37.9 kB] Get: 130 http://deb.debian.org/debian bookworm/main armhf libxdamage1 armhf 1:1.1.6-1 [14.6 kB] Get: 131 http://deb.debian.org/debian bookworm/main armhf libxi6 armhf 2:1.8-1+b1 [78.6 kB] Get: 132 http://deb.debian.org/debian bookworm/main armhf libxinerama1 armhf 2:1.1.4-3 [17.4 kB] Get: 133 http://deb.debian.org/debian bookworm/main armhf libxrandr2 armhf 2:1.5.2-2+b1 [36.0 kB] Get: 134 http://deb.debian.org/debian bookworm/main armhf libgtk2.0-0 armhf 2.24.33-2 [1588 kB] Get: 135 http://deb.debian.org/debian bookworm/main armhf libglvnd0 armhf 1.6.0-1 [51.9 kB] Get: 136 http://deb.debian.org/debian bookworm/main armhf libdrm-common all 2.4.114-1 [7112 B] Get: 137 http://deb.debian.org/debian bookworm/main armhf libdrm2 armhf 2.4.114-1+b1 [33.0 kB] Get: 138 http://deb.debian.org/debian bookworm/main armhf libglapi-mesa armhf 22.3.6-1+deb12u1 [41.0 kB] Get: 139 http://deb.debian.org/debian bookworm/main armhf libx11-xcb1 armhf 2:1.8.4-2+deb12u2 [192 kB] Get: 140 http://deb.debian.org/debian bookworm/main armhf libxcb-dri2-0 armhf 1.15-1 [107 kB] Get: 141 http://deb.debian.org/debian bookworm/main armhf libxcb-dri3-0 armhf 1.15-1 [107 kB] Get: 142 http://deb.debian.org/debian bookworm/main armhf libxcb-glx0 armhf 1.15-1 [120 kB] Get: 143 http://deb.debian.org/debian bookworm/main armhf libxcb-present0 armhf 1.15-1 [105 kB] Get: 144 http://deb.debian.org/debian bookworm/main armhf libxcb-randr0 armhf 1.15-1 [116 kB] Get: 145 http://deb.debian.org/debian bookworm/main armhf libxcb-sync1 armhf 1.15-1 [108 kB] Get: 146 http://deb.debian.org/debian bookworm/main armhf libxcb-xfixes0 armhf 1.15-1 [110 kB] Get: 147 http://deb.debian.org/debian bookworm/main armhf libxshmfence1 armhf 1.3-1 [8592 B] Get: 148 http://deb.debian.org/debian bookworm/main armhf libxxf86vm1 armhf 1:1.1.4-1+b2 [20.2 kB] Get: 149 http://deb.debian.org/debian bookworm/main armhf libdrm-amdgpu1 armhf 2.4.114-1+b1 [19.3 kB] Get: 150 http://deb.debian.org/debian bookworm/main armhf libdrm-nouveau2 armhf 2.4.114-1+b1 [16.7 kB] Get: 151 http://deb.debian.org/debian bookworm/main armhf libdrm-radeon1 armhf 2.4.114-1+b1 [19.3 kB] Get: 152 http://deb.debian.org/debian bookworm/main armhf libedit2 armhf 3.1-20221030-2 [77.0 kB] Get: 153 http://deb.debian.org/debian bookworm/main armhf libz3-4 armhf 4.8.12-3.1 [6061 kB] Get: 154 http://deb.debian.org/debian bookworm/main armhf libllvm15 armhf 1:15.0.6-4+b1 [20.5 MB] Get: 155 http://deb.debian.org/debian bookworm/main armhf libsensors-config all 1:3.6.0-7.1 [14.3 kB] Get: 156 http://deb.debian.org/debian bookworm/main armhf libsensors5 armhf 1:3.6.0-7.1 [31.6 kB] Get: 157 http://deb.debian.org/debian bookworm/main armhf libgl1-mesa-dri armhf 22.3.6-1+deb12u1 [5792 kB] Get: 158 http://deb.debian.org/debian bookworm/main armhf libglx-mesa0 armhf 22.3.6-1+deb12u1 [126 kB] Get: 159 http://deb.debian.org/debian bookworm/main armhf libglx0 armhf 1.6.0-1 [32.0 kB] Get: 160 http://deb.debian.org/debian bookworm/main armhf libgl1 armhf 1.6.0-1 [90.6 kB] Get: 161 http://deb.debian.org/debian bookworm/main armhf libgif7 armhf 5.2.1-2.5 [44.4 kB] Get: 162 http://deb.debian.org/debian bookworm/main armhf x11-common all 1:7.7+23 [252 kB] Get: 163 http://deb.debian.org/debian bookworm/main armhf libxtst6 armhf 2:1.2.3-1.1 [26.2 kB] Get: 164 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jre armhf 17.0.9+9-1~deb12u1 [162 kB] Get: 165 http://deb.debian.org/debian bookworm/main armhf default-jre armhf 2:1.17-74 [1056 B] Get: 166 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jdk-headless armhf 17.0.9+9-1~deb12u1 [67.4 MB] Get: 167 http://deb.debian.org/debian bookworm/main armhf default-jdk-headless armhf 2:1.17-74 [1108 B] Get: 168 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jdk armhf 17.0.9+9-1~deb12u1 [2348 kB] Get: 169 http://deb.debian.org/debian bookworm/main armhf default-jdk armhf 2:1.17-74 [1068 B] Get: 170 http://deb.debian.org/debian bookworm/main armhf libassuan0 armhf 2.5.5-5 [42.0 kB] Get: 171 http://deb.debian.org/debian bookworm/main armhf gpgconf armhf 2.2.40-1.1 [547 kB] Get: 172 http://deb.debian.org/debian bookworm/main armhf libksba8 armhf 1.6.3-2 [109 kB] Get: 173 http://deb.debian.org/debian bookworm/main armhf libsasl2-modules-db armhf 2.1.28+dfsg-10 [19.0 kB] Get: 174 http://deb.debian.org/debian bookworm/main armhf libsasl2-2 armhf 2.1.28+dfsg-10 [52.3 kB] Get: 175 http://deb.debian.org/debian bookworm/main armhf libldap-2.5-0 armhf 2.5.13+dfsg-5 [158 kB] Get: 176 http://deb.debian.org/debian bookworm/main armhf libnpth0 armhf 1.6-3 [17.8 kB] Get: 177 http://deb.debian.org/debian bookworm/main armhf dirmngr armhf 2.2.40-1.1 [748 kB] Get: 178 http://deb.debian.org/debian bookworm/main armhf gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 179 http://deb.debian.org/debian bookworm/main armhf gnupg-utils armhf 2.2.40-1.1 [850 kB] Get: 180 http://deb.debian.org/debian bookworm/main armhf gpg armhf 2.2.40-1.1 [884 kB] Get: 181 http://deb.debian.org/debian bookworm/main armhf pinentry-curses armhf 1.2.1-1 [73.4 kB] Get: 182 http://deb.debian.org/debian bookworm/main armhf gpg-agent armhf 2.2.40-1.1 [652 kB] Get: 183 http://deb.debian.org/debian bookworm/main armhf gpg-wks-client armhf 2.2.40-1.1 [524 kB] Get: 184 http://deb.debian.org/debian bookworm/main armhf gpg-wks-server armhf 2.2.40-1.1 [517 kB] Get: 185 http://deb.debian.org/debian bookworm/main armhf gpgsm armhf 2.2.40-1.1 [637 kB] Get: 186 http://deb.debian.org/debian bookworm/main armhf gnupg all 2.2.40-1.1 [846 kB] Get: 187 http://deb.debian.org/debian bookworm/main armhf libfile-dirlist-perl all 0.05-3 [7600 B] Get: 188 http://deb.debian.org/debian bookworm/main armhf libfile-which-perl all 1.27-2 [15.1 kB] Get: 189 http://deb.debian.org/debian bookworm/main armhf libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 190 http://deb.debian.org/debian bookworm/main armhf libfile-touch-perl all 0.12-2 [8816 B] Get: 191 http://deb.debian.org/debian bookworm/main armhf libio-pty-perl armhf 1:1.17-1 [34.5 kB] Get: 192 http://deb.debian.org/debian bookworm/main armhf libipc-run-perl all 20220807.0-1 [104 kB] Get: 193 http://deb.debian.org/debian bookworm/main armhf libclass-method-modifiers-perl all 2.14-1 [18.1 kB] Get: 194 http://deb.debian.org/debian bookworm/main armhf libclass-xsaccessor-perl armhf 1.19-4+b1 [35.5 kB] Get: 195 http://deb.debian.org/debian bookworm/main armhf libb-hooks-op-check-perl armhf 0.22-2+b1 [10.3 kB] Get: 196 http://deb.debian.org/debian bookworm/main armhf libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 197 http://deb.debian.org/debian bookworm/main armhf libdevel-callchecker-perl armhf 0.008-2 [15.7 kB] Get: 198 http://deb.debian.org/debian bookworm/main armhf libparams-classify-perl armhf 0.015-2+b1 [21.9 kB] Get: 199 http://deb.debian.org/debian bookworm/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 200 http://deb.debian.org/debian bookworm/main armhf libimport-into-perl all 1.002005-2 [11.3 kB] Get: 201 http://deb.debian.org/debian bookworm/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 202 http://deb.debian.org/debian bookworm/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 203 http://deb.debian.org/debian bookworm/main armhf libmoo-perl all 2.005005-1 [58.0 kB] Get: 204 http://deb.debian.org/debian bookworm/main armhf libencode-locale-perl all 1.05-3 [12.9 kB] Get: 205 http://deb.debian.org/debian bookworm/main armhf libtimedate-perl all 2.3300-2 [39.3 kB] Get: 206 http://deb.debian.org/debian bookworm/main armhf libhttp-date-perl all 6.05-2 [10.5 kB] Get: 207 http://deb.debian.org/debian bookworm/main armhf libfile-listing-perl all 6.15-1 [12.6 kB] Get: 208 http://deb.debian.org/debian bookworm/main armhf libhtml-tagset-perl all 3.20-6 [11.7 kB] Get: 209 http://deb.debian.org/debian bookworm/main armhf libregexp-ipv6-perl all 0.03-3 [5212 B] Get: 210 http://deb.debian.org/debian bookworm/main armhf liburi-perl all 5.17-1 [90.4 kB] Get: 211 http://deb.debian.org/debian bookworm/main armhf libhtml-parser-perl armhf 3.81-1 [97.4 kB] Get: 212 http://deb.debian.org/debian bookworm/main armhf libhtml-tree-perl all 5.07-3 [211 kB] Get: 213 http://deb.debian.org/debian bookworm/main armhf libclone-perl armhf 0.46-1 [13.1 kB] Get: 214 http://deb.debian.org/debian bookworm/main armhf libio-html-perl all 1.004-3 [16.2 kB] Get: 215 http://deb.debian.org/debian bookworm/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 216 http://deb.debian.org/debian bookworm/main armhf libhttp-message-perl all 6.44-1 [81.7 kB] Get: 217 http://deb.debian.org/debian bookworm/main armhf libhttp-cookies-perl all 6.10-1 [19.6 kB] Get: 218 http://deb.debian.org/debian bookworm/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 219 http://deb.debian.org/debian bookworm/main armhf perl-openssl-defaults armhf 7+b1 [7916 B] Get: 220 http://deb.debian.org/debian bookworm/main armhf libnet-ssleay-perl armhf 1.92-2+b1 [298 kB] Get: 221 http://deb.debian.org/debian bookworm/main armhf libio-socket-ssl-perl all 2.081-2 [219 kB] Get: 222 http://deb.debian.org/debian bookworm/main armhf libnet-http-perl all 6.22-1 [25.3 kB] Get: 223 http://deb.debian.org/debian bookworm/main armhf liblwp-protocol-https-perl all 6.10-1 [12.2 kB] Get: 224 http://deb.debian.org/debian bookworm/main armhf libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 225 http://deb.debian.org/debian bookworm/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 226 http://deb.debian.org/debian bookworm/main armhf libwww-perl all 6.68-1 [186 kB] Get: 227 http://deb.debian.org/debian bookworm/main armhf patchutils armhf 0.4.2-1 [72.5 kB] Get: 228 http://deb.debian.org/debian bookworm/main armhf wdiff armhf 1.2.2-5 [118 kB] Get: 229 http://deb.debian.org/debian bookworm/main armhf devscripts armhf 2.23.4+deb12u1 [1072 kB] Get: 230 http://deb.debian.org/debian bookworm/main armhf ivy all 2.5.1-2 [1288 kB] Get: 231 http://deb.debian.org/debian bookworm/main armhf libasm-java all 9.4-1 [389 kB] Get: 232 http://deb.debian.org/debian bookworm/main armhf libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 233 http://deb.debian.org/debian bookworm/main armhf libcommons-cli-java all 1.5.0-1 [60.0 kB] Get: 234 http://deb.debian.org/debian bookworm/main armhf libapache-pom-java all 29-2 [5276 B] Get: 235 http://deb.debian.org/debian bookworm/main armhf libcommons-parent-java all 56-1 [10.8 kB] Get: 236 http://deb.debian.org/debian bookworm/main armhf libcommons-logging-java all 1.2-3 [62.4 kB] Get: 237 http://deb.debian.org/debian bookworm/main armhf libjansi-java all 2.4.0-2 [105 kB] Get: 238 http://deb.debian.org/debian bookworm/main armhf libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 239 http://deb.debian.org/debian bookworm/main armhf libqdox-java all 1.12.1-3 [172 kB] Get: 240 http://deb.debian.org/debian bookworm/main armhf libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 241 http://deb.debian.org/debian bookworm/main armhf libxpp3-java all 1.1.4c-3 [292 kB] Get: 242 http://deb.debian.org/debian bookworm/main armhf libxstream-java all 1.4.20-1 [565 kB] Get: 243 http://deb.debian.org/debian bookworm/main armhf groovy all 2.4.21-8 [12.9 MB] Get: 244 http://deb.debian.org/debian bookworm/main armhf libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 245 http://deb.debian.org/debian bookworm/main armhf libcommons-collections3-java all 3.2.2-2 [526 kB] Get: 246 http://deb.debian.org/debian bookworm/main armhf libcommons-compress-java all 1.22-1 [615 kB] Get: 247 http://deb.debian.org/debian bookworm/main armhf libcommons-io-java all 2.11.0-2 [319 kB] Get: 248 http://deb.debian.org/debian bookworm/main armhf libcommons-lang-java all 2.6-10 [273 kB] Get: 249 http://deb.debian.org/debian bookworm/main armhf liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 250 http://deb.debian.org/debian bookworm/main armhf libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 251 http://deb.debian.org/debian bookworm/main armhf libguava-java all 31.1-1 [2613 kB] Get: 252 http://deb.debian.org/debian bookworm/main armhf libcommons-codec-java all 1.15-1 [292 kB] Get: 253 http://deb.debian.org/debian bookworm/main armhf libhttpcore-java all 4.4.16-1 [636 kB] Get: 254 http://deb.debian.org/debian bookworm/main armhf libhttpclient-java all 4.5.14-1 [1247 kB] Get: 255 http://deb.debian.org/debian bookworm/main armhf libjarjar-java all 1.4+svn142-12 [205 kB] Get: 256 http://deb.debian.org/debian bookworm/main armhf libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 257 http://deb.debian.org/debian bookworm/main armhf libjna-jni armhf 5.13.0-2 [59.3 kB] Get: 258 http://deb.debian.org/debian bookworm/main armhf libjna-java all 5.13.0-2 [236 kB] Get: 259 http://deb.debian.org/debian bookworm/main armhf libjzlib-java all 1.1.3-2 [80.0 kB] Get: 260 http://deb.debian.org/debian bookworm/main armhf libjsch-java all 0.1.55-1 [298 kB] Get: 261 http://deb.debian.org/debian bookworm/main armhf libminlog-java all 1.3.0-1.1 [7928 B] Get: 262 http://deb.debian.org/debian bookworm/main armhf libobjenesis-java all 3.3-3 [41.3 kB] Get: 263 http://deb.debian.org/debian bookworm/main armhf libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 264 http://deb.debian.org/debian bookworm/main armhf libkryo-java all 2.20-7 [158 kB] Get: 265 http://deb.debian.org/debian bookworm/main armhf liblogback-java all 1:1.2.11-3 [700 kB] Get: 266 http://deb.debian.org/debian bookworm/main armhf libncurses6 armhf 6.4-4 [81.1 kB] Get: 267 http://deb.debian.org/debian bookworm/main armhf libnative-platform-jni armhf 0.14-5 [11.6 kB] Get: 268 http://deb.debian.org/debian bookworm/main armhf libnative-platform-java all 0.14-5 [71.0 kB] Get: 269 http://deb.debian.org/debian bookworm/main armhf libxml-commons-external-java all 1.4.01-5 [240 kB] Get: 270 http://deb.debian.org/debian bookworm/main armhf libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 271 http://deb.debian.org/debian bookworm/main armhf libxerces2-java all 2.12.2-1 [1440 kB] Get: 272 http://deb.debian.org/debian bookworm/main armhf libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 273 http://deb.debian.org/debian bookworm/main armhf libxbean-reflect-java all 4.5-8 [133 kB] Get: 274 http://deb.debian.org/debian bookworm/main armhf libgradle-core-java all 4.4.1-18 [4286 kB] Get: 275 http://deb.debian.org/debian bookworm/main armhf libbcprov-java all 1.72-2 [8225 kB] Get: 276 http://deb.debian.org/debian bookworm/main armhf libbcpg-java all 1.72-2 [383 kB] Get: 277 http://deb.debian.org/debian bookworm/main armhf libbsh-java all 2.0b4-20 [291 kB] Get: 278 http://deb.debian.org/debian bookworm/main armhf libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 279 http://deb.debian.org/debian bookworm/main armhf libjaxen-java all 1.1.6-4 [214 kB] Get: 280 http://deb.debian.org/debian bookworm/main armhf libdom4j-java all 2.1.3-2 [310 kB] Get: 281 http://deb.debian.org/debian bookworm/main armhf libbcel-java all 6.5.0-2 [634 kB] Get: 282 http://deb.debian.org/debian bookworm/main armhf libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 283 http://deb.debian.org/debian bookworm/main armhf libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 284 http://deb.debian.org/debian bookworm/main armhf libgoogle-gson-java all 2.10-1 [261 kB] Get: 285 http://deb.debian.org/debian bookworm/main armhf libaopalliance-java all 20070526-7 [8572 B] Get: 286 http://deb.debian.org/debian bookworm/main armhf libguice-java all 4.2.3-2 [1435 kB] Get: 287 http://deb.debian.org/debian bookworm/main armhf libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 288 http://deb.debian.org/debian bookworm/main armhf libjcifs-java all 1.3.19-2 [394 kB] Get: 289 http://deb.debian.org/debian bookworm/main armhf libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 290 http://deb.debian.org/debian bookworm/main armhf libjavaewah-java all 1.1.7-1 [156 kB] Get: 291 http://deb.debian.org/debian bookworm/main armhf libel-api-java all 3.0.0-3 [64.9 kB] Get: 292 http://deb.debian.org/debian bookworm/main armhf libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 293 http://deb.debian.org/debian bookworm/main armhf libjetty9-java all 9.4.50-4+deb12u2 [2981 kB] Get: 294 http://deb.debian.org/debian bookworm/main armhf libjgit-java all 4.11.9-2 [2534 kB] Get: 295 http://deb.debian.org/debian bookworm/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 296 http://deb.debian.org/debian bookworm/main armhf libcommons-lang3-java all 3.12.0-2 [561 kB] Get: 297 http://deb.debian.org/debian bookworm/main armhf libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 298 http://deb.debian.org/debian bookworm/main armhf libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 299 http://deb.debian.org/debian bookworm/main armhf libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 300 http://deb.debian.org/debian bookworm/main armhf libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 301 http://deb.debian.org/debian bookworm/main armhf libmaven-parent-java all 35-1 [6140 B] Get: 302 http://deb.debian.org/debian bookworm/main armhf libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 303 http://deb.debian.org/debian bookworm/main armhf libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 304 http://deb.debian.org/debian bookworm/main armhf libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 305 http://deb.debian.org/debian bookworm/main armhf libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 306 http://deb.debian.org/debian bookworm/main armhf libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 307 http://deb.debian.org/debian bookworm/main armhf libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 308 http://deb.debian.org/debian bookworm/main armhf libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 309 http://deb.debian.org/debian bookworm/main armhf libcdi-api-java all 1.2-3 [54.3 kB] Get: 310 http://deb.debian.org/debian bookworm/main armhf libsisu-inject-java all 0.3.4-2 [347 kB] Get: 311 http://deb.debian.org/debian bookworm/main armhf libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 312 http://deb.debian.org/debian bookworm/main armhf libmaven3-core-java all 3.8.7-1 [1572 kB] Get: 313 http://deb.debian.org/debian bookworm/main armhf libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 314 http://deb.debian.org/debian bookworm/main armhf libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 315 http://deb.debian.org/debian bookworm/main armhf librhino-java all 1.7.14-2.1 [1357 kB] Get: 316 http://deb.debian.org/debian bookworm/main armhf libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 317 http://deb.debian.org/debian bookworm/main armhf libwagon-file-java all 3.5.3-1 [8388 B] Get: 318 http://deb.debian.org/debian bookworm/main armhf libjsoup-java all 1.15.3-1 [431 kB] Get: 319 http://deb.debian.org/debian bookworm/main armhf libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 320 http://deb.debian.org/debian bookworm/main armhf libjcommander-java all 1.71-4 [73.0 kB] Get: 321 http://deb.debian.org/debian bookworm/main armhf testng all 6.9.12-4 [795 kB] Get: 322 http://deb.debian.org/debian bookworm/main armhf libgradle-plugins-java all 4.4.1-18 [5212 kB] Get: 323 http://deb.debian.org/debian bookworm/main armhf gradle all 4.4.1-18 [398 kB] Get: 324 http://deb.debian.org/debian bookworm/main armhf maven-repo-helper all 1.11 [142 kB] Get: 325 http://deb.debian.org/debian bookworm/main armhf gradle-debian-helper all 2.4 [24.5 kB] Get: 326 http://deb.debian.org/debian bookworm/main armhf javahelper all 0.78 [97.2 kB] Get: 327 http://deb.debian.org/debian bookworm/main armhf libbyte-buddy-java all 1.12.21-1 [4393 kB] Get: 328 http://deb.debian.org/debian bookworm/main armhf libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 329 http://deb.debian.org/debian bookworm/main armhf libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 330 http://deb.debian.org/debian bookworm/main armhf libjackson2-core-java all 2.14.1-1 [447 kB] Get: 331 http://deb.debian.org/debian bookworm/main armhf libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 332 http://deb.debian.org/debian bookworm/main armhf liblz4-jni armhf 1.8.0-3 [9248 B] Get: 333 http://deb.debian.org/debian bookworm/main armhf liblz4-java all 1.8.0-3 [114 kB] Get: 334 http://deb.debian.org/debian bookworm/main armhf libmockito-java all 2.23.0-2 [479 kB] Get: 335 http://deb.debian.org/debian bookworm/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 336 http://deb.debian.org/debian bookworm/main armhf libtrove3-java all 3.0.3-5 [2146 kB] Fetched 295 MB in 10s (29.3 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:armhf. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19288 files and directories currently installed.) Preparing to unpack .../libpython3.11-minimal_3.11.2-6_armhf.deb ... Unpacking libpython3.11-minimal:armhf (3.11.2-6) ... Selecting previously unselected package libexpat1:armhf. Preparing to unpack .../libexpat1_2.5.0-1_armhf.deb ... Unpacking libexpat1:armhf (2.5.0-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.2-6_armhf.deb ... Unpacking python3.11-minimal (3.11.2-6) ... Setting up libpython3.11-minimal:armhf (3.11.2-6) ... Setting up libexpat1:armhf (2.5.0-1) ... Setting up python3.11-minimal (3.11.2-6) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.2-1+b1_armhf.deb ... Unpacking python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.0.0_all.deb ... Unpacking media-types (10.0.0) ... Selecting previously unselected package readline-common. Preparing to unpack .../2-readline-common_8.2-1.3_all.deb ... Unpacking readline-common (8.2-1.3) ... Selecting previously unselected package libreadline8:armhf. Preparing to unpack .../3-libreadline8_8.2-1.3_armhf.deb ... Unpacking libreadline8:armhf (8.2-1.3) ... Selecting previously unselected package libpython3.11-stdlib:armhf. Preparing to unpack .../4-libpython3.11-stdlib_3.11.2-6_armhf.deb ... Unpacking libpython3.11-stdlib:armhf (3.11.2-6) ... Selecting previously unselected package python3.11. Preparing to unpack .../5-python3.11_3.11.2-6_armhf.deb ... Unpacking python3.11 (3.11.2-6) ... Selecting previously unselected package libpython3-stdlib:armhf. Preparing to unpack .../6-libpython3-stdlib_3.11.2-1+b1_armhf.deb ... Unpacking libpython3-stdlib:armhf (3.11.2-1+b1) ... Setting up python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20038 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.2-1+b1_armhf.deb ... Unpacking python3 (3.11.2-1+b1) ... Selecting previously unselected package netbase. Preparing to unpack .../001-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../002-sensible-utils_0.0.17+nmu1_all.deb ... Unpacking sensible-utils (0.0.17+nmu1) ... Selecting previously unselected package openssl. Preparing to unpack .../003-openssl_3.0.11-1~deb12u2_armhf.deb ... Unpacking openssl (3.0.11-1~deb12u2) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../004-ca-certificates_20230311_all.deb ... Unpacking ca-certificates (20230311) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../005-libmagic-mgc_1%3a5.44-3_armhf.deb ... Unpacking libmagic-mgc (1:5.44-3) ... Selecting previously unselected package libmagic1:armhf. Preparing to unpack .../006-libmagic1_1%3a5.44-3_armhf.deb ... Unpacking libmagic1:armhf (1:5.44-3) ... Selecting previously unselected package file. Preparing to unpack .../007-file_1%3a5.44-3_armhf.deb ... Unpacking file (1:5.44-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../008-gettext-base_0.21-12_armhf.deb ... Unpacking gettext-base (0.21-12) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../009-libuchardet0_0.0.7-1_armhf.deb ... Unpacking libuchardet0:armhf (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../010-groff-base_1.22.4-10_armhf.deb ... Unpacking groff-base (1.22.4-10) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../011-bsdextrautils_2.38.1-5+b1_armhf.deb ... Unpacking bsdextrautils (2.38.1-5+b1) ... Selecting previously unselected package libpipeline1:armhf. Preparing to unpack .../012-libpipeline1_1.5.7-1_armhf.deb ... Unpacking libpipeline1:armhf (1.5.7-1) ... Selecting previously unselected package man-db. Preparing to unpack .../013-man-db_2.11.2-2_armhf.deb ... Unpacking man-db (2.11.2-2) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../014-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.10+dfsg-1_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Selecting previously unselected package libglib2.0-0:armhf. Preparing to unpack .../016-libglib2.0-0_2.74.6-2_armhf.deb ... Unpacking libglib2.0-0:armhf (2.74.6-2) ... Selecting previously unselected package libicu72:armhf. Preparing to unpack .../017-libicu72_72.1-3_armhf.deb ... Unpacking libicu72:armhf (72.1-3) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../018-libxml2_2.9.14+dfsg-1.3~deb12u1_armhf.deb ... Unpacking libxml2:armhf (2.9.14+dfsg-1.3~deb12u1) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.2-1_armhf.deb ... Unpacking shared-mime-info (2.2-1) ... Selecting previously unselected package libjpeg62-turbo:armhf. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-2_armhf.deb ... Unpacking libjpeg62-turbo:armhf (1:2.1.5-2) ... Selecting previously unselected package libpng16-16:armhf. Preparing to unpack .../021-libpng16-16_1.6.39-2_armhf.deb ... Unpacking libpng16-16:armhf (1.6.39-2) ... Selecting previously unselected package libdeflate0:armhf. Preparing to unpack .../022-libdeflate0_1.14-1_armhf.deb ... Unpacking libdeflate0:armhf (1.14-1) ... Selecting previously unselected package libjbig0:armhf. Preparing to unpack .../023-libjbig0_2.1-6.1_armhf.deb ... Unpacking libjbig0:armhf (2.1-6.1) ... Selecting previously unselected package liblerc4:armhf. Preparing to unpack .../024-liblerc4_4.0.0+ds-2_armhf.deb ... Unpacking liblerc4:armhf (4.0.0+ds-2) ... Selecting previously unselected package libwebp7:armhf. Preparing to unpack .../025-libwebp7_1.2.4-0.2+deb12u1_armhf.deb ... Unpacking libwebp7:armhf (1.2.4-0.2+deb12u1) ... Selecting previously unselected package libtiff6:armhf. Preparing to unpack .../026-libtiff6_4.5.0-6+deb12u1_armhf.deb ... Unpacking libtiff6:armhf (4.5.0-6+deb12u1) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf. Preparing to unpack .../027-libgdk-pixbuf-2.0-0_2.42.10+dfsg-1+b1_armhf.deb ... Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-1+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../028-gtk-update-icon-cache_3.24.38-2~deb12u1_armhf.deb ... Unpacking gtk-update-icon-cache (3.24.38-2~deb12u1) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../029-adwaita-icon-theme_43-1_all.deb ... Unpacking adwaita-icon-theme (43-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../030-ca-certificates-java_20230710~deb12u1_all.deb ... Unpacking ca-certificates-java (20230710~deb12u1) ... Selecting previously unselected package java-common. Preparing to unpack .../031-java-common_0.74_all.deb ... Unpacking java-common (0.74) ... Selecting previously unselected package libavahi-common-data:armhf. Preparing to unpack .../032-libavahi-common-data_0.8-10_armhf.deb ... Unpacking libavahi-common-data:armhf (0.8-10) ... Selecting previously unselected package libavahi-common3:armhf. Preparing to unpack .../033-libavahi-common3_0.8-10_armhf.deb ... Unpacking libavahi-common3:armhf (0.8-10) ... Selecting previously unselected package libdbus-1-3:armhf. Preparing to unpack .../034-libdbus-1-3_1.14.10-1~deb12u1_armhf.deb ... Unpacking libdbus-1-3:armhf (1.14.10-1~deb12u1) ... Selecting previously unselected package libavahi-client3:armhf. Preparing to unpack .../035-libavahi-client3_0.8-10_armhf.deb ... Unpacking libavahi-client3:armhf (0.8-10) ... Selecting previously unselected package libcups2:armhf. Preparing to unpack .../036-libcups2_2.4.2-3+deb12u5_armhf.deb ... Unpacking libcups2:armhf (2.4.2-3+deb12u5) ... Selecting previously unselected package liblcms2-2:armhf. Preparing to unpack .../037-liblcms2-2_2.14-2_armhf.deb ... Unpacking liblcms2-2:armhf (2.14-2) ... Selecting previously unselected package libbrotli1:armhf. Preparing to unpack .../038-libbrotli1_1.0.9-2+b6_armhf.deb ... Unpacking libbrotli1:armhf (1.0.9-2+b6) ... Selecting previously unselected package libfreetype6:armhf. Preparing to unpack .../039-libfreetype6_2.12.1+dfsg-5_armhf.deb ... Unpacking libfreetype6:armhf (2.12.1+dfsg-5) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-6_all.deb ... Unpacking fonts-dejavu-core (2.37-6) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.14.1-4_armhf.deb ... Unpacking fontconfig-config (2.14.1-4) ... Selecting previously unselected package libfontconfig1:armhf. Preparing to unpack .../042-libfontconfig1_2.14.1-4_armhf.deb ... Unpacking libfontconfig1:armhf (2.14.1-4) ... Selecting previously unselected package libnspr4:armhf. Preparing to unpack .../043-libnspr4_2%3a4.35-1_armhf.deb ... Unpacking libnspr4:armhf (2:4.35-1) ... Selecting previously unselected package libnss3:armhf. Preparing to unpack .../044-libnss3_2%3a3.87.1-1_armhf.deb ... Unpacking libnss3:armhf (2:3.87.1-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.8-1_all.deb ... Unpacking libasound2-data (1.2.8-1) ... Selecting previously unselected package libasound2:armhf. Preparing to unpack .../046-libasound2_1.2.8-1+b1_armhf.deb ... Unpacking libasound2:armhf (1.2.8-1+b1) ... Selecting previously unselected package libgraphite2-3:armhf. Preparing to unpack .../047-libgraphite2-3_1.3.14-1_armhf.deb ... Unpacking libgraphite2-3:armhf (1.3.14-1) ... Selecting previously unselected package libharfbuzz0b:armhf. Preparing to unpack .../048-libharfbuzz0b_6.0.0+dfsg-3_armhf.deb ... Unpacking libharfbuzz0b:armhf (6.0.0+dfsg-3) ... Selecting previously unselected package libpcsclite1:armhf. Preparing to unpack .../049-libpcsclite1_1.9.9-2_armhf.deb ... Unpacking libpcsclite1:armhf (1.9.9-2) ... Selecting previously unselected package openjdk-17-jre-headless:armhf. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jre-headless:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-74_armhf.deb ... Unpacking default-jre-headless (2:1.17-74) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.13-1_all.deb ... Unpacking ant (1.10.13-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.13-1_all.deb ... Unpacking ant-optional (1.10.13-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-12_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-12) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-12_all.deb ... Unpacking antlr (2.7.7+dfsg-12) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.46.0-5_all.deb ... Unpacking at-spi2-common (2.46.0-5) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-3_armhf.deb ... Unpacking m4 (1.4.19-3) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-12_all.deb ... Unpacking autopoint (0.21-12) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_armhf.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-1_all.deb ... Unpacking libhamcrest-java (2.2-1) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-3_all.deb ... Unpacking junit4 (4.13.2-3) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-1_all.deb ... Unpacking libjansi-native-java (1.8-1) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-3_all.deb ... Unpacking bnd (5.0.1-3) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3_armhf.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.11.4_all.deb ... Unpacking libdebhelper-perl (13.11.4) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-5_all.deb ... Unpacking libtool (2.4.7-5) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.09-4_all.deb ... Unpacking libsub-override-perl (0.09-4) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:armhf. Preparing to unpack .../088-libelf1_0.188-2.1_armhf.deb ... Unpacking libelf1:armhf (0.188-2.1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_armhf.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-12_armhf.deb ... Unpacking gettext (0.21-12) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.11.4_all.deb ... Unpacking debhelper (13.11.4) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-2_all.deb ... Unpacking libgtk2.0-common (2.24.33-2) ... Selecting previously unselected package libatk1.0-0:armhf. Preparing to unpack .../095-libatk1.0-0_2.46.0-5_armhf.deb ... Unpacking libatk1.0-0:armhf (2.46.0-5) ... Selecting previously unselected package libpixman-1-0:armhf. Preparing to unpack .../096-libpixman-1-0_0.42.2-1_armhf.deb ... Unpacking libpixman-1-0:armhf (0.42.2-1) ... Selecting previously unselected package libxau6:armhf. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_armhf.deb ... Unpacking libxau6:armhf (1:1.0.9-1) ... Selecting previously unselected package libbsd0:armhf. Preparing to unpack .../098-libbsd0_0.11.7-2_armhf.deb ... Unpacking libbsd0:armhf (0.11.7-2) ... Selecting previously unselected package libxdmcp6:armhf. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_armhf.deb ... Unpacking libxdmcp6:armhf (1:1.1.2-3) ... Selecting previously unselected package libxcb1:armhf. Preparing to unpack .../100-libxcb1_1.15-1_armhf.deb ... Unpacking libxcb1:armhf (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.4-2+deb12u2_all.deb ... Unpacking libx11-data (2:1.8.4-2+deb12u2) ... Selecting previously unselected package libx11-6:armhf. Preparing to unpack .../102-libx11-6_2%3a1.8.4-2+deb12u2_armhf.deb ... Unpacking libx11-6:armhf (2:1.8.4-2+deb12u2) ... Selecting previously unselected package libxcb-render0:armhf. Preparing to unpack .../103-libxcb-render0_1.15-1_armhf.deb ... Unpacking libxcb-render0:armhf (1.15-1) ... Selecting previously unselected package libxcb-shm0:armhf. Preparing to unpack .../104-libxcb-shm0_1.15-1_armhf.deb ... Unpacking libxcb-shm0:armhf (1.15-1) ... Selecting previously unselected package libxext6:armhf. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_armhf.deb ... Unpacking libxext6:armhf (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:armhf. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_armhf.deb ... Unpacking libxrender1:armhf (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:armhf. Preparing to unpack .../107-libcairo2_1.16.0-7_armhf.deb ... Unpacking libcairo2:armhf (1.16.0-7) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.14.1-4_armhf.deb ... Unpacking fontconfig (2.14.1-4) ... Selecting previously unselected package libfribidi0:armhf. Preparing to unpack .../109-libfribidi0_1.0.8-2.1_armhf.deb ... Unpacking libfribidi0:armhf (1.0.8-2.1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-1_all.deb ... Unpacking libthai-data (0.1.29-1) ... Selecting previously unselected package libdatrie1:armhf. Preparing to unpack .../111-libdatrie1_0.2.13-2+b1_armhf.deb ... Unpacking libdatrie1:armhf (0.2.13-2+b1) ... Selecting previously unselected package libthai0:armhf. Preparing to unpack .../112-libthai0_0.1.29-1_armhf.deb ... Unpacking libthai0:armhf (0.1.29-1) ... Selecting previously unselected package libpango-1.0-0:armhf. Preparing to unpack .../113-libpango-1.0-0_1.50.12+ds-1_armhf.deb ... Unpacking libpango-1.0-0:armhf (1.50.12+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:armhf. Preparing to unpack .../114-libpangoft2-1.0-0_1.50.12+ds-1_armhf.deb ... Unpacking libpangoft2-1.0-0:armhf (1.50.12+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:armhf. Preparing to unpack .../115-libpangocairo-1.0-0_1.50.12+ds-1_armhf.deb ... Unpacking libpangocairo-1.0-0:armhf (1.50.12+ds-1) ... Selecting previously unselected package libxcomposite1:armhf. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_armhf.deb ... Unpacking libxcomposite1:armhf (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:armhf. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_armhf.deb ... Unpacking libxfixes3:armhf (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:armhf. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_armhf.deb ... Unpacking libxcursor1:armhf (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:armhf. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_armhf.deb ... Unpacking libxdamage1:armhf (1:1.1.6-1) ... Selecting previously unselected package libxi6:armhf. Preparing to unpack .../120-libxi6_2%3a1.8-1+b1_armhf.deb ... Unpacking libxi6:armhf (2:1.8-1+b1) ... Selecting previously unselected package libxinerama1:armhf. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_armhf.deb ... Unpacking libxinerama1:armhf (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:armhf. Preparing to unpack .../122-libxrandr2_2%3a1.5.2-2+b1_armhf.deb ... Unpacking libxrandr2:armhf (2:1.5.2-2+b1) ... Selecting previously unselected package libgtk2.0-0:armhf. Preparing to unpack .../123-libgtk2.0-0_2.24.33-2_armhf.deb ... Unpacking libgtk2.0-0:armhf (2.24.33-2) ... Selecting previously unselected package libglvnd0:armhf. Preparing to unpack .../124-libglvnd0_1.6.0-1_armhf.deb ... Unpacking libglvnd0:armhf (1.6.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.114-1_all.deb ... Unpacking libdrm-common (2.4.114-1) ... Selecting previously unselected package libdrm2:armhf. Preparing to unpack .../126-libdrm2_2.4.114-1+b1_armhf.deb ... Unpacking libdrm2:armhf (2.4.114-1+b1) ... Selecting previously unselected package libglapi-mesa:armhf. Preparing to unpack .../127-libglapi-mesa_22.3.6-1+deb12u1_armhf.deb ... Unpacking libglapi-mesa:armhf (22.3.6-1+deb12u1) ... Selecting previously unselected package libx11-xcb1:armhf. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.4-2+deb12u2_armhf.deb ... Unpacking libx11-xcb1:armhf (2:1.8.4-2+deb12u2) ... Selecting previously unselected package libxcb-dri2-0:armhf. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_armhf.deb ... Unpacking libxcb-dri2-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:armhf. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_armhf.deb ... Unpacking libxcb-dri3-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-glx0:armhf. Preparing to unpack .../131-libxcb-glx0_1.15-1_armhf.deb ... Unpacking libxcb-glx0:armhf (1.15-1) ... Selecting previously unselected package libxcb-present0:armhf. Preparing to unpack .../132-libxcb-present0_1.15-1_armhf.deb ... Unpacking libxcb-present0:armhf (1.15-1) ... Selecting previously unselected package libxcb-randr0:armhf. Preparing to unpack .../133-libxcb-randr0_1.15-1_armhf.deb ... Unpacking libxcb-randr0:armhf (1.15-1) ... Selecting previously unselected package libxcb-sync1:armhf. Preparing to unpack .../134-libxcb-sync1_1.15-1_armhf.deb ... Unpacking libxcb-sync1:armhf (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:armhf. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_armhf.deb ... Unpacking libxcb-xfixes0:armhf (1.15-1) ... Selecting previously unselected package libxshmfence1:armhf. Preparing to unpack .../136-libxshmfence1_1.3-1_armhf.deb ... Unpacking libxshmfence1:armhf (1.3-1) ... Selecting previously unselected package libxxf86vm1:armhf. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_armhf.deb ... Unpacking libxxf86vm1:armhf (1:1.1.4-1+b2) ... Selecting previously unselected package libdrm-amdgpu1:armhf. Preparing to unpack .../138-libdrm-amdgpu1_2.4.114-1+b1_armhf.deb ... Unpacking libdrm-amdgpu1:armhf (2.4.114-1+b1) ... Selecting previously unselected package libdrm-nouveau2:armhf. Preparing to unpack .../139-libdrm-nouveau2_2.4.114-1+b1_armhf.deb ... Unpacking libdrm-nouveau2:armhf (2.4.114-1+b1) ... Selecting previously unselected package libdrm-radeon1:armhf. Preparing to unpack .../140-libdrm-radeon1_2.4.114-1+b1_armhf.deb ... Unpacking libdrm-radeon1:armhf (2.4.114-1+b1) ... Selecting previously unselected package libedit2:armhf. Preparing to unpack .../141-libedit2_3.1-20221030-2_armhf.deb ... Unpacking libedit2:armhf (3.1-20221030-2) ... Selecting previously unselected package libz3-4:armhf. Preparing to unpack .../142-libz3-4_4.8.12-3.1_armhf.deb ... Unpacking libz3-4:armhf (4.8.12-3.1) ... Selecting previously unselected package libllvm15:armhf. Preparing to unpack .../143-libllvm15_1%3a15.0.6-4+b1_armhf.deb ... Unpacking libllvm15:armhf (1:15.0.6-4+b1) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../144-libsensors-config_1%3a3.6.0-7.1_all.deb ... Unpacking libsensors-config (1:3.6.0-7.1) ... Selecting previously unselected package libsensors5:armhf. Preparing to unpack .../145-libsensors5_1%3a3.6.0-7.1_armhf.deb ... Unpacking libsensors5:armhf (1:3.6.0-7.1) ... Selecting previously unselected package libgl1-mesa-dri:armhf. Preparing to unpack .../146-libgl1-mesa-dri_22.3.6-1+deb12u1_armhf.deb ... Unpacking libgl1-mesa-dri:armhf (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx-mesa0:armhf. Preparing to unpack .../147-libglx-mesa0_22.3.6-1+deb12u1_armhf.deb ... Unpacking libglx-mesa0:armhf (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx0:armhf. Preparing to unpack .../148-libglx0_1.6.0-1_armhf.deb ... Unpacking libglx0:armhf (1.6.0-1) ... Selecting previously unselected package libgl1:armhf. Preparing to unpack .../149-libgl1_1.6.0-1_armhf.deb ... Unpacking libgl1:armhf (1.6.0-1) ... Selecting previously unselected package libgif7:armhf. Preparing to unpack .../150-libgif7_5.2.1-2.5_armhf.deb ... Unpacking libgif7:armhf (5.2.1-2.5) ... Selecting previously unselected package x11-common. Preparing to unpack .../151-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:armhf. Preparing to unpack .../152-libxtst6_2%3a1.2.3-1.1_armhf.deb ... Unpacking libxtst6:armhf (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:armhf. Preparing to unpack .../153-openjdk-17-jre_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jre:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jre. Preparing to unpack .../154-default-jre_2%3a1.17-74_armhf.deb ... Unpacking default-jre (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk-headless:armhf. Preparing to unpack .../155-openjdk-17-jdk-headless_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jdk-headless:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../156-default-jdk-headless_2%3a1.17-74_armhf.deb ... Unpacking default-jdk-headless (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk:armhf. Preparing to unpack .../157-openjdk-17-jdk_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jdk:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../158-default-jdk_2%3a1.17-74_armhf.deb ... Unpacking default-jdk (2:1.17-74) ... Selecting previously unselected package libassuan0:armhf. Preparing to unpack .../159-libassuan0_2.5.5-5_armhf.deb ... Unpacking libassuan0:armhf (2.5.5-5) ... Selecting previously unselected package gpgconf. Preparing to unpack .../160-gpgconf_2.2.40-1.1_armhf.deb ... Unpacking gpgconf (2.2.40-1.1) ... Selecting previously unselected package libksba8:armhf. Preparing to unpack .../161-libksba8_1.6.3-2_armhf.deb ... Unpacking libksba8:armhf (1.6.3-2) ... Selecting previously unselected package libsasl2-modules-db:armhf. Preparing to unpack .../162-libsasl2-modules-db_2.1.28+dfsg-10_armhf.deb ... Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg-10) ... Selecting previously unselected package libsasl2-2:armhf. Preparing to unpack .../163-libsasl2-2_2.1.28+dfsg-10_armhf.deb ... Unpacking libsasl2-2:armhf (2.1.28+dfsg-10) ... Selecting previously unselected package libldap-2.5-0:armhf. Preparing to unpack .../164-libldap-2.5-0_2.5.13+dfsg-5_armhf.deb ... Unpacking libldap-2.5-0:armhf (2.5.13+dfsg-5) ... Selecting previously unselected package libnpth0:armhf. Preparing to unpack .../165-libnpth0_1.6-3_armhf.deb ... Unpacking libnpth0:armhf (1.6-3) ... Selecting previously unselected package dirmngr. Preparing to unpack .../166-dirmngr_2.2.40-1.1_armhf.deb ... Unpacking dirmngr (2.2.40-1.1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../167-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../168-gnupg-utils_2.2.40-1.1_armhf.deb ... Unpacking gnupg-utils (2.2.40-1.1) ... Selecting previously unselected package gpg. Preparing to unpack .../169-gpg_2.2.40-1.1_armhf.deb ... Unpacking gpg (2.2.40-1.1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../170-pinentry-curses_1.2.1-1_armhf.deb ... Unpacking pinentry-curses (1.2.1-1) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../171-gpg-agent_2.2.40-1.1_armhf.deb ... Unpacking gpg-agent (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../172-gpg-wks-client_2.2.40-1.1_armhf.deb ... Unpacking gpg-wks-client (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../173-gpg-wks-server_2.2.40-1.1_armhf.deb ... Unpacking gpg-wks-server (2.2.40-1.1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../174-gpgsm_2.2.40-1.1_armhf.deb ... Unpacking gpgsm (2.2.40-1.1) ... Selecting previously unselected package gnupg. Preparing to unpack .../175-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../176-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../177-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../178-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../179-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../180-libio-pty-perl_1%3a1.17-1_armhf.deb ... Unpacking libio-pty-perl (1:1.17-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../181-libipc-run-perl_20220807.0-1_all.deb ... Unpacking libipc-run-perl (20220807.0-1) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../182-libclass-method-modifiers-perl_2.14-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.14-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../183-libclass-xsaccessor-perl_1.19-4+b1_armhf.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b1) ... Selecting previously unselected package libb-hooks-op-check-perl:armhf. Preparing to unpack .../184-libb-hooks-op-check-perl_0.22-2+b1_armhf.deb ... Unpacking libb-hooks-op-check-perl:armhf (0.22-2+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../185-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:armhf. Preparing to unpack .../186-libdevel-callchecker-perl_0.008-2_armhf.deb ... Unpacking libdevel-callchecker-perl:armhf (0.008-2) ... Selecting previously unselected package libparams-classify-perl:armhf. Preparing to unpack .../187-libparams-classify-perl_0.015-2+b1_armhf.deb ... Unpacking libparams-classify-perl:armhf (0.015-2+b1) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../188-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../189-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../190-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../191-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../192-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../193-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../194-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../195-libhttp-date-perl_6.05-2_all.deb ... Unpacking libhttp-date-perl (6.05-2) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../196-libfile-listing-perl_6.15-1_all.deb ... Unpacking libfile-listing-perl (6.15-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../197-libhtml-tagset-perl_3.20-6_all.deb ... Unpacking libhtml-tagset-perl (3.20-6) ... Selecting previously unselected package libregexp-ipv6-perl. Preparing to unpack .../198-libregexp-ipv6-perl_0.03-3_all.deb ... Unpacking libregexp-ipv6-perl (0.03-3) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../199-liburi-perl_5.17-1_all.deb ... Unpacking liburi-perl (5.17-1) ... Selecting previously unselected package libhtml-parser-perl:armhf. Preparing to unpack .../200-libhtml-parser-perl_3.81-1_armhf.deb ... Unpacking libhtml-parser-perl:armhf (3.81-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../201-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:armhf. Preparing to unpack .../202-libclone-perl_0.46-1_armhf.deb ... Unpacking libclone-perl:armhf (0.46-1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../203-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../204-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../205-libhttp-message-perl_6.44-1_all.deb ... Unpacking libhttp-message-perl (6.44-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../206-libhttp-cookies-perl_6.10-1_all.deb ... Unpacking libhttp-cookies-perl (6.10-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../207-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:armhf. Preparing to unpack .../208-perl-openssl-defaults_7+b1_armhf.deb ... Unpacking perl-openssl-defaults:armhf (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:armhf. Preparing to unpack .../209-libnet-ssleay-perl_1.92-2+b1_armhf.deb ... Unpacking libnet-ssleay-perl:armhf (1.92-2+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../210-libio-socket-ssl-perl_2.081-2_all.deb ... Unpacking libio-socket-ssl-perl (2.081-2) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../211-libnet-http-perl_6.22-1_all.deb ... Unpacking libnet-http-perl (6.22-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../212-liblwp-protocol-https-perl_6.10-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.10-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../213-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../214-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../215-libwww-perl_6.68-1_all.deb ... Unpacking libwww-perl (6.68-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../216-patchutils_0.4.2-1_armhf.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../217-wdiff_1.2.2-5_armhf.deb ... Unpacking wdiff (1.2.2-5) ... Selecting previously unselected package devscripts. Preparing to unpack .../218-devscripts_2.23.4+deb12u1_armhf.deb ... Unpacking devscripts (2.23.4+deb12u1) ... Selecting previously unselected package ivy. Preparing to unpack .../219-ivy_2.5.1-2_all.deb ... Unpacking ivy (2.5.1-2) ... Selecting previously unselected package libasm-java. Preparing to unpack .../220-libasm-java_9.4-1_all.deb ... Unpacking libasm-java (9.4-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../221-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../222-libcommons-cli-java_1.5.0-1_all.deb ... Unpacking libcommons-cli-java (1.5.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../223-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../224-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../225-libcommons-logging-java_1.2-3_all.deb ... Unpacking libcommons-logging-java (1.2-3) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../226-libjansi-java_2.4.0-2_all.deb ... Unpacking libjansi-java (2.4.0-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../227-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../228-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../229-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../230-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../231-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../232-groovy_2.4.21-8_all.deb ... Unpacking groovy (2.4.21-8) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../233-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../234-libcommons-collections3-java_3.2.2-2_all.deb ... Unpacking libcommons-collections3-java (3.2.2-2) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../235-libcommons-compress-java_1.22-1_all.deb ... Unpacking libcommons-compress-java (1.22-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../236-libcommons-io-java_2.11.0-2_all.deb ... Unpacking libcommons-io-java (2.11.0-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../237-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../238-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../239-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../240-libguava-java_31.1-1_all.deb ... Unpacking libguava-java (31.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../241-libcommons-codec-java_1.15-1_all.deb ... Unpacking libcommons-codec-java (1.15-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../242-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../243-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../244-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../245-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../246-libjna-jni_5.13.0-2_armhf.deb ... Unpacking libjna-jni (5.13.0-2) ... Selecting previously unselected package libjna-java. Preparing to unpack .../247-libjna-java_5.13.0-2_all.deb ... Unpacking libjna-java (5.13.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../248-libjzlib-java_1.1.3-2_all.deb ... Unpacking libjzlib-java (1.1.3-2) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../249-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../250-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../251-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../252-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../253-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../254-liblogback-java_1%3a1.2.11-3_all.deb ... Unpacking liblogback-java (1:1.2.11-3) ... Selecting previously unselected package libncurses6:armhf. Preparing to unpack .../255-libncurses6_6.4-4_armhf.deb ... Unpacking libncurses6:armhf (6.4-4) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../256-libnative-platform-jni_0.14-5_armhf.deb ... Unpacking libnative-platform-jni (0.14-5) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../257-libnative-platform-java_0.14-5_all.deb ... Unpacking libnative-platform-java (0.14-5) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../258-libxml-commons-external-java_1.4.01-5_all.deb ... Unpacking libxml-commons-external-java (1.4.01-5) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../259-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../260-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../261-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../262-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../263-libgradle-core-java_4.4.1-18_all.deb ... Unpacking libgradle-core-java (4.4.1-18) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../264-libbcprov-java_1.72-2_all.deb ... Unpacking libbcprov-java (1.72-2) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../265-libbcpg-java_1.72-2_all.deb ... Unpacking libbcpg-java (1.72-2) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../266-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../267-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../268-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../269-libdom4j-java_2.1.3-2_all.deb ... Unpacking libdom4j-java (2.1.3-2) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../270-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../271-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../272-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../273-libgoogle-gson-java_2.10-1_all.deb ... Unpacking libgoogle-gson-java (2.10-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../274-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../275-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../276-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../277-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../278-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../279-libjavaewah-java_1.1.7-1_all.deb ... Unpacking libjavaewah-java (1.1.7-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../280-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../281-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../282-libjetty9-java_9.4.50-4+deb12u2_all.deb ... Unpacking libjetty9-java (9.4.50-4+deb12u2) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../283-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../284-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../285-libcommons-lang3-java_3.12.0-2_all.deb ... Unpacking libcommons-lang3-java (3.12.0-2) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../286-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../287-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../288-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../289-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../290-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../291-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../292-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../293-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../294-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../295-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../296-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../297-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../298-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../299-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../300-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../301-libmaven3-core-java_3.8.7-1_all.deb ... Unpacking libmaven3-core-java (3.8.7-1) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../302-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../303-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../304-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../305-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../306-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../307-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../308-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../309-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../310-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../311-libgradle-plugins-java_4.4.1-18_all.deb ... Unpacking libgradle-plugins-java (4.4.1-18) ... Selecting previously unselected package gradle. Preparing to unpack .../312-gradle_4.4.1-18_all.deb ... Unpacking gradle (4.4.1-18) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../313-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../314-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package javahelper. Preparing to unpack .../315-javahelper_0.78_all.deb ... Unpacking javahelper (0.78) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../316-libbyte-buddy-java_1.12.21-1_all.deb ... Unpacking libbyte-buddy-java (1.12.21-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../317-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../318-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../319-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../320-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../321-liblz4-jni_1.8.0-3_armhf.deb ... Unpacking liblz4-jni (1.8.0-3) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../322-liblz4-java_1.8.0-3_all.deb ... Unpacking liblz4-java (1.8.0-3) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../323-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../324-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../325-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.72-2) ... Setting up libksba8:armhf (1.6.3-2) ... Setting up media-types (10.0.0) ... Setting up libpipeline1:armhf (1.5.7-1) ... Setting up libgraphite2-3:armhf (1.3.14-1) ... Setting up liblcms2-2:armhf (2.14-2) ... Setting up libpixman-1-0:armhf (0.42.2-1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-5) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:armhf (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:armhf (72.1-3) ... Setting up liblerc4:armhf (4.0.0+ds-2) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.38.1-5+b1) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.74) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:armhf (0.2.13-2+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.14-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.5.0-1) ... Setting up libio-pty-perl (1:1.17-1) ... Setting up libmagic-mgc (1:5.44-3) ... Setting up liblogback-java (1:1.2.11-3) ... Setting up libclone-perl:armhf (0.46-1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:armhf (2.74.6-2) ... No schema files found: doing nothing. Setting up libglvnd0:armhf (1.6.0-1) ... Setting up libgoogle-gson-java (2.10-1) ... Setting up libhtml-tagset-perl (3.20-6) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.11.4) ... Setting up libbrotli1:armhf (1.0.9-2+b6) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Setting up libasm-java (9.4-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-7.1) ... Setting up libmagic1:armhf (1:5.44-3) ... Setting up libdeflate0:armhf (1.14-1) ... Setting up perl-openssl-defaults:armhf (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-12) ... Setting up m4 (1.4.19-3) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:armhf (1.6-3) ... Setting up file (1:5.44-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:armhf (2.5.5-5) ... Setting up libjzlib-java (1.1.3-2) ... Setting up libjbig0:armhf (2.1-6.1) ... Setting up libsasl2-modules-db:armhf (2.1.28+dfsg-10) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-2) ... Setting up libasound2-data (1.2.8-1) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:armhf (4.8.12-3.1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.1.7-1) ... Setting up libjpeg62-turbo:armhf (1:2.1.5-2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.4-2+deb12u2) ... Setting up libnspr4:armhf (2:4.35-1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.0-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:armhf (0.8-10) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libncurses6:armhf (6.4-4) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:armhf (1.14.10-1~deb12u1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:armhf (1.0.8-2.1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up libpng16-16:armhf (1.6.39-2) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.13.0-2) ... Setting up autopoint (0.21-12) ... Setting up libb-hooks-op-check-perl:armhf (0.22-2+b1) ... Setting up fonts-dejavu-core (2.37-6) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20220807.0-1) ... Setting up libpcsclite1:armhf (1.9.9-2) ... Setting up libsensors5:armhf (1:3.6.0-7.1) ... Setting up libhamcrest-java (2.2-1) ... Setting up libglapi-mesa:armhf (22.3.6-1+deb12u1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:armhf (2.1.28+dfsg-10) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:armhf (1.2.4-0.2+deb12u1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libregexp-ipv6-perl (0.03-3) ... Setting up libgif7:armhf (5.2.1-2.5) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.17+nmu1) ... Setting up libxshmfence1:armhf (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.46.0-5) ... Setting up libtiff6:armhf (4.5.0-6+deb12u1) ... Setting up libuchardet0:armhf (0.0.7-1) ... Setting up libxml-commons-external-java (1.4.01-5) ... Setting up libjna-java (5.13.0-2) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:armhf (1.2.8-1+b1) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.09-4) ... Setting up libthai-data (0.1.29-1) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-5) ... Setting up libclass-xsaccessor-perl (1.19-4+b1) ... Setting up libgtk2.0-common (2.24.33-2) ... Setting up libatk1.0-0:armhf (2.46.0-5) ... Setting up liblz4-jni (1.8.0-3) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.72-2) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-12) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.0.11-1~deb12u2) ... Setting up libbsd0:armhf (0.11.7-2) ... Setting up libdrm-common (2.4.114-1) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:armhf (0.188-2.1) ... Setting up readline-common (8.2-1.3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:armhf (2.9.14+dfsg-1.3~deb12u1) ... Setting up liburi-perl (5.17-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:armhf (1.92-2+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-1) ... Setting up libdom4j-java (2.1.3-2) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-5) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.05-2) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:armhf (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-3) ... Setting up libxcb1:armhf (1.15-1) ... Setting up gettext (0.21-12) ... Setting up libjetty9-java (9.4.50-4+deb12u2) ... Setting up libxcb-xfixes0:armhf (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.15-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libtool (2.4.7-5) ... Setting up libxcb-render0:armhf (1.15-1) ... Setting up fontconfig-config (2.14.1-4) ... Setting up libxcb-glx0:armhf (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:armhf (3.1-20221030-2) ... Setting up libreadline8:armhf (8.2-1.3) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:armhf (0.8-10) ... Setting up libcommons-logging-java (1.2-3) ... Setting up libnet-http-perl (6.22-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:armhf (2:3.87.1-1) ... Setting up libxcb-shm0:armhf (1.15-1) ... Setting up libdevel-callchecker-perl:armhf (0.008-2) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:armhf (2.5.13+dfsg-5) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:armhf (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:armhf (0.1.29-1) ... Setting up ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 140 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:armhf (2.12.1+dfsg-5) ... Setting up libxcb-sync1:armhf (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.2-1) ... Setting up libcommons-lang3-java (3.12.0-2) ... Setting up libxcb-dri2-0:armhf (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:armhf (2.4.114-1+b1) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-1) ... Setting up groff-base (1.22.4-10) ... Setting up libxcb-randr0:armhf (1.15-1) ... Setting up libhtml-parser-perl:armhf (3.81-1) ... Setting up libllvm15:armhf (1:15.0.6-4+b1) ... Setting up gpgconf (2.2.40-1.1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:armhf (2:1.8.4-2+deb12u2) ... Setting up libharfbuzz0b:armhf (6.0.0+dfsg-3) ... Setting up libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-1+b1) ... Setting up libfontconfig1:armhf (2.14.1-4) ... Setting up ca-certificates-java (20230710~deb12u1) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.15-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libxcomposite1:armhf (1:0.4.5-1) ... Setting up libavahi-client3:armhf (0.8-10) ... Setting up libio-socket-ssl-perl (2.081-2) ... Setting up gpg (2.2.40-1.1) ... Setting up gnupg-utils (2.2.40-1.1) ... Setting up libhttp-message-perl (6.44-1) ... Setting up libdrm-amdgpu1:armhf (2.4.114-1+b1) ... Setting up libxcb-dri3-0:armhf (1.15-1) ... Setting up gtk-update-icon-cache (3.24.38-2~deb12u1) ... Setting up libx11-xcb1:armhf (2:1.8.4-2+deb12u2) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.14.1-4) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:armhf (2.4.114-1+b1) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:armhf (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1) ... Setting up libxrender1:armhf (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.22-1) ... Setting up libhttp-cookies-perl (6.10-1) ... Setting up libcommons-io-java (2.11.0-2) ... Setting up libdrm-radeon1:armhf (2.4.114-1+b1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:armhf (3.11.2-6) ... Setting up libparams-classify-perl:armhf (0.015-2+b1) ... Setting up gpgsm (2.2.40-1.1) ... Setting up libpango-1.0-0:armhf (1.50.12+ds-1) ... Setting up libgl1-mesa-dri:armhf (22.3.6-1+deb12u1) ... Setting up libxext6:armhf (2:1.3.4-1+b1) ... Setting up man-db (2.11.2-2) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:armhf (1.16.0-7) ... Setting up libxxf86vm1:armhf (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (43-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:armhf (1:6.0.0-2) ... Setting up libxinerama1:armhf (2:1.1.4-3) ... Setting up libxrandr2:armhf (2:1.5.2-2+b1) ... Setting up gpg-wks-server (2.2.40-1.1) ... Setting up libcups2:armhf (2.4.2-3+deb12u5) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:armhf (1.50.12+ds-1) ... Setting up libpangocairo-1.0-0:armhf (1.50.12+ds-1) ... Setting up libpython3-stdlib:armhf (3.11.2-1+b1) ... Setting up python3.11 (3.11.2-6) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:armhf (22.3.6-1+deb12u1) ... Setting up libxi6:armhf (2:1.8-1+b1) ... Setting up gpg-wks-client (2.2.40-1.1) ... Setting up libglx0:armhf (1.6.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:armhf (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:armhf (1:1.2.1-1) ... Setting up debhelper (13.11.4) ... Setting up python3 (3.11.2-1+b1) ... Setting up libgl1:armhf (1.6.0-1) ... Setting up openjdk-17-jre-headless:armhf (17.0.9+9-1~deb12u1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:armhf (2.24.33-2) ... Setting up liblwp-protocol-https-perl (6.10-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.68-1) ... Setting up devscripts (2.23.4+deb12u1) ... Setting up libguava-java (31.1-1) ... Setting up javahelper (0.78) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up libguice-java (4.2.3-2) ... Setting up libmaven3-core-java (3.8.7-1) ... Setting up libbyte-buddy-java (1.12.21-1) ... Setting up libmockito-java (2.23.0-2) ... Processing triggers for libc-bin (2.36-9+deb12u3) ... Processing triggers for ca-certificates-java (20230710~deb12u1) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068_2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:E-Tugra_Certification_Authority.pem Adding debian:E-Tugra_Global_Root_CA_ECC_v3.pem Adding debian:E-Tugra_Global_Root_CA_RSA_v3.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustCor_ECA-1.pem Adding debian:TrustCor_RootCert_CA-1.pem Adding debian:TrustCor_RootCert_CA-2.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up maven-repo-helper (1.11) ... Setting up antlr (2.7.7+dfsg-12) ... Setting up openjdk-17-jdk-headless:armhf (17.0.9+9-1~deb12u1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.1-2) ... Setting up ant (1.10.13-1) ... Setting up junit4 (4.13.2-3) ... Setting up groovy (2.4.21-8) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up default-jre-headless (2:1.17-74) ... Setting up openjdk-17-jre:armhf (17.0.9+9-1~deb12u1) ... Setting up default-jre (2:1.17-74) ... Setting up openjdk-17-jdk:armhf (17.0.9+9-1~deb12u1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up ant-optional (1.10.13-1) ... Setting up bnd (5.0.1-3) ... Setting up default-jdk-headless (2:1.17-74) ... Setting up libgradle-core-java (4.4.1-18) ... Setting up libgradle-plugins-java (4.4.1-18) ... Setting up gradle (4.4.1-18) ... Setting up default-jdk (2:1.17-74) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20230710~deb12u1) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 jar openjdk version "17.0.9" 2023-10-17 OpenJDK Runtime Environment (build 17.0.9+9-Debian-1deb12u1) OpenJDK Server VM (build 17.0.9+9-Debian-1deb12u1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 5.714 secs. The client will now receive all logging from the daemon (pid: 28777). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-28777.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 3 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@171efdb Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@171efdb Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@149252e Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@e005b4 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@6a8fac Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@149252e Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e059e7 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@118445b :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.019 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@16a4502 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) Up-to-date check for task ':compileJava' took 19.086 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':',5,main]) completed. Took 57.176 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.11 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.221 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':',5,main]) completed. Took 0.008 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.003 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.333 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.16 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':',5,main]) completed. Took 1.147 secs. BUILD SUCCESSFUL in 1m 28s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 test openjdk version "17.0.9" 2023-10-17 OpenJDK Runtime Environment (build 17.0.9+9-Debian-1deb12u1) OpenJDK Server VM (build 17.0.9+9-Debian-1deb12u1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.961 secs. The client will now receive all logging from the daemon (pid: 2902). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-2902.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 3 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e51ee4 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e51ee4 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1605d8e Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@1446097 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@7b862a Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1605d8e Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@feab16 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@19c63f8 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.017 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e385ba Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 5.545 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':',5,main]) completed. Took 5.667 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.035 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.045 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':',5,main]) completed. Took 0.003 secs. :compileTestJava (Thread[Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 21.607 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 1 mins 8.354 secs. :processTestResources (Thread[Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.134 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.356 secs. :testClasses (Thread[Daemon worker,5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Daemon worker,5,main]) completed. Took 0.002 secs. :test (Thread[Daemon worker,5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 5.323 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath14115665275392845916txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 47 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 620 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2563 com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99928 elements with 366.26KiB in raw nucleotide entropy serialized into 273.22KiB com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: 0% Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: 0% Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_0cfce7ad22a5466d4046b9bd368d3677aa3f823c6758219618182737869.tmp: 0% Indexing milib_0cfce7ad22a5466d4046b9bd368d3677aa3f823c6758219618182737869.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT GTTGCCCGGGACCCTTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTTCCGCTTCGGAATAGCTGGTGGATGGCATACTTACACTCACGGCTGGTATTCGCTACTACTTCCTGCATATCCGATCCCCTTGATGGGGGCACCAATACTATTATCCGGGGGTAGTTATCACTGTCCGTTAACCCTTGAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGTCAAGCAATTTGTGCGGCCTTCAAACAACGACCGTGTCCTAGCGATTAACCGTATTTGTCAGAGCGGCAGGATTATTGCTGACGACCTCTCCAACATGTAGTGCAGTTGTAGGTATGGCGGCGAAGGTTATGAGGCTTAGGTGCAAAGAATTGTTAAAACTCTATAACATCGGTTTAGGTTGGTACGAGTAAGCCACTTCGAGACGTGTGGTGAGTGTCTATTGCTGAATGTAGCCCCCATTTGTCTGGTCTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACATTCATAATTGGAATTATACGGTACAAACCGGTATTTAGCGCGATAGTCCGTGCGAATGAGATGGACAGTGTGGCGTCTTTGTCGGCGGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCATATCTTTAGATGGTATCGATGGAGATATGTTGGTAACCCAGAGGGTAACTCCGCGAATTCTTTGGGACGCATTATTATCAGCGTTAAGCCGGTGTTTTGGCTCGTCGCAGCTTCCC GTTGCCCGGGCCCTTCAGGCCCGTAAAAGCATCGTTGTTCCTGCATGCCTCGCTGTCGGAATAGCGGTGGATGGCATATTACACTCTCCGGCTGGTATTCGCTTCTACTTCCTGATATCGATCCGCCTTGATGGGGCTCCAACACTACTATCCGGGGTAGTTACCACTGTCCGTTTACTCTTAGAAAACGGTTAGGTTTCGAAAAACATTGTCCTTGGGCTACAAGCAATTTGGCGGCCTTCTAACTAACGACCGTGTCCTAGCGATTCAACCGTCATTTGTCAGAGCGCAGGATCATTGCTGACGACCTCTCCAACATGTAGTGCAGTTCTAGGTATGGCGGCGTAAGGTTATGAGGCTTAGGGCAAAGAATTGTTAAATCCTATAACATCGGTTAGGTTGTCAGTAAGCCACTCGAGACGTTGGTGAGTGTCTATTCTGAATGTAGCCCCCATTTGTCGGTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTTACATCCTTATTGGATTTACGGGTCTAACCGGATTTAGCGCGATAGTCCGTGCGAATGAGTGACGTGTGGCGTCTTTGTCGGGCGGAACACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGTATCACCACTTCGCCGTCATCTTTATATGTATCGATAGGAGATATGTTGGTAACCCAGAGGTAACTCCGCAATTCTTGTGCGACATTATTATCAGCGTTAAGCCGGTGTTTTGGCTCGTCGAGCTTCCT GTTGCCCGGGCCTTCGGCCCGTAAAGCACGTTGTTCTCCATGCCTGCTGTCGATAGGTGGATGGATATTACATCTCCGGCTGGTATTCGCTTCTCTTCCTGTATCGATCGCCTTGATTGGGGCTCCAACACTACTATCCTGGGATAGTTACCATGTCCGTTTACTCTTAGAAAACGGTTATGTTTCGAAAACATTGTCCTTGGGCTACAAGCAATTTGGCGGCCTTCTAGGCTAACGCCGTGTCCTGAGCGATTCAACCGTCATTTTCAGAGCTCAGGATACATTGCTGACGACCCTCATCCAACATGTAGTGCAGTTCTAGGTATGTCGCGTAAGGCTATGAGGCTTAGGGCAAAGAATGTTAATCCTATAACATCGGTTAGGTTTCATAAGCCACTGAGACGTTGTGGTGTCATAGTTCTGATGTACCCCCATTTGTCGGTCAATCAAAGTGTGAGTCTATAAATATCCCCGTATTTCACCTTATTGGATTTATGGGTCTAACCGATTTGAGCGCGATAGTCCGTGCGAATGAGTGACGTGTGGCGTCTTGTCGGGGGAGCACAATGCGTCAGATTGCGTTTAAATCATGAATCGTCGGGTATCACCACTTCGCCGTCATTCTTTATATGTATCATTAGGAGATATGTTGGTGACCACAGAGTACTCCGCATTCTGTGCGACATTATTATCAGCGTTAAGCCGGGTTTTGTTCGTCGACTTCCT 0 GTTGCCCGGG--CCTTC-GGCCCGT-AAAGCA-CGT-TGTT-CTCCATGCC-T--GCTGTC-G-ATA---GGTGGATGG-ATA-TTACATCTC-CGGCTGGTATTCGCTTCT-CTTCCTG--TAT-CGATCGCCTTGATTGGGGCTCCAACACTACTATCCTGGGATAGTTACCA-TGTCCGTTTACTCTTAGAAAACG-GTTATGTTTCGAAA-A-CA-TT-GTCCTTGGGC-TACAAGCAATTTG-GCGGCCTTCTAGGCTAACG-CCGTGTCCTGAGCGATTCAACCGTCATTT-TCAGAGC-TCAGGATACATTGCTGACGACCCTCATCCAACATGTAGTGCAGTTCTAGGTATGTC-GCGTAAGGCTATGAGGCTTAGG-GCAAAGAA-TGTT-AATC-CTATAACATCGG-TTAGGTT--T-C-A-TAAGCCAC-T-GAGACGT-T-GTG-GTGTCATAGTT-CTG-ATGTA-CCCCCATTTGTC-GG--TCAATCA-AAGTGTGAG-TCTATAAATATCCCCGTATTT-CA--CCTTATTGGATTTAT-GGGT-CTAACC-G-ATTTGAGCGCGATAGTCCGTGCGAATGAG-T-GAC-GTGTGGCGTC-TTGTCGGGGGAGC-ACAATGCGTCAGATTGCGTTTAAATCA-TGA-AT-CGTCGGGTATCACCACTTCGCCGTCAT-TCTTTATAT-GTATC-ATTAGGAGATATGTTGGTGACCACAGA--GT-ACTCCGC--ATTCTGTGCGA--CATTATTATCAGCGTTAAGCCGG-GTTTT-GTTCGTCG-A-CTTCCT 725 |||||||||| ||||| ||||||| |||||| ||| |||| || |||||| | ||| || | ||| ||||||||| ||| ||||| ||| ||||||||||||||| || ||||||| ||| ||||| ||||||| ||||| |||| |||| ||||| ||| |||||| || |||||||| || ||| ||||||| |||| ||||||||| | || || |||||||||| | ||||||||||| ||||||||| | | |||| ||||||||| ||||||| |||||| |||| ||||||| |||||| ||||||||||| |||| ||||||||||||||||||| |||||||| | ||| |||| ||||||||||||| |||||||| |||| || | |||||||||||| ||||||| | | | |||||||| | ||||||| | ||| ||||| || || ||| ||||| |||||||||||| || ||||||| ||||||||| ||||||||||||||||||||| || | | |||||| |||| ||| | |||| | |||| |||||||||||||||||||||||| | ||| |||||||||| ||||||| ||| | ||||||||||||||||||| |||||| ||| || ||||||| ||||||||||||||||||| |||||| || ||||| | | |||||||||||||| ||| |||| || ||||||| ||||| || || ||||||||||||||||||||||| ||||| | |||||| | ||||| 0 GTTGCCCGGGACCCTTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTTCCGCT-TCGGAATAGCTGGTGGATGGCATACTTACA-CTCACGGCTGGTATTCGCTACTACTTCCTGCATATCCGATCCCCTTGATGGGGGCACCAATACTATTATCCGGGGGTAGTTATCACTGTCCGTTAACCCTT-GAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGT-CAAGCAATTTGTGCGGCCTTC-AAAC-AACGACCGTGTCCT-AGCGATT-AACCGT-ATTTGTCAGAGCGGCAGGAT-TATTGCTGACGA-CCTC-TCCAACATGTAGTGCAGTTGTAGGTATGGCGGCG-AAGGTTATGAGGCTTAGGTGCAAAGAATTGTTAAAACTCTATAACATCGGTTTAGGTTGGTACGAGTAAGCCACTTCGAGACGTGTGGTGAGTGTC-TA-TTGCTGAATGTAGCCCCCATTTGTCTGGTCTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACATTCATAATTGGAATTATACGGTACAAACCGGTATTT-AGCGCGATAGTCCGTGCGAATGAGATGGACAGTGTGGCGTCTTTGTCGGCGGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCATATCTTTAGATGGTATCGA-T-GGAGATATGTTGGTAACC-CAGAGGGTAACTCCGCGAATTCTTTGGGACGCATTATTATCAGCGTTAAGCCGGTGTTTTGGCTCGTCGCAGCTTCCC 792 [I10:A,S10:A->C,D13:C,I53:C,D54:C,I60:G,S61:G->A,D62:A,I66:G,I66:C,I66:T,D67:C,D68:T,D69:G,D88:C,D89:T,S91:A->T,I93:A,I93:C,I118:C,S118:C->A,D119:A,I123:C,D124:C,D159:G,I164:G,D253:A,I256:A,I296:G,D297:G,D316:C,I318:C,I350:G,D351:G,I381:T,D382:T,I404:T,D406:T,I412:G,D413:G,I440:G,D441:G,I480:T,I480:C,D481:C,D482:T,I524:T,S525:T->C,S526:C->A,D527:A,D536:A,S537:T->A,D539:A,S542:C->T,I543:A,I543:C,I586:G,D587:G,I601:T,D602:T,I607:G,S608:G->C,D609:C,D677:T,D678:A,I680:A,I680:T,I688:G,D689:G,I694:G,S694:G->A,S695:A->T,D696:T,I719:G,D721:G,I723:A,D724:A,I731:G,S731:G->A,D733:A,D738:T,D739:T,S740:G->T,S741:G->T,D743:A,S744:C->G,I746:A,I746:C,I746:G,I775:G,S776:G->C,D777:C] 0 GTTGCCCGGG-ACCCTTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTT-CCGCTTC-GGAATA---GCTGGTGGATGGCATACTTACACTCAC--GGCTGGTATTCGCTACTACTTCCTG-CATAT-CCGATCCCCTTGATGGGGGCACCAATACTATTATCCGGGGG-TAGTTATCACTGTCCGTTAACCCTTGAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGTCAAGCAATTTGTGCGGCCTTCAAA-CAACGACCGTGTCCTAGCGATTAACCGTATTTGTCAGAGC-GGCAGGATTATTGCTGACGACC-TCTCCAACATGTAGTGCAGTTGTAGGTATGGC-GGCGAAGGTTATGAGGCTTAGGTGCAAAGAA-TTGTTAAAACTCTATAACATCGG-TTTAGGTT-GGTACGAGTAAGCCACTTCGAGACGTGT-GGTGAGTGTCTATTGCTGAATGTAGCCCCCATTTGTCTGG--TCTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACA-TTCATAATTGGAATTATAC--GGTACAAACCGGTATTTAGCGCGATAGTCCGTGCGAATGAGAT-GGACAGTGTGGCGTC-TTTGTC-GGCGGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCATAT--CTTTAGAT-GGTATC-GATGGAGATATGTTGGTAACCCAGA-GGGT-AACTCCGC-GAATTCTTTGGGACG---CATTATTATCAGCGTTAAGCCGGTGTTTT-GGCTCGTCGCAGCTTCCC 792 |||||||||| || ||||||||||||||||||||||||||||||||||||||| | ||||| | ||| | |||||||||||||||||| | | ||||||||||||||||||||||||| ||| | |||||||||||||||||||||||||||||||||| |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||| | |||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||| | ||||||||||||||||||||| || ||||| | |||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||| | |||||||| | || ||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||| | |||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||| | |||| |||||||||||||||||||||| || | | |||||| | |||| | | ||||||||||||||||||||||||||||| | ||||||||||||||| 0 GTTGCCCGGGACCC-TTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTTCC-GCTTCGGA-ATAGCTG---GTGGATGGCATACTTACA--CTCACGGCTGGTATTCGCTACTACTTCCTGCA-TATCC-GATCCCCTTGATGGGGGCACCAATACTATTATCC-GGGGGTAGTTATCACTGTCCGTTAACCCTTGAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGTCAAGCAATTTGTGCGGCCTTC-AAACAACGACCGTGTCCTAGCGATTAACCGTATTTGTCAGAGCGG-CAGGATTATTGCTGACGA-CCTCTCCAACATGTAGTGCAGTTGTAGGTATGGCGG-CGAAGGTTATGAGGCTTAGGTGCAAAGAATT-GTTAAAACTCTATAACATCGGTTT-AGGTTGG-TACGAGTAAGCCACTTCGAGACGTGTGG-TGAGTGTCTATTGCTGAATGTAGCCCCCATTTGTCTGGTCT--CAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACATTCA-TAATTGGA-AT-TATACGGTACAAACCGGTATTTAGCGCGATAGTCCGTGCGAATGAGATGG-ACAGTGTGGCGTCTT-TGTCGGC-GGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCA--TATCTTTAGATGG-TATCGAT-GGAGATATGTTGGTAACCCAGAGGG-TAA-CTCCGCGAA-TTCT--TTG-GGACGCATTATTATCAGCGTTAAGCCGGTGTTTTGGC-TCGTCGCAGCTTCCC 792 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 8.39us 7.51us 5.08us com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4967 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED Gradle is still running, please be patient... com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 8.20ms Processed queries: 7 Bad percent: 0.0 False positive percent: 0.5809128630705395 Scoring error percent: 0.0 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1665 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 114 -> T 82 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1206 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 265 noHits2: 0 noHits3: 0 wrongTopHit: 42 wrongTopHitS: 28 noCorrectHitInList: 20 Timings: DescriptiveStatistics: n: 100000 min: 12738.0 max: 1.341385159E9 mean: 501236.4706300188 std dev: 8481027.150666695 median: 206341.0 skewness: 115.55915758613185 kurtosis: 15143.729588782413 Clusters basicSize DescriptiveStatistics: n: 99693 min: 1.0 max: 6.0 mean: 2.8441314836548326 std dev: 1.096179981455982 median: 3.0 skewness: 0.3137727099557269 kurtosis: -0.6560879927001659 Top Delta DescriptiveStatistics: n: 99715 min: -19.0 max: 0.0 mean: -0.0012134583563152288 std dev: 0.14115777944866573 median: 0.0 skewness: -122.07259593272437 kurtosis: 15358.139874738128 com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1703 rTrimmed = 1706 lTrimmed = 2814 rTrimmed = 2780 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 3.20ms C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 2.51ms C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 798.83us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 1.25ms com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=2998;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 4.80ms C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 5.33ms C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 2.88ms C=2994;I=0;M=2;ScE=0;R=8.333333333333333E-7 AlignmentTime = 912.38us com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 1.63us Addition to hash set (per operation): 7.17us Hash set removal (per operation): 3.71us b com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_3c46d72f844cb302cdfe10b50e73b42b3c0a14033509164381156177478 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_66a965c9c66418719d0e16c0c9d99eae88bbc0565404239152299951793.tmp com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 991.45ms Sorting: 481.21ms 1 217 41478 99537 99999 com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_11459a7f8ed93ef6867a583beecd816823a61f5f16032856083478984307 timeInCollate: 44.52s timeInCollatorInit: 29.91s timeAwaitingO: 34.1ms timeAwaitingI: 7.76s timeInFinalSorting1: 0ns timeInFinalSorting2: 133.08ms timeInFinalSorting3: 276.48ms /8S (5|27|32): objs=50000 size=3.18MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_8374c26a3e38966571b4d576a63e106712c27b2412905336616831267225 Gradle is still running, please be patient... timeInCollate: 2.15m timeInCollatorInit: 6.14s timeAwaitingO: 13.42s timeAwaitingI: 30.88s timeInFinalSorting1: 15.24s timeInFinalSorting2: 14.7s timeInFinalSorting3: 3.84s /0N (5|27|32): objs=156403 size=9.15MiB /1N (5|27|32): objs=151939 size=8.39MiB /2N (5|27|32): objs=161804 size=9.23MiB /3N (5|27|32): objs=150232 size=8.41MiB /4N (5|27|32): objs=143722 size=7.86MiB /5N (5|27|32): objs=149708 size=8.36MiB /6N (5|27|32): objs=154969 size=8.7MiB /7N (5|27|32): objs=151091 size=8.61MiB /8N (5|27|32): objs=151208 size=8.23MiB /9N (5|27|32): objs=158907 size=9.01MiB /10N (5|27|32): objs=164979 size=9.33MiB /11N (5|27|32): objs=161276 size=9.25MiB /12N (5|27|32): objs=161507 size=9.27MiB /13N (5|27|32): objs=160137 size=9.06MiB /14N (5|27|32): objs=156707 size=8.89MiB /15N (5|27|32): objs=162754 size=9.26MiB /16N (5|27|32): objs=152396 size=8.51MiB /17N (5|27|32): objs=159178 size=9.06MiB /18N (5|27|32): objs=151231 size=8.63MiB /19N (5|27|32): objs=158684 size=9.18MiB /20N (5|27|32): objs=163566 size=9.47MiB /21N (5|27|32): objs=167450 size=9.5MiB /22N (5|27|32): objs=163397 size=9.72MiB /23N (5|27|32): objs=144610 size=8.03MiB /24N (5|27|32): objs=148727 size=8.35MiB /25N (5|27|32): objs=155663 size=8.74MiB /26N (5|27|32): objs=154125 size=8.69MiB /27N (5|27|32): objs=156229 size=8.88MiB /28N (5|27|32): objs=154378 size=8.61MiB /29N (5|27|32): objs=156404 size=8.9MiB /30N (5|27|32): objs=164590 size=9.77MiB /31N (5|27|32): objs=152029 size=8.46MiB /0/0N (2|25|36): objs=42014 size=958.12KiB /0/1N (2|25|36): objs=39693 size=915.35KiB /0/2N (2|25|36): objs=23210 size=331.19KiB /0/3S (2|25|36): objs=151 size=185B /0/4N (2|25|36): objs=14681 size=93.91KiB /0/5N (2|25|36): objs=4549 size=21.98KiB /0/6S (2|25|36): objs=163 size=286B /0/7N (2|25|36): objs=1409 size=5.71KiB /0/8S (2|25|36): objs=157 size=277B /0/9S (2|25|36): objs=123 size=115B /0/10S (2|25|36): objs=136 size=297B /0/11N (2|25|36): objs=3531 size=16.08KiB /0/12S (2|25|36): objs=146 size=218B /0/13N (2|25|36): objs=2165 size=9.33KiB /0/14S (2|25|36): objs=155 size=258B /0/15N (2|25|36): objs=460 size=1.74KiB /0/16S (2|25|36): objs=138 size=152B /0/17N (2|25|36): objs=1656 size=7.05KiB /0/18S (2|25|36): objs=163 size=215B /0/19N (2|25|36): objs=2765 size=11.79KiB /0/20S (2|25|36): objs=151 size=281B /0/21N (2|25|36): objs=2871 size=12.57KiB /0/22S (2|25|36): objs=143 size=142B /0/23N (2|25|36): objs=298 size=908B /0/24S (2|25|36): objs=156 size=211B /0/25N (2|25|36): objs=299 size=727B /0/26S (2|25|36): objs=160 size=257B /0/27N (2|25|36): objs=1544 size=6.35KiB /0/28S (2|25|36): objs=150 size=86B /0/29N (2|25|36): objs=1406 size=5.66KiB /0/30S (2|25|36): objs=161 size=93B /0/31N (2|25|36): objs=3638 size=16.89KiB /0/32S (2|25|36): objs=148 size=119B /0/33N (2|25|36): objs=2853 size=12.39KiB /0/34S (2|25|36): objs=153 size=165B /0/35N (2|25|36): objs=4807 size=23.49KiB /1/0N (2|25|36): objs=35438 size=710.08KiB /1/1N (2|25|36): objs=41103 size=918.37KiB /1/2N (2|25|36): objs=39208 size=799.4KiB /1/3N (2|25|36): objs=4757 size=21.8KiB /1/4S (2|25|36): objs=178 size=106B /1/5N (2|25|36): objs=760 size=3.12KiB /1/6S (2|25|36): objs=173 size=102B /1/7N (2|25|36): objs=841 size=3.25KiB /1/8S (2|25|36): objs=175 size=196B /1/9N (2|25|36): objs=1092 size=4.27KiB /1/10S (2|25|36): objs=140 size=136B /1/11N (2|25|36): objs=3042 size=13.27KiB /1/12S (2|25|36): objs=149 size=224B /1/13N (2|25|36): objs=5486 size=25.08KiB /1/14S (2|25|36): objs=166 size=163B /1/15N (2|25|36): objs=750 size=2.69KiB /1/16S (2|25|36): objs=169 size=167B /1/17N (2|25|36): objs=3538 size=15.95KiB /1/18S (2|25|36): objs=153 size=271B /1/19N (2|25|36): objs=299 size=922B /1/20S (2|25|36): objs=162 size=204B /1/21N (2|25|36): objs=1541 size=5.96KiB /1/22S (2|25|36): objs=160 size=275B /1/23N (2|25|36): objs=478 size=1.66KiB /1/24S (2|25|36): objs=155 size=205B /1/25N (2|25|36): objs=904 size=3.49KiB /1/26S (2|25|36): objs=144 size=219B /1/27N (2|25|36): objs=2842 size=13.45KiB /1/28S (2|25|36): objs=150 size=202B /1/29N (2|25|36): objs=1083 size=4.01KiB /1/30S (2|25|36): objs=153 size=209B /1/31N (2|25|36): objs=3523 size=15.84KiB /1/32S (2|25|36): objs=160 size=181B /1/33N (2|25|36): objs=2430 size=10.02KiB /1/34S (2|25|36): objs=167 size=249B /1/35N (2|25|36): objs=270 size=963B /2/0N (2|25|36): objs=41481 size=926.49KiB /2/1N (2|25|36): objs=42474 size=1.05MiB /2/2N (2|25|36): objs=39022 size=798.16KiB /2/3N (2|25|36): objs=17394 size=193.35KiB /2/4S (2|25|36): objs=149 size=214B /2/5S (2|25|36): objs=149 size=129B /2/6S (2|25|36): objs=166 size=230B /2/7N (2|25|36): objs=649 size=2.26KiB /2/8S (2|25|36): objs=160 size=180B /2/9N (2|25|36): objs=1219 size=5.5KiB /2/10S (2|25|36): objs=168 size=198B /2/11N (2|25|36): objs=789 size=3.36KiB /2/12S (2|25|36): objs=144 size=323B /2/13N (2|25|36): objs=567 size=1.95KiB /2/14S (2|25|36): objs=169 size=104B /2/15S (2|25|36): objs=135 size=128B /2/16S (2|25|36): objs=154 size=206B /2/17N (2|25|36): objs=706 size=2.74KiB /2/18S (2|25|36): objs=155 size=312B /2/19N (2|25|36): objs=3559 size=16.79KiB /2/20S (2|25|36): objs=167 size=335B /2/21N (2|25|36): objs=3931 size=19.59KiB /2/22S (2|25|36): objs=180 size=127B /2/23N (2|25|36): objs=1041 size=4.16KiB /2/24S (2|25|36): objs=170 size=208B /2/25N (2|25|36): objs=651 size=2.26KiB /2/26S (2|25|36): objs=137 size=307B /2/27S (2|25|36): objs=141 size=175B /2/28S (2|25|36): objs=154 size=288B /2/29N (2|25|36): objs=1489 size=6.07KiB /2/30S (2|25|36): objs=153 size=217B /2/31N (2|25|36): objs=726 size=2.77KiB /2/32S (2|25|36): objs=155 size=318B /2/33S (2|25|36): objs=151 size=87B /2/34S (2|25|36): objs=119 size=261B /2/35N (2|25|36): objs=3030 size=12.73KiB /3/0N (2|25|36): objs=30406 size=405.93KiB /3/1S (2|25|36): objs=133 size=105B /3/2N (2|25|36): objs=8084 size=40.27KiB /3/3N (2|25|36): objs=41005 size=831.81KiB /3/4N (2|25|36): objs=30845 size=550.25KiB /3/5S (2|25|36): objs=167 size=276B /3/6N (2|25|36): objs=3874 size=17.98KiB /3/7N (2|25|36): objs=14244 size=101.83KiB /3/8S (2|25|36): objs=154 size=323B /3/9N (2|25|36): objs=3670 size=15.89KiB /3/10S (2|25|36): objs=155 size=271B /3/11N (2|25|36): objs=325 size=924B /3/12S (2|25|36): objs=162 size=99B /3/14S (2|25|36): objs=178 size=303B /3/15N (2|25|36): objs=1350 size=5.65KiB /3/16S (2|25|36): objs=168 size=144B /3/17N (2|25|36): objs=1750 size=7.43KiB /3/18S (2|25|36): objs=147 size=279B /3/19N (2|25|36): objs=782 size=2.88KiB /3/20S (2|25|36): objs=147 size=209B /3/21N (2|25|36): objs=3883 size=17.92KiB /3/22S (2|25|36): objs=179 size=318B /3/24S (2|25|36): objs=147 size=330B /3/25N (2|25|36): objs=468 size=1.58KiB /3/26S (2|25|36): objs=167 size=303B /3/27N (2|25|36): objs=2449 size=10.14KiB /3/28S (2|25|36): objs=161 size=245B /3/29N (2|25|36): objs=922 size=3.81KiB /3/30S (2|25|36): objs=129 size=163B /3/31N (2|25|36): objs=322 size=1022B /3/32S (2|25|36): objs=151 size=112B /3/33N (2|25|36): objs=335 size=945B /3/34S (2|25|36): objs=141 size=336B /3/35N (2|25|36): objs=3032 size=13.01KiB /4/0N (1|26|34): objs=72867 size=2.62MiB /4/1N (1|26|34): objs=43686 size=1002.53KiB /4/2S (1|26|34): objs=150 size=190B /4/3N (1|26|34): objs=316 size=979B /4/4S (1|26|34): objs=154 size=127B /4/5N (1|26|34): objs=2749 size=11.54KiB /4/6S (1|26|34): objs=163 size=267B /4/7N (1|26|34): objs=1527 size=6.58KiB /4/8S (1|26|34): objs=152 size=131B /4/9N (1|26|34): objs=1531 size=6.48KiB /4/10S (1|26|34): objs=168 size=203B /4/11N (1|26|34): objs=284 size=807B /4/12S (1|26|34): objs=127 size=245B /4/13N (1|26|34): objs=1136 size=4.41KiB /4/14S (1|26|34): objs=158 size=303B /4/15N (1|26|34): objs=2774 size=13.14KiB /4/16S (1|26|34): objs=160 size=136B /4/17N (1|26|34): objs=3244 size=15.44KiB /4/18S (1|26|34): objs=153 size=235B /4/19N (1|26|34): objs=1825 size=7.64KiB /4/20S (1|26|34): objs=149 size=262B /4/22S (1|26|34): objs=145 size=294B /4/23N (1|26|34): objs=2311 size=10.3KiB /4/24S (1|26|34): objs=131 size=97B /4/25N (1|26|34): objs=1060 size=4.21KiB /4/26S (1|26|34): objs=156 size=150B /4/27N (1|26|34): objs=1621 size=6.87KiB /4/28S (1|26|34): objs=141 size=291B /4/29N (1|26|34): objs=2606 size=11.73KiB /4/30S (1|26|34): objs=136 size=198B /4/31N (1|26|34): objs=445 size=1.53KiB /4/32S (1|26|34): objs=162 size=243B /4/33N (1|26|34): objs=1335 size=5.56KiB /4/0/0N (1|25|34): objs=34766 size=620.16KiB /4/0/1N (1|25|34): objs=8673 size=41.74KiB /4/0/2S (1|25|34): objs=139 size=131B /4/0/3N (1|25|34): objs=1222 size=5.19KiB /4/0/4S (1|25|34): objs=159 size=174B /4/0/5N (1|25|34): objs=7356 size=35.28KiB /4/0/6S (1|25|34): objs=150 size=315B /4/0/7N (1|25|34): objs=3381 size=14.53KiB /4/0/8S (1|25|34): objs=154 size=279B /4/0/9N (1|25|34): objs=471 size=1.46KiB /4/0/10S (1|25|34): objs=147 size=88B /4/0/11N (1|25|34): objs=1866 size=7.71KiB /4/0/12S (1|25|34): objs=145 size=243B /4/0/13N (1|25|34): objs=2844 size=12.1KiB /4/0/14S (1|25|34): objs=148 size=277B /4/0/15N (1|25|34): objs=1204 size=4.9KiB /4/0/16S (1|25|34): objs=145 size=271B /4/0/18S (1|25|34): objs=170 size=321B /4/0/19N (1|25|34): objs=468 size=1.65KiB /4/0/20S (1|25|34): objs=150 size=320B /4/0/21S (1|25|34): objs=170 size=254B /4/0/22S (1|25|34): objs=145 size=153B /4/0/23N (1|25|34): objs=780 size=3.28KiB /4/0/24S (1|25|34): objs=147 size=132B /4/0/25N (1|25|34): objs=3905 size=17.58KiB /4/0/26S (1|25|34): objs=147 size=86B /4/0/27N (1|25|34): objs=738 size=2.74KiB /4/0/28S (1|25|34): objs=158 size=312B /4/0/29N (1|25|34): objs=432 size=1.52KiB /4/0/30S (1|25|34): objs=157 size=194B /4/0/32S (1|25|34): objs=146 size=246B /4/0/33N (1|25|34): objs=2184 size=9.05KiB /5/0N (2|25|36): objs=35844 size=599.32KiB /5/1N (2|25|36): objs=16044 size=108.34KiB /5/2S (2|25|36): objs=157 size=124B /5/3N (2|25|36): objs=23099 size=199.22KiB /5/4N (2|25|36): objs=38723 size=949.94KiB /5/5N (2|25|36): objs=9771 size=55.36KiB /5/6S (2|25|36): objs=179 size=230B /5/7N (2|25|36): objs=1507 size=6.21KiB /5/8S (2|25|36): objs=133 size=104B /5/9S (2|25|36): objs=191 size=190B /5/10S (2|25|36): objs=141 size=320B /5/11N (2|25|36): objs=297 size=715B /5/12S (2|25|36): objs=142 size=153B /5/14S (2|25|36): objs=155 size=268B /5/15N (2|25|36): objs=1436 size=5.99KiB /5/16S (2|25|36): objs=151 size=340B /5/17N (2|25|36): objs=6744 size=34.33KiB /5/18S (2|25|36): objs=142 size=87B /5/19N (2|25|36): objs=4162 size=18.75KiB /5/20S (2|25|36): objs=146 size=209B /5/21N (2|25|36): objs=1347 size=5.5KiB /5/22S (2|25|36): objs=135 size=307B /5/23N (2|25|36): objs=852 size=3.62KiB /5/24S (2|25|36): objs=151 size=206B /5/25N (2|25|36): objs=2298 size=9.98KiB /5/26S (2|25|36): objs=164 size=213B /5/27N (2|25|36): objs=452 size=1.66KiB /5/28S (2|25|36): objs=142 size=241B /5/29N (2|25|36): objs=1253 size=5.1KiB /5/30S (2|25|36): objs=154 size=120B /5/32S (2|25|36): objs=151 size=284B /5/33N (2|25|36): objs=2697 size=11.61KiB /5/34S (2|25|36): objs=147 size=117B /5/35N (2|25|36): objs=601 size=2.17KiB /6/0N (2|25|36): objs=37311 size=651KiB /6/1N (2|25|36): objs=37698 size=784.54KiB /6/2N (2|25|36): objs=42418 size=1.12MiB /6/3N (2|25|36): objs=8287 size=39.05KiB /6/4S (2|25|36): objs=165 size=103B /6/5N (2|25|36): objs=1805 size=7.37KiB /6/6S (2|25|36): objs=143 size=324B /6/7N (2|25|36): objs=466 size=1.49KiB /6/8S (2|25|36): objs=155 size=105B /6/9N (2|25|36): objs=492 size=1.83KiB /6/10S (2|25|36): objs=158 size=220B /6/11N (2|25|36): objs=4958 size=22.53KiB /6/12S (2|25|36): objs=143 size=173B /6/13N (2|25|36): objs=1676 size=6.87KiB /6/14S (2|25|36): objs=164 size=341B /6/15N (2|25|36): objs=1824 size=7.68KiB /6/16S (2|25|36): objs=150 size=286B /6/17N (2|25|36): objs=3504 size=15.8KiB /6/18S (2|25|36): objs=161 size=172B /6/19S (2|25|36): objs=167 size=341B /6/20S (2|25|36): objs=153 size=196B /6/21N (2|25|36): objs=3301 size=15.14KiB /6/22S (2|25|36): objs=178 size=296B /6/23N (2|25|36): objs=567 size=2.19KiB /6/24S (2|25|36): objs=156 size=160B /6/25N (2|25|36): objs=485 size=1.6KiB /6/26S (2|25|36): objs=135 size=173B /6/27N (2|25|36): objs=3222 size=13.8KiB /6/28S (2|25|36): objs=171 size=212B /6/29N (2|25|36): objs=1448 size=5.82KiB /6/30S (2|25|36): objs=156 size=188B /6/31N (2|25|36): objs=924 size=3.5KiB /6/32S (2|25|36): objs=145 size=300B /6/34S (2|25|36): objs=131 size=178B /6/35N (2|25|36): objs=1952 size=8.09KiB /7/0N (2|25|36): objs=36593 size=759.49KiB /7/1N (2|25|36): objs=38322 size=878.67KiB /7/2N (2|25|36): objs=37182 size=775.89KiB /7/3N (2|25|36): objs=7511 size=42KiB /7/4S (2|25|36): objs=144 size=277B /7/5N (2|25|36): objs=2860 size=12.26KiB /7/6S (2|25|36): objs=163 size=319B /7/7N (2|25|36): objs=1670 size=6.67KiB /7/8S (2|25|36): objs=145 size=211B /7/9N (2|25|36): objs=2239 size=10.03KiB /7/10S (2|25|36): objs=160 size=341B /7/11N (2|25|36): objs=748 size=2.84KiB /7/12S (2|25|36): objs=152 size=211B /7/13N (2|25|36): objs=292 size=805B /7/14S (2|25|36): objs=145 size=181B /7/15N (2|25|36): objs=3195 size=14.15KiB /7/16S (2|25|36): objs=140 size=105B /7/17N (2|25|36): objs=1042 size=4.29KiB /7/18S (2|25|36): objs=173 size=307B /7/19N (2|25|36): objs=1120 size=4.55KiB /7/20S (2|25|36): objs=133 size=252B /7/21N (2|25|36): objs=1221 size=4.86KiB /7/22S (2|25|36): objs=168 size=140B /7/23N (2|25|36): objs=442 size=1.68KiB /7/24S (2|25|36): objs=147 size=181B /7/25N (2|25|36): objs=5047 size=21.54KiB /7/26S (2|25|36): objs=166 size=196B /7/28S (2|25|36): objs=163 size=100B /7/29N (2|25|36): objs=6848 size=36.07KiB /7/30S (2|25|36): objs=166 size=327B /7/31N (2|25|36): objs=313 size=1.04KiB /7/32S (2|25|36): objs=163 size=138B /7/33S (2|25|36): objs=161 size=162B /7/34S (2|25|36): objs=150 size=190B /7/35N (2|25|36): objs=1807 size=7.8KiB /8/0N (2|25|36): objs=38666 size=782.12KiB /8/1N (2|25|36): objs=35406 size=688.09KiB /8/2N (2|25|36): objs=31638 size=493.42KiB /8/3S (2|25|36): objs=147 size=98B /8/4N (2|25|36): objs=2301 size=9.81KiB /8/5S (2|25|36): objs=171 size=210B /8/6N (2|25|36): objs=3346 size=15.38KiB /8/7N (2|25|36): objs=9857 size=51.92KiB /8/8S (2|25|36): objs=181 size=357B /8/9N (2|25|36): objs=444 size=1.47KiB /8/10S (2|25|36): objs=164 size=122B /8/11N (2|25|36): objs=1573 size=6.54KiB /8/12S (2|25|36): objs=158 size=98B /8/13N (2|25|36): objs=572 size=2.36KiB /8/14S (2|25|36): objs=163 size=91B /8/15N (2|25|36): objs=1527 size=6.4KiB /8/16S (2|25|36): objs=148 size=156B /8/17N (2|25|36): objs=479 size=1.53KiB /8/18S (2|25|36): objs=150 size=298B /8/19N (2|25|36): objs=1385 size=5.66KiB /8/20S (2|25|36): objs=164 size=282B /8/21N (2|25|36): objs=1410 size=5.77KiB /8/22S (2|25|36): objs=142 size=85B /8/23N (2|25|36): objs=5296 size=24.38KiB /8/24S (2|25|36): objs=142 size=234B /8/26S (2|25|36): objs=146 size=159B /8/27N (2|25|36): objs=4282 size=19.77KiB /8/28S (2|25|36): objs=155 size=254B /8/29N (2|25|36): objs=313 size=795B /8/30S (2|25|36): objs=149 size=254B /8/31N (2|25|36): objs=3011 size=13.37KiB /8/32S (2|25|36): objs=141 size=172B /8/33N (2|25|36): objs=3025 size=14.18KiB /8/34S (2|25|36): objs=148 size=171B /8/35N (2|25|36): objs=4208 size=18.13KiB /9/0N (2|25|36): objs=43115 size=978.71KiB /9/1N (2|25|36): objs=33779 size=611.24KiB /9/2N (2|25|36): objs=44999 size=1.14MiB /9/3N (2|25|36): objs=17722 size=174.28KiB /9/4S (2|25|36): objs=163 size=234B /9/5N (2|25|36): objs=1210 size=4.86KiB /9/6S (2|25|36): objs=150 size=279B /9/7N (2|25|36): objs=583 size=2.12KiB /9/8S (2|25|36): objs=151 size=179B /9/9N (2|25|36): objs=1236 size=5.2KiB /9/10S (2|25|36): objs=174 size=204B /9/11N (2|25|36): objs=449 size=1.58KiB /9/12S (2|25|36): objs=145 size=158B /9/13N (2|25|36): objs=879 size=3.39KiB /9/14S (2|25|36): objs=143 size=147B /9/15N (2|25|36): objs=1146 size=4.61KiB /9/16S (2|25|36): objs=141 size=252B /9/17N (2|25|36): objs=489 size=1.64KiB /9/18S (2|25|36): objs=128 size=120B /9/19N (2|25|36): objs=1385 size=5.41KiB /9/20S (2|25|36): objs=154 size=106B /9/21N (2|25|36): objs=4873 size=23.14KiB /9/22S (2|25|36): objs=158 size=129B /9/23N (2|25|36): objs=1497 size=6.38KiB /9/24S (2|25|36): objs=148 size=273B /9/25N (2|25|36): objs=897 size=3.57KiB /9/26S (2|25|36): objs=170 size=297B /9/27N (2|25|36): objs=276 size=906B /9/28S (2|25|36): objs=166 size=94B /9/30S (2|25|36): objs=153 size=301B /9/31N (2|25|36): objs=309 size=941B /9/32S (2|25|36): objs=148 size=128B /9/33N (2|25|36): objs=1620 size=7KiB /9/34S (2|25|36): objs=151 size=102B /10/0N (2|25|36): objs=39459 size=905.39KiB /10/1N (2|25|36): objs=38655 size=852.01KiB /10/2N (2|25|36): objs=45605 size=1.09MiB /10/3N (2|25|36): objs=1677 size=7.14KiB /10/4S (2|25|36): objs=165 size=108B /10/5N (2|25|36): objs=499 size=1.64KiB /10/6S (2|25|36): objs=135 size=146B /10/7N (2|25|36): objs=6249 size=31.01KiB /10/8S (2|25|36): objs=148 size=311B /10/9N (2|25|36): objs=1820 size=7.45KiB /10/10S (2|25|36): objs=150 size=305B /10/11N (2|25|36): objs=4174 size=18.45KiB /10/12S (2|25|36): objs=138 size=156B /10/13N (2|25|36): objs=8343 size=40.98KiB /10/14S (2|25|36): objs=152 size=171B /10/15N (2|25|36): objs=1615 size=6.65KiB /10/16S (2|25|36): objs=158 size=234B /10/17N (2|25|36): objs=1073 size=4.23KiB /10/18S (2|25|36): objs=154 size=255B /10/19N (2|25|36): objs=1610 size=6.84KiB /10/20S (2|25|36): objs=180 size=147B /10/21N (2|25|36): objs=1917 size=8.28KiB /10/22S (2|25|36): objs=156 size=123B /10/23N (2|25|36): objs=1351 size=5.7KiB /10/24S (2|25|36): objs=176 size=283B /10/25N (2|25|36): objs=324 size=969B /10/26S (2|25|36): objs=165 size=123B /10/27N (2|25|36): objs=1229 size=5.26KiB /10/28S (2|25|36): objs=133 size=280B /10/29N (2|25|36): objs=1390 size=5.55KiB /10/30S (2|25|36): objs=163 size=245B /10/31N (2|25|36): objs=932 size=3.46KiB /10/32S (2|25|36): objs=165 size=128B /10/33N (2|25|36): objs=4416 size=20.29KiB /10/34S (2|25|36): objs=156 size=284B /10/35S (2|25|36): objs=147 size=238B /11/0N (2|25|36): objs=40410 size=943.66KiB /11/1N (2|25|36): objs=13827 size=88.06KiB /11/2S (2|25|36): objs=147 size=251B /11/3N (2|25|36): objs=26404 size=364.81KiB /11/4N (2|25|36): objs=40746 size=920.25KiB /11/5N (2|25|36): objs=7209 size=33.33KiB /11/6S (2|25|36): objs=173 size=210B /11/7N (2|25|36): objs=1168 size=4.7KiB /11/8S (2|25|36): objs=150 size=170B /11/9N (2|25|36): objs=288 size=784B /11/10S (2|25|36): objs=156 size=136B /11/11N (2|25|36): objs=482 size=1.54KiB /11/12S (2|25|36): objs=155 size=328B /11/13S (2|25|36): objs=172 size=258B /11/14S (2|25|36): objs=151 size=289B /11/15N (2|25|36): objs=498 size=1.78KiB /11/16S (2|25|36): objs=171 size=185B /11/17N (2|25|36): objs=817 size=3.01KiB /11/18S (2|25|36): objs=147 size=328B /11/19N (2|25|36): objs=307 size=814B /11/20S (2|25|36): objs=155 size=230B /11/21N (2|25|36): objs=5397 size=26.31KiB /11/22S (2|25|36): objs=137 size=248B /11/24S (2|25|36): objs=157 size=122B /11/25N (2|25|36): objs=2814 size=11.85KiB /11/26S (2|25|36): objs=166 size=292B /11/27N (2|25|36): objs=3543 size=15.49KiB /11/28S (2|25|36): objs=149 size=180B /11/30S (2|25|36): objs=155 size=199B /11/31N (2|25|36): objs=12140 size=80.78KiB /11/32S (2|25|36): objs=135 size=237B /11/33N (2|25|36): objs=1099 size=4.7KiB /11/34S (2|25|36): objs=146 size=115B /11/35N (2|25|36): objs=1505 size=6.27KiB /12/0N (2|25|36): objs=44337 size=1.21MiB /12/1N (2|25|36): objs=42454 size=1.03MiB /12/2N (2|25|36): objs=37429 size=702.82KiB /12/3N (2|25|36): objs=4090 size=17.31KiB /12/4S (2|25|36): objs=156 size=182B /12/5N (2|25|36): objs=1330 size=5.1KiB /12/6S (2|25|36): objs=157 size=189B /12/7N (2|25|36): objs=6717 size=34.37KiB /12/8S (2|25|36): objs=164 size=99B /12/9N (2|25|36): objs=1064 size=4.13KiB /12/10S (2|25|36): objs=148 size=335B /12/11N (2|25|36): objs=883 size=3.49KiB /12/12S (2|25|36): objs=146 size=142B /12/13N (2|25|36): objs=2317 size=9.65KiB /12/14S (2|25|36): objs=178 size=169B /12/15N (2|25|36): objs=1205 size=4.69KiB /12/16S (2|25|36): objs=166 size=289B /12/17N (2|25|36): objs=488 size=1.73KiB /12/18S (2|25|36): objs=145 size=246B /12/19N (2|25|36): objs=2463 size=10.96KiB /12/20S (2|25|36): objs=153 size=228B /12/21N (2|25|36): objs=2076 size=8.79KiB /12/22S (2|25|36): objs=171 size=351B /12/23N (2|25|36): objs=3940 size=16.57KiB /12/24S (2|25|36): objs=153 size=187B /12/26S (2|25|36): objs=139 size=128B /12/27N (2|25|36): objs=287 size=799B /12/28S (2|25|36): objs=141 size=255B /12/29N (2|25|36): objs=1380 size=5.6KiB /12/30S (2|25|36): objs=146 size=124B /12/31N (2|25|36): objs=4011 size=17.88KiB /12/32S (2|25|36): objs=150 size=215B /12/33N (2|25|36): objs=2562 size=12.06KiB /12/34S (2|25|36): objs=161 size=186B /13/0N (2|25|36): objs=40653 size=919.73KiB /13/1N (2|25|36): objs=40527 size=873.4KiB /13/2N (2|25|36): objs=39550 size=1.05MiB /13/3N (2|25|36): objs=6590 size=30.26KiB /13/4S (2|25|36): objs=151 size=254B /13/5N (2|25|36): objs=1051 size=4.33KiB /13/6S (2|25|36): objs=147 size=119B /13/7N (2|25|36): objs=5312 size=25.55KiB /13/8S (2|25|36): objs=162 size=295B /13/9N (2|25|36): objs=3339 size=14.84KiB /13/10S (2|25|36): objs=156 size=271B /13/12S (2|25|36): objs=109 size=160B /13/13N (2|25|36): objs=587 size=2.29KiB /13/14S (2|25|36): objs=178 size=107B /13/15N (2|25|36): objs=3003 size=12.57KiB /13/16S (2|25|36): objs=151 size=132B /13/17N (2|25|36): objs=285 size=712B /13/18S (2|25|36): objs=141 size=122B /13/19N (2|25|36): objs=6258 size=30.55KiB /13/20S (2|25|36): objs=154 size=227B /13/21S (2|25|36): objs=147 size=293B /13/22S (2|25|36): objs=153 size=169B /13/23N (2|25|36): objs=1632 size=6.9KiB /13/24S (2|25|36): objs=140 size=296B /13/25N (2|25|36): objs=1344 size=5.36KiB /13/26S (2|25|36): objs=161 size=152B /13/27N (2|25|36): objs=900 size=3.47KiB /13/28S (2|25|36): objs=169 size=161B /13/29N (2|25|36): objs=1906 size=7.94KiB /13/30S (2|25|36): objs=152 size=168B /13/31N (2|25|36): objs=314 size=815B /13/32S (2|25|36): objs=149 size=107B /13/33N (2|25|36): objs=4035 size=17.2KiB /13/34S (2|25|36): objs=159 size=138B /13/35N (2|25|36): objs=272 size=673B /14/0N (2|25|36): objs=40745 size=935.77KiB /14/1N (2|25|36): objs=41649 size=1.04MiB /14/2N (2|25|36): objs=37158 size=737.84KiB /14/3N (2|25|36): objs=7993 size=36.32KiB /14/4S (2|25|36): objs=142 size=122B /14/5N (2|25|36): objs=319 size=924B /14/6S (2|25|36): objs=147 size=242B /14/7N (2|25|36): objs=5047 size=24.03KiB /14/8S (2|25|36): objs=146 size=180B /14/9N (2|25|36): objs=720 size=2.85KiB /14/10S (2|25|36): objs=151 size=205B /14/11N (2|25|36): objs=2504 size=10.65KiB /14/12S (2|25|36): objs=158 size=292B /14/13N (2|25|36): objs=307 size=1005B /14/14S (2|25|36): objs=164 size=117B /14/15S (2|25|36): objs=175 size=136B /14/16S (2|25|36): objs=165 size=314B /14/17N (2|25|36): objs=324 size=979B /14/18S (2|25|36): objs=148 size=285B /14/19S (2|25|36): objs=169 size=111B /14/20S (2|25|36): objs=141 size=131B /14/21N (2|25|36): objs=1646 size=6.99KiB /14/22S (2|25|36): objs=184 size=341B /14/23N (2|25|36): objs=3748 size=17.07KiB /14/24S (2|25|36): objs=128 size=235B /14/26S (2|25|36): objs=136 size=235B /14/27N (2|25|36): objs=791 size=2.88KiB /14/28S (2|25|36): objs=161 size=88B /14/29N (2|25|36): objs=2474 size=10.33KiB /14/30S (2|25|36): objs=134 size=92B /14/32S (2|25|36): objs=149 size=108B /14/33N (2|25|36): objs=2216 size=9.28KiB /14/34S (2|25|36): objs=130 size=181B /14/35N (2|25|36): objs=6338 size=30.59KiB /15/0N (2|25|36): objs=42598 size=985.31KiB /15/1N (2|25|36): objs=44595 size=1015.32KiB /15/2N (2|25|36): objs=36815 size=732.09KiB /15/3N (2|25|36): objs=1454 size=5.98KiB /15/4S (2|25|36): objs=156 size=85B /15/5N (2|25|36): objs=1054 size=4.18KiB /15/6S (2|25|36): objs=124 size=255B /15/7N (2|25|36): objs=886 size=3.38KiB /15/8S (2|25|36): objs=165 size=190B /15/9N (2|25|36): objs=294 size=810B /15/10S (2|25|36): objs=130 size=234B /15/11N (2|25|36): objs=458 size=1.46KiB /15/12S (2|25|36): objs=163 size=229B /15/13N (2|25|36): objs=462 size=1.48KiB /15/14S (2|25|36): objs=162 size=146B /15/15N (2|25|36): objs=7242 size=34.35KiB /15/16S (2|25|36): objs=158 size=106B /15/17N (2|25|36): objs=323 size=1003B /15/18S (2|25|36): objs=165 size=130B /15/19N (2|25|36): objs=6461 size=29.09KiB /15/20S (2|25|36): objs=160 size=313B /15/21N (2|25|36): objs=6159 size=26.87KiB /15/22S (2|25|36): objs=149 size=161B /15/23N (2|25|36): objs=2530 size=10.8KiB /15/24S (2|25|36): objs=170 size=256B /15/25N (2|25|36): objs=484 size=1.59KiB /15/26S (2|25|36): objs=142 size=155B /15/27N (2|25|36): objs=4809 size=23.13KiB /15/28S (2|25|36): objs=174 size=124B /15/29N (2|25|36): objs=463 size=1.47KiB /15/30S (2|25|36): objs=156 size=303B /15/31N (2|25|36): objs=910 size=3.71KiB /15/32S (2|25|36): objs=137 size=266B /15/33N (2|25|36): objs=1182 size=4.87KiB /15/34S (2|25|36): objs=165 size=231B /15/35N (2|25|36): objs=1099 size=4.46KiB /16/0N (2|25|36): objs=34582 size=667.92KiB /16/1N (2|25|36): objs=40948 size=1016.06KiB /16/2N (2|25|36): objs=18947 size=164.35KiB /16/3S (2|25|36): objs=141 size=286B /16/4N (2|25|36): objs=13518 size=75.76KiB /16/5S (2|25|36): objs=153 size=310B /16/6N (2|25|36): objs=5381 size=27.99KiB /16/7S (2|25|36): objs=167 size=137B /16/8N (2|25|36): objs=1900 size=7.77KiB /16/9S (2|25|36): objs=145 size=206B /16/10N (2|25|36): objs=727 size=2.65KiB /16/11N (2|25|36): objs=482 size=1.67KiB /16/12S (2|25|36): objs=143 size=207B /16/13N (2|25|36): objs=2447 size=10.81KiB /16/14S (2|25|36): objs=163 size=216B /16/15N (2|25|36): objs=1236 size=5.06KiB /16/16S (2|25|36): objs=146 size=316B /16/17S (2|25|36): objs=152 size=195B /16/18S (2|25|36): objs=155 size=108B /16/19N (2|25|36): objs=4254 size=18.28KiB /16/20S (2|25|36): objs=148 size=299B /16/21N (2|25|36): objs=2122 size=8.91KiB /16/22S (2|25|36): objs=153 size=250B /16/24S (2|25|36): objs=149 size=207B /16/25N (2|25|36): objs=2230 size=10.03KiB /16/26S (2|25|36): objs=148 size=304B /16/27N (2|25|36): objs=3115 size=13.54KiB /16/28S (2|25|36): objs=150 size=308B /16/29N (2|25|36): objs=3940 size=18.28KiB /16/30S (2|25|36): objs=165 size=213B /16/31N (2|25|36): objs=6374 size=33.47KiB /16/32S (2|25|36): objs=149 size=228B /16/33N (2|25|36): objs=2274 size=9.81KiB /16/34S (2|25|36): objs=151 size=136B /16/35N (2|25|36): objs=5341 size=24.17KiB /17/0N (2|25|36): objs=41235 size=958.16KiB /17/1N (2|25|36): objs=39477 size=847.84KiB /17/2N (2|25|36): objs=32936 size=545.51KiB /17/3S (2|25|36): objs=153 size=182B /17/4N (2|25|36): objs=3205 size=14.67KiB /17/5S (2|25|36): objs=137 size=192B /17/6N (2|25|36): objs=2309 size=9.89KiB /17/7S (2|25|36): objs=145 size=184B /17/8N (2|25|36): objs=3497 size=14.63KiB /17/9N (2|25|36): objs=1178 size=4.73KiB /17/10S (2|25|36): objs=138 size=188B /17/11N (2|25|36): objs=4709 size=21.3KiB /17/12S (2|25|36): objs=152 size=338B /17/13N (2|25|36): objs=1242 size=4.76KiB /17/14S (2|25|36): objs=142 size=284B /17/15N (2|25|36): objs=458 size=1.62KiB /17/16S (2|25|36): objs=145 size=117B /17/17N (2|25|36): objs=2867 size=12.98KiB /17/18S (2|25|36): objs=191 size=329B /17/19N (2|25|36): objs=1832 size=7.54KiB /17/20S (2|25|36): objs=162 size=267B /17/21N (2|25|36): objs=3121 size=13.69KiB /17/22S (2|25|36): objs=137 size=265B /17/23N (2|25|36): objs=1596 size=6.78KiB /17/24S (2|25|36): objs=140 size=269B /17/25N (2|25|36): objs=306 size=855B /17/26S (2|25|36): objs=173 size=301B /17/27N (2|25|36): objs=887 size=3.7KiB /17/28S (2|25|36): objs=162 size=236B /17/29N (2|25|36): objs=4357 size=18.84KiB /17/30S (2|25|36): objs=131 size=140B /17/31S (2|25|36): objs=167 size=324B /17/32S (2|25|36): objs=160 size=177B /17/33N (2|25|36): objs=9118 size=48.26KiB /17/34S (2|25|36): objs=141 size=110B /17/35N (2|25|36): objs=2272 size=9.81KiB /18/0N (2|25|36): objs=39207 size=817.58KiB /18/1N (2|25|36): objs=36909 size=756.6KiB /18/2N (2|25|36): objs=28814 size=376.76KiB /18/3S (2|25|36): objs=123 size=197B /18/4N (2|25|36): objs=9400 size=46.4KiB /18/5N (2|25|36): objs=15133 size=109.66KiB /18/6S (2|25|36): objs=154 size=230B /18/7N (2|25|36): objs=1830 size=7.65KiB /18/8S (2|25|36): objs=146 size=99B /18/9N (2|25|36): objs=285 size=842B /18/10S (2|25|36): objs=152 size=276B /18/12S (2|25|36): objs=154 size=333B /18/14S (2|25|36): objs=141 size=205B /18/15N (2|25|36): objs=926 size=3.5KiB /18/16S (2|25|36): objs=154 size=190B /18/17N (2|25|36): objs=1320 size=5.49KiB /18/18S (2|25|36): objs=167 size=233B /18/19N (2|25|36): objs=2676 size=11.79KiB /18/20S (2|25|36): objs=158 size=172B /18/21N (2|25|36): objs=313 size=814B /18/22S (2|25|36): objs=169 size=251B /18/23N (2|25|36): objs=2422 size=11.08KiB /18/24S (2|25|36): objs=154 size=305B /18/26S (2|25|36): objs=158 size=202B /18/27N (2|25|36): objs=1475 size=6.18KiB /18/28S (2|25|36): objs=159 size=147B /18/29N (2|25|36): objs=5425 size=26.94KiB /18/30S (2|25|36): objs=150 size=333B /18/31N (2|25|36): objs=561 size=1.88KiB /18/32S (2|25|36): objs=163 size=327B /18/33N (2|25|36): objs=586 size=2.16KiB /18/34S (2|25|36): objs=149 size=264B /18/35N (2|25|36): objs=1498 size=5.91KiB /19/0N (2|25|36): objs=39611 size=1.02MiB /19/1N (2|25|36): objs=39169 size=851.48KiB /19/2N (2|25|36): objs=36809 size=821.06KiB /19/3N (2|25|36): objs=20880 size=208.96KiB /19/4S (2|25|36): objs=143 size=82B /19/6S (2|25|36): objs=163 size=258B /19/7N (2|25|36): objs=1253 size=5.03KiB /19/8S (2|25|36): objs=156 size=226B /19/9N (2|25|36): objs=2304 size=9.7KiB /19/10S (2|25|36): objs=167 size=242B /19/11N (2|25|36): objs=6071 size=28.76KiB /19/12S (2|25|36): objs=152 size=143B /19/13N (2|25|36): objs=1673 size=7.12KiB /19/14S (2|25|36): objs=160 size=172B /19/16S (2|25|36): objs=141 size=316B /19/17N (2|25|36): objs=608 size=2.08KiB /19/18S (2|25|36): objs=156 size=332B /19/20S (2|25|36): objs=162 size=122B /19/21N (2|25|36): objs=1079 size=4.08KiB /19/22S (2|25|36): objs=133 size=161B /19/23S (2|25|36): objs=161 size=341B /19/24S (2|25|36): objs=154 size=145B /19/25N (2|25|36): objs=1906 size=7.71KiB /19/26S (2|25|36): objs=158 size=201B /19/27N (2|25|36): objs=1684 size=6.9KiB /19/28S (2|25|36): objs=137 size=310B /19/29N (2|25|36): objs=614 size=2.28KiB /19/30S (2|25|36): objs=156 size=302B /19/31N (2|25|36): objs=1273 size=5.02KiB /19/32S (2|25|36): objs=155 size=233B /19/34S (2|25|36): objs=161 size=302B /19/35N (2|25|36): objs=1135 size=4.66KiB /20/0N (2|25|36): objs=40254 size=1006.34KiB /20/1N (2|25|36): objs=38981 size=763.73KiB /20/2N (2|25|36): objs=24084 size=257.14KiB /20/3S (2|25|36): objs=135 size=203B /20/4N (2|25|36): objs=16737 size=103.97KiB /20/5N (2|25|36): objs=23743 size=228.42KiB /20/6S (2|25|36): objs=177 size=271B /20/7S (2|25|36): objs=176 size=230B /20/8S (2|25|36): objs=143 size=340B /20/9N (2|25|36): objs=1101 size=4.37KiB /20/10S (2|25|36): objs=165 size=112B /20/12S (2|25|36): objs=148 size=315B /20/13N (2|25|36): objs=1688 size=7.06KiB /20/14S (2|25|36): objs=152 size=324B /20/15N (2|25|36): objs=2806 size=11.93KiB /20/16S (2|25|36): objs=138 size=117B /20/17S (2|25|36): objs=145 size=330B /20/18S (2|25|36): objs=143 size=193B /20/19N (2|25|36): objs=2122 size=11.06KiB /20/20S (2|25|36): objs=150 size=327B /20/21N (2|25|36): objs=1523 size=6.23KiB /20/22S (2|25|36): objs=136 size=152B /20/23N (2|25|36): objs=629 size=2.46KiB /20/24S (2|25|36): objs=154 size=110B /20/25N (2|25|36): objs=4499 size=21.15KiB /20/26S (2|25|36): objs=139 size=195B /20/27N (2|25|36): objs=298 size=988B /20/28S (2|25|36): objs=155 size=278B /20/29N (2|25|36): objs=477 size=1.48KiB /20/30S (2|25|36): objs=148 size=85B /20/31N (2|25|36): objs=969 size=3.86KiB /20/32S (2|25|36): objs=140 size=242B /20/33N (2|25|36): objs=473 size=1.46KiB /20/34S (2|25|36): objs=141 size=286B /20/35N (2|25|36): objs=497 size=1.73KiB /21/0N (2|25|36): objs=39053 size=872.61KiB /21/1N (2|25|36): objs=43758 size=1.03MiB /21/2N (2|25|36): objs=34975 size=537.62KiB /21/3S (2|25|36): objs=165 size=330B /21/4N (2|25|36): objs=5986 size=29.32KiB /21/5N (2|25|36): objs=3436 size=15.94KiB /21/6S (2|25|36): objs=151 size=107B /21/7N (2|25|36): objs=7905 size=39.05KiB /21/8S (2|25|36): objs=153 size=232B /21/10S (2|25|36): objs=147 size=196B /21/11N (2|25|36): objs=1095 size=4.38KiB /21/12S (2|25|36): objs=156 size=294B /21/14S (2|25|36): objs=163 size=244B /21/15N (2|25|36): objs=4146 size=20.04KiB /21/16S (2|25|36): objs=169 size=178B /21/17N (2|25|36): objs=307 size=878B /21/18S (2|25|36): objs=147 size=120B /21/19N (2|25|36): objs=1560 size=6.5KiB /21/20S (2|25|36): objs=147 size=326B /21/21N (2|25|36): objs=2847 size=12.3KiB /21/22S (2|25|36): objs=147 size=305B /21/23N (2|25|36): objs=1221 size=4.97KiB /21/24S (2|25|36): objs=141 size=317B /21/25N (2|25|36): objs=9246 size=50.51KiB /21/26S (2|25|36): objs=172 size=98B /21/28S (2|25|36): objs=161 size=307B /21/29N (2|25|36): objs=1424 size=5.85KiB /21/30S (2|25|36): objs=172 size=284B /21/31N (2|25|36): objs=2899 size=12.13KiB /21/32S (2|25|36): objs=141 size=228B /21/33N (2|25|36): objs=1512 size=6.18KiB /21/34S (2|25|36): objs=141 size=209B /21/35N (2|25|36): objs=3607 size=15.49KiB /22/0N (2|25|36): objs=37825 size=778.64KiB /22/1N (2|25|36): objs=44835 size=1.24MiB /22/2N (2|25|36): objs=40908 size=973.53KiB /22/3N (2|25|36): objs=9296 size=47.21KiB /22/4S (2|25|36): objs=149 size=337B /22/5N (2|25|36): objs=3374 size=15.95KiB /22/6S (2|25|36): objs=164 size=264B /22/7N (2|25|36): objs=625 size=2.41KiB /22/8S (2|25|36): objs=133 size=160B /22/9N (2|25|36): objs=309 size=1.03KiB /22/10S (2|25|36): objs=140 size=237B /22/11S (2|25|36): objs=142 size=165B /22/12S (2|25|36): objs=151 size=140B /22/13S (2|25|36): objs=156 size=150B /22/14S (2|25|36): objs=150 size=301B /22/15N (2|25|36): objs=1832 size=7.64KiB /22/16S (2|25|36): objs=166 size=342B /22/17N (2|25|36): objs=4712 size=22.18KiB /22/18S (2|25|36): objs=160 size=200B /22/19N (2|25|36): objs=5585 size=25.42KiB /22/20S (2|25|36): objs=153 size=153B /22/21N (2|25|36): objs=1326 size=5.63KiB /22/22S (2|25|36): objs=147 size=161B /22/23N (2|25|36): objs=317 size=856B /22/24S (2|25|36): objs=161 size=317B /22/25N (2|25|36): objs=468 size=1.64KiB /22/26S (2|25|36): objs=170 size=337B /22/27N (2|25|36): objs=2155 size=8.75KiB /22/28S (2|25|36): objs=148 size=160B /22/29N (2|25|36): objs=615 size=2.41KiB /22/30S (2|25|36): objs=153 size=296B /22/31N (2|25|36): objs=2028 size=8.58KiB /22/32S (2|25|36): objs=157 size=206B /22/33N (2|25|36): objs=4100 size=17.49KiB /22/34S (2|25|36): objs=178 size=216B /22/35N (2|25|36): objs=309 size=1.06KiB /23/0N (1|26|34): objs=76075 size=3.14MiB /23/1N (1|26|34): objs=42377 size=1005.8KiB /23/2S (1|26|34): objs=173 size=332B /23/3N (1|26|34): objs=2324 size=9.76KiB /23/4S (1|26|34): objs=168 size=187B /23/5N (1|26|34): objs=1483 size=6.13KiB /23/6S (1|26|34): objs=153 size=148B /23/7N (1|26|34): objs=483 size=1.66KiB /23/8S (1|26|34): objs=156 size=313B /23/9N (1|26|34): objs=3000 size=12.77KiB /23/10S (1|26|34): objs=151 size=308B /23/11N (1|26|34): objs=769 size=2.92KiB /23/12S (1|26|34): objs=153 size=115B /23/13N (1|26|34): objs=1034 size=3.98KiB /23/14S (1|26|34): objs=134 size=187B /23/15N (1|26|34): objs=769 size=2.9KiB /23/16S (1|26|34): objs=158 size=335B /23/17N (1|26|34): objs=2509 size=10.67KiB /23/18S (1|26|34): objs=136 size=131B /23/19N (1|26|34): objs=4235 size=22.33KiB /23/20S (1|26|34): objs=154 size=191B /23/21N (1|26|34): objs=963 size=3.81KiB /23/22S (1|26|34): objs=159 size=158B /23/23N (1|26|34): objs=1332 size=5.41KiB /23/24S (1|26|34): objs=160 size=247B /23/25N (1|26|34): objs=1536 size=5.78KiB /23/26S (1|26|34): objs=159 size=249B /23/27N (1|26|34): objs=1067 size=4.02KiB /23/28S (1|26|34): objs=159 size=248B /23/29N (1|26|34): objs=471 size=1.45KiB /23/30S (1|26|34): objs=144 size=326B /23/31S (1|26|34): objs=146 size=91B /23/32S (1|26|34): objs=153 size=256B /23/33N (1|26|34): objs=1567 size=6.45KiB /23/0/0N (1|25|34): objs=38515 size=966.71KiB /23/0/1N (1|25|34): objs=18061 size=160.22KiB /23/0/2S (1|25|34): objs=142 size=228B /23/0/3N (1|25|34): objs=2553 size=11.51KiB /23/0/4S (1|25|34): objs=188 size=312B /23/0/5N (1|25|34): objs=447 size=1.63KiB /23/0/6S (1|25|34): objs=149 size=299B /23/0/7N (1|25|34): objs=885 size=3.4KiB /23/0/8S (1|25|34): objs=167 size=119B /23/0/10S (1|25|34): objs=166 size=88B /23/0/11N (1|25|34): objs=2251 size=10.16KiB /23/0/12S (1|25|34): objs=145 size=319B /23/0/13N (1|25|34): objs=758 size=2.98KiB /23/0/14S (1|25|34): objs=161 size=179B /23/0/16S (1|25|34): objs=140 size=269B /23/0/17N (1|25|34): objs=2498 size=10.41KiB /23/0/18S (1|25|34): objs=146 size=327B /23/0/19N (1|25|34): objs=768 size=2.81KiB /23/0/20S (1|25|34): objs=140 size=181B /23/0/21N (1|25|34): objs=459 size=1.51KiB /23/0/22S (1|25|34): objs=154 size=280B /23/0/23N (1|25|34): objs=1695 size=6.89KiB /23/0/24S (1|25|34): objs=162 size=274B /23/0/25N (1|25|34): objs=272 size=884B /23/0/26S (1|25|34): objs=186 size=359B /23/0/27N (1|25|34): objs=1986 size=8.49KiB /23/0/28S (1|25|34): objs=136 size=157B /23/0/30S (1|25|34): objs=145 size=177B /23/0/31N (1|25|34): objs=1096 size=4.31KiB /23/0/32S (1|25|34): objs=176 size=140B /23/0/33N (1|25|34): objs=1328 size=5.34KiB /24/0N (2|25|36): objs=37695 size=694.2KiB /24/1N (2|25|36): objs=37989 size=786.21KiB /24/2N (2|25|36): objs=36737 size=764.48KiB /24/3N (2|25|36): objs=3399 size=14.73KiB /24/4S (2|25|36): objs=149 size=177B /24/5N (2|25|36): objs=5997 size=29.11KiB /24/6S (2|25|36): objs=148 size=172B /24/7N (2|25|36): objs=600 size=2.2KiB /24/8S (2|25|36): objs=173 size=268B /24/9N (2|25|36): objs=1790 size=7.32KiB /24/10S (2|25|36): objs=175 size=273B /24/11N (2|25|36): objs=2895 size=12.32KiB /24/12S (2|25|36): objs=163 size=229B /24/14S (2|25|36): objs=163 size=99B /24/15S (2|25|36): objs=151 size=129B /24/16S (2|25|36): objs=162 size=114B /24/18S (2|25|36): objs=161 size=127B /24/19N (2|25|36): objs=2701 size=11.97KiB /24/20S (2|25|36): objs=142 size=276B /24/21N (2|25|36): objs=1085 size=4.35KiB /24/22S (2|25|36): objs=145 size=194B /24/24S (2|25|36): objs=145 size=260B /24/26S (2|25|36): objs=170 size=153B /24/27N (2|25|36): objs=5704 size=25.93KiB /24/28S (2|25|36): objs=170 size=322B /24/29N (2|25|36): objs=3711 size=16.97KiB /24/30S (2|25|36): objs=144 size=261B /24/31N (2|25|36): objs=2109 size=9.01KiB /24/32S (2|25|36): objs=152 size=160B /24/33N (2|25|36): objs=1639 size=6.47KiB /24/34S (2|25|36): objs=169 size=336B /24/35N (2|25|36): objs=1994 size=8.88KiB /25/0N (2|25|36): objs=38199 size=846.22KiB /25/1N (2|25|36): objs=36555 size=714.93KiB /25/2N (2|25|36): objs=41152 size=967.44KiB /25/3N (2|25|36): objs=5899 size=27.95KiB /25/4S (2|25|36): objs=136 size=236B /25/5N (2|25|36): objs=4128 size=17.39KiB /25/6S (2|25|36): objs=151 size=141B /25/8S (2|25|36): objs=136 size=104B /25/9S (2|25|36): objs=161 size=240B /25/10S (2|25|36): objs=154 size=146B /25/11N (2|25|36): objs=6056 size=29.41KiB /25/12S (2|25|36): objs=166 size=150B /25/13N (2|25|36): objs=2578 size=10.8KiB /25/14S (2|25|36): objs=142 size=268B /25/15N (2|25|36): objs=2024 size=9.58KiB /25/16S (2|25|36): objs=144 size=219B /25/18S (2|25|36): objs=158 size=228B /25/19N (2|25|36): objs=790 size=3.11KiB /25/20S (2|25|36): objs=143 size=305B /25/21N (2|25|36): objs=593 size=2.11KiB /25/22S (2|25|36): objs=173 size=127B /25/23N (2|25|36): objs=303 size=785B /25/24S (2|25|36): objs=150 size=327B /25/25N (2|25|36): objs=2298 size=9.9KiB /25/26S (2|25|36): objs=160 size=206B /25/27N (2|25|36): objs=446 size=1.61KiB /25/28S (2|25|36): objs=163 size=351B /25/29N (2|25|36): objs=1357 size=5.44KiB /25/30S (2|25|36): objs=152 size=316B /25/31N (2|25|36): objs=2905 size=13.1KiB /25/32S (2|25|36): objs=153 size=233B /25/33N (2|25|36): objs=5574 size=28.32KiB /25/34S (2|25|36): objs=167 size=215B /25/35N (2|25|36): objs=2197 size=9.19KiB /26/0N (2|25|36): objs=39807 size=796.6KiB /26/1N (2|25|36): objs=38486 size=878.27KiB /26/2N (2|25|36): objs=38525 size=760.75KiB /26/3N (2|25|36): objs=5630 size=26.08KiB /26/4S (2|25|36): objs=162 size=281B /26/5N (2|25|36): objs=290 size=876B /26/6S (2|25|36): objs=146 size=304B /26/8S (2|25|36): objs=150 size=196B /26/9N (2|25|36): objs=298 size=1.01KiB /26/10S (2|25|36): objs=162 size=255B /26/12S (2|25|36): objs=152 size=183B /26/13N (2|25|36): objs=1038 size=4.19KiB /26/14S (2|25|36): objs=139 size=125B /26/15N (2|25|36): objs=475 size=1.52KiB /26/16S (2|25|36): objs=148 size=105B /26/17N (2|25|36): objs=1234 size=4.97KiB /26/18S (2|25|36): objs=165 size=188B /26/19N (2|25|36): objs=567 size=2KiB /26/20S (2|25|36): objs=144 size=157B /26/21N (2|25|36): objs=1769 size=7.44KiB /26/22S (2|25|36): objs=161 size=329B /26/23N (2|25|36): objs=2318 size=10.04KiB /26/24S (2|25|36): objs=137 size=222B /26/25N (2|25|36): objs=444 size=1.49KiB /26/26S (2|25|36): objs=145 size=230B /26/27N (2|25|36): objs=1057 size=4.28KiB /26/28S (2|25|36): objs=168 size=251B /26/29S (2|25|36): objs=160 size=217B /26/30S (2|25|36): objs=157 size=332B /26/31N (2|25|36): objs=17114 size=139.46KiB /26/32S (2|25|36): objs=160 size=120B /26/33N (2|25|36): objs=282 size=767B /26/34S (2|25|36): objs=144 size=130B /26/35N (2|25|36): objs=2191 size=9.38KiB /27/0N (2|25|36): objs=41835 size=1.1MiB /27/1N (2|25|36): objs=39014 size=691.15KiB /27/2N (2|25|36): objs=21227 size=190.07KiB /27/3S (2|25|36): objs=173 size=159B /27/4N (2|25|36): objs=15451 size=112.09KiB /27/5N (2|25|36): objs=272 size=677B /27/6S (2|25|36): objs=157 size=104B /27/7N (2|25|36): objs=787 size=3.2KiB /27/8S (2|25|36): objs=172 size=179B /27/9N (2|25|36): objs=308 size=882B /27/10S (2|25|36): objs=132 size=259B /27/11N (2|25|36): objs=1354 size=5.52KiB /27/12S (2|25|36): objs=155 size=115B /27/13N (2|25|36): objs=473 size=1.48KiB /27/14S (2|25|36): objs=156 size=263B /27/15N (2|25|36): objs=1556 size=6.28KiB /27/16S (2|25|36): objs=148 size=301B /27/17N (2|25|36): objs=2983 size=14.33KiB /27/18S (2|25|36): objs=159 size=286B /27/19S (2|25|36): objs=176 size=353B /27/20S (2|25|36): objs=136 size=295B /27/21N (2|25|36): objs=1836 size=7.93KiB /27/22S (2|25|36): objs=137 size=284B /27/23N (2|25|36): objs=756 size=3.07KiB /27/24S (2|25|36): objs=145 size=312B /27/25N (2|25|36): objs=5363 size=26.61KiB /27/26S (2|25|36): objs=132 size=163B /27/27N (2|25|36): objs=1502 size=6.13KiB /27/28S (2|25|36): objs=135 size=220B /27/29N (2|25|36): objs=7112 size=35.28KiB /27/30S (2|25|36): objs=160 size=181B /27/31N (2|25|36): objs=5570 size=28.06KiB /27/32S (2|25|36): objs=178 size=294B /27/33N (2|25|36): objs=4700 size=22.14KiB /27/34S (2|25|36): objs=140 size=179B /27/35N (2|25|36): objs=1539 size=6.62KiB /28/0N (2|25|36): objs=39852 size=959.71KiB /28/1N (2|25|36): objs=5993 size=27.18KiB /28/2S (2|25|36): objs=169 size=233B /28/3N (2|25|36): objs=30161 size=464.94KiB /28/4N (2|25|36): objs=36110 size=609.29KiB /28/5S (2|25|36): objs=157 size=192B /28/6N (2|25|36): objs=861 size=3.34KiB /28/7S (2|25|36): objs=145 size=113B /28/8N (2|25|36): objs=1188 size=4.94KiB /28/9S (2|25|36): objs=160 size=94B /28/10N (2|25|36): objs=3416 size=14.33KiB /28/11N (2|25|36): objs=3176 size=13.51KiB /28/12S (2|25|36): objs=152 size=256B /28/13N (2|25|36): objs=306 size=1009B /28/14S (2|25|36): objs=158 size=98B /28/15N (2|25|36): objs=1365 size=5.61KiB /28/16S (2|25|36): objs=157 size=143B /28/17N (2|25|36): objs=6718 size=32.51KiB /28/18S (2|25|36): objs=165 size=300B /28/19N (2|25|36): objs=7839 size=41.4KiB /28/20S (2|25|36): objs=150 size=307B /28/21N (2|25|36): objs=5484 size=25.9KiB /28/22S (2|25|36): objs=134 size=160B /28/23N (2|25|36): objs=613 size=2.28KiB /28/24S (2|25|36): objs=166 size=282B /28/25S (2|25|36): objs=138 size=85B /28/26S (2|25|36): objs=141 size=207B /28/27N (2|25|36): objs=3226 size=13.78KiB /28/28S (2|25|36): objs=146 size=330B /28/29N (2|25|36): objs=1226 size=5KiB /28/30S (2|25|36): objs=164 size=228B /28/31S (2|25|36): objs=154 size=213B /28/32S (2|25|36): objs=151 size=322B /28/33N (2|25|36): objs=2960 size=12.64KiB /28/34S (2|25|36): objs=134 size=118B /28/35N (2|25|36): objs=1143 size=4.59KiB /29/0N (2|25|36): objs=37906 size=778.88KiB /29/1N (2|25|36): objs=38247 size=841.07KiB /29/2N (2|25|36): objs=41420 size=982.82KiB /29/3N (2|25|36): objs=2953 size=12.63KiB /29/4S (2|25|36): objs=139 size=159B /29/5S (2|25|36): objs=136 size=224B /29/6S (2|25|36): objs=139 size=299B /29/7N (2|25|36): objs=1658 size=7.01KiB /29/8S (2|25|36): objs=184 size=338B /29/9N (2|25|36): objs=324 size=964B /29/10S (2|25|36): objs=144 size=273B /29/11N (2|25|36): objs=4255 size=21.6KiB /29/12S (2|25|36): objs=166 size=203B /29/13N (2|25|36): objs=5743 size=28KiB /29/14S (2|25|36): objs=148 size=272B /29/16S (2|25|36): objs=151 size=245B /29/17N (2|25|36): objs=1357 size=5.48KiB /29/18S (2|25|36): objs=156 size=164B /29/19S (2|25|36): objs=162 size=194B /29/20S (2|25|36): objs=151 size=160B /29/21N (2|25|36): objs=1865 size=7.86KiB /29/22S (2|25|36): objs=172 size=341B /29/23N (2|25|36): objs=5378 size=25.74KiB /29/24S (2|25|36): objs=142 size=272B /29/25N (2|25|36): objs=1268 size=5KiB /29/26S (2|25|36): objs=135 size=130B /29/27N (2|25|36): objs=3447 size=15.53KiB /29/28S (2|25|36): objs=158 size=185B /29/29N (2|25|36): objs=3264 size=14.32KiB /29/30S (2|25|36): objs=142 size=194B /29/31N (2|25|36): objs=1667 size=6.7KiB /29/32S (2|25|36): objs=154 size=134B /29/34S (2|25|36): objs=168 size=297B /29/35N (2|25|36): objs=2905 size=12.18KiB /30/0N (2|25|36): objs=38668 size=888.4KiB /30/1N (2|25|36): objs=41872 size=1.04MiB /30/2N (2|25|36): objs=46240 size=1.26MiB /30/3N (2|25|36): objs=12512 size=77.42KiB /30/4S (2|25|36): objs=156 size=161B /30/5N (2|25|36): objs=589 size=2.12KiB /30/6S (2|25|36): objs=132 size=192B /30/7N (2|25|36): objs=1592 size=6.41KiB /30/8S (2|25|36): objs=158 size=218B /30/10S (2|25|36): objs=161 size=238B /30/11N (2|25|36): objs=4260 size=19.16KiB /30/12S (2|25|36): objs=164 size=210B /30/13N (2|25|36): objs=3746 size=17.23KiB /30/14S (2|25|36): objs=144 size=136B /30/15N (2|25|36): objs=1799 size=7.49KiB /30/16S (2|25|36): objs=157 size=268B /30/18S (2|25|36): objs=158 size=113B /30/19N (2|25|36): objs=492 size=1.63KiB /30/20S (2|25|36): objs=160 size=227B /30/21N (2|25|36): objs=292 size=796B /30/22S (2|25|36): objs=156 size=319B /30/23N (2|25|36): objs=610 size=2.14KiB /30/24S (2|25|36): objs=142 size=123B /30/25N (2|25|36): objs=2272 size=9.42KiB /30/26S (2|25|36): objs=145 size=147B /30/27N (2|25|36): objs=310 size=882B /30/28S (2|25|36): objs=159 size=170B /30/29N (2|25|36): objs=931 size=3.55KiB /30/30S (2|25|36): objs=154 size=240B /30/31N (2|25|36): objs=4603 size=22.18KiB /30/32S (2|25|36): objs=166 size=185B /30/33N (2|25|36): objs=758 size=2.87KiB /30/34S (2|25|36): objs=153 size=237B /30/35N (2|25|36): objs=579 size=2.29KiB /31/0N (2|25|36): objs=39264 size=884.4KiB /31/1N (2|25|36): objs=40000 size=902.55KiB /31/2N (2|25|36): objs=27673 size=558.4KiB /31/3S (2|25|36): objs=140 size=138B /31/4N (2|25|36): objs=1184 size=4.8KiB /31/5S (2|25|36): objs=147 size=119B /31/6N (2|25|36): objs=2741 size=11.61KiB /31/7S (2|25|36): objs=142 size=199B /31/9S (2|25|36): objs=146 size=100B /31/10N (2|25|36): objs=4058 size=17.39KiB /31/11N (2|25|36): objs=2864 size=12.38KiB /31/12S (2|25|36): objs=152 size=339B /31/13N (2|25|36): objs=4827 size=21.32KiB /31/14S (2|25|36): objs=169 size=314B /31/15N (2|25|36): objs=3216 size=13.62KiB /31/16S (2|25|36): objs=161 size=101B /31/18S (2|25|36): objs=177 size=238B /31/19N (2|25|36): objs=2129 size=8.52KiB /31/20S (2|25|36): objs=191 size=168B /31/21N (2|25|36): objs=1623 size=6.93KiB /31/22S (2|25|36): objs=148 size=192B /31/23N (2|25|36): objs=8832 size=51.06KiB /31/24S (2|25|36): objs=135 size=311B /31/25N (2|25|36): objs=2206 size=9.69KiB /31/26S (2|25|36): objs=139 size=236B /31/27N (2|25|36): objs=948 size=3.56KiB /31/28S (2|25|36): objs=176 size=127B /31/29N (2|25|36): objs=319 size=851B /31/30S (2|25|36): objs=150 size=161B /31/31N (2|25|36): objs=1042 size=4.04KiB /31/32S (2|25|36): objs=147 size=129B /31/33N (2|25|36): objs=6042 size=31.25KiB /31/34S (2|25|36): objs=134 size=201B /31/35N (2|25|36): objs=607 size=2.3KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 6799510 Write time: 761.9ms O. Stats: Wall clock time: 775.54ms Total CPU time: 1.02s User wait time: 588.06ms Serialization time: 170.22ms (16.75%) Checksum calculation time: 328.51ms (32.33%) Compression time: 356.58ms (35.1%) Total IO delay: 415.32ms Concurrency overhead: 220.39ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 15.63MiB/s Concurrency adjusted uncompressed speed: 31.9MiB/s Actual uncompressed speed: 23.79MiB/s Actual speed: 8.37MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 674.35ms Total CPU time: 630.16ms Serialization time: 445.81ms (70.75%) Checksum calculation time: 75.69ms (12.01%) Compression time: 102.76ms (16.31%) Total IO delay: 274.73ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 23.67MiB/s Concurrency adjusted uncompressed speed: 81.58MiB/s Actual uncompressed speed: 27.35MiB/s Actual speed: 9.62MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.6s Total CPU time: 913.07ms Serialization time: 521.65ms (57.13%) Checksum calculation time: 160.49ms (17.58%) Compression time: 219.07ms (23.99%) Total IO delay: 638.48ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 20.33MiB/s Concurrency adjusted uncompressed speed: 95.28MiB/s Actual uncompressed speed: 22.99MiB/s Actual speed: 8.09MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6791878 Write time: 625.33ms O. Stats: Wall clock time: 626.31ms Total CPU time: 752.52ms User wait time: 495.53ms Serialization time: 253.79ms (33.73%) Checksum calculation time: 200.3ms (26.62%) Compression time: 294.29ms (39.11%) Total IO delay: 158.17ms Concurrency overhead: 71.47ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 41MiB/s Concurrency adjusted uncompressed speed: 61.66MiB/s Actual uncompressed speed: 29.45MiB/s Actual speed: 10.35MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 652.87ms Total CPU time: 672.82ms Serialization time: 252.4ms (37.51%) Checksum calculation time: 192.01ms (28.54%) Compression time: 227.26ms (33.78%) Total IO delay: 90.53ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 71.97MiB/s Concurrency adjusted uncompressed speed: 97.04MiB/s Actual uncompressed speed: 28.28MiB/s Actual speed: 9.93MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 1 / 0 I. Stats 2: Wall clock time: 1.41s Total CPU time: 1.3s Serialization time: 493.56ms (37.88%) Checksum calculation time: 382.58ms (29.36%) Compression time: 424.4ms (32.57%) Total IO delay: 191.87ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 67.82MiB/s Concurrency adjusted uncompressed speed: 98.86MiB/s Actual uncompressed speed: 26.1MiB/s Actual speed: 9.17MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6799510 Write time: 837.34ms O. Stats: Wall clock time: 838.57ms Total CPU time: 357.87ms User wait time: 782.26ms Serialization time: 81.32ms (22.72%) Checksum calculation time: 57.51ms (16.07%) Compression time: 212.85ms (59.48%) Total IO delay: 192.55ms Concurrency overhead: 115.79ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 33.77MiB/s Concurrency adjusted uncompressed speed: 27.68MiB/s Actual uncompressed speed: 22MiB/s Actual speed: 7.74MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 539.62ms Total CPU time: 268.53ms Serialization time: 122.44ms (45.6%) Checksum calculation time: 57.52ms (21.42%) Compression time: 81.02ms (30.17%) Total IO delay: 417.59ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 15.55MiB/s Concurrency adjusted uncompressed speed: 26.88MiB/s Actual uncompressed speed: 34.21MiB/s Actual speed: 12.03MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 1 / 0 I. Stats 2: Wall clock time: 1.17s Total CPU time: 466.06ms Serialization time: 179.6ms (38.54%) Checksum calculation time: 114.6ms (24.59%) Compression time: 155.4ms (33.34%) Total IO delay: 902.33ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 14.38MiB/s Concurrency adjusted uncompressed speed: 26.95MiB/s Actual uncompressed speed: 31.49MiB/s Actual speed: 11.08MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 Write time: 921.45ms O. Stats: Wall clock time: 922.62ms Total CPU time: 638.27ms User wait time: 852.19ms Serialization time: 200.12ms (31.35%) Checksum calculation time: 187.15ms (29.32%) Compression time: 235.57ms (36.91%) Total IO delay: 138.92ms Concurrency overhead: 35.49ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 46.94MiB/s Concurrency adjusted uncompressed speed: 22.71MiB/s Actual uncompressed speed: 20MiB/s Actual speed: 7.03MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 589.36ms Total CPU time: 598.55ms Serialization time: 148.56ms (24.82%) Checksum calculation time: 225.64ms (37.7%) Compression time: 223.33ms (37.31%) Total IO delay: 71.44ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 91.23MiB/s Concurrency adjusted uncompressed speed: 27.56MiB/s Actual uncompressed speed: 31.3MiB/s Actual speed: 11MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.26s Total CPU time: 1.18s Serialization time: 340.8ms (28.81%) Checksum calculation time: 410.02ms (34.66%) Compression time: 429.99ms (36.35%) Total IO delay: 155.45ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 83.58MiB/s Concurrency adjusted uncompressed speed: 27.56MiB/s Actual uncompressed speed: 29.26MiB/s Actual speed: 10.28MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 1 / 0 / 3 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 13.56s O. Stats: Wall clock time: 13.56s Total CPU time: 34.83s User wait time: 12.88s Serialization time: 107.15ms (0.31%) Checksum calculation time: 65.36ms (0.19%) Compression time: 34.63s (99.41%) Total IO delay: 272.04ms Concurrency overhead: 83.73ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 14.57MiB/s Concurrency adjusted uncompressed speed: 2.08MiB/s Actual uncompressed speed: 1.36MiB/s Actual speed: 299.26KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 1 / 0 I. Stats 1: Wall clock time: 443.09ms Total CPU time: 196.43ms Serialization time: 60.33ms (30.71%) Checksum calculation time: 68.75ms (35%) Compression time: 60.12ms (30.61%) Total IO delay: 365.61ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 10.86MiB/s Concurrency adjusted uncompressed speed: 131.69MiB/s Actual uncompressed speed: 41.62MiB/s Actual speed: 8.95MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.01s Total CPU time: 424.75ms Serialization time: 148.17ms (34.88%) Checksum calculation time: 142.15ms (33.47%) Compression time: 120.63ms (28.4%) Total IO delay: 712.4ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 11.13MiB/s Concurrency adjusted uncompressed speed: 129.84MiB/s Actual uncompressed speed: 36.58MiB/s Actual speed: 7.86MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 1 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 20.42s O. Stats: Wall clock time: 20.42s Total CPU time: 35.33s User wait time: 18.56s Serialization time: 218.95ms (0.62%) Checksum calculation time: 158.83ms (0.45%) Compression time: 34.95s (98.92%) Total IO delay: 133.31ms Concurrency overhead: 26.43ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 29.39MiB/s Concurrency adjusted uncompressed speed: 2.07MiB/s Actual uncompressed speed: 924.42KiB/s Actual speed: 195.98KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 544.31ms Total CPU time: 505.66ms Serialization time: 188.09ms (37.2%) Checksum calculation time: 179.49ms (35.5%) Compression time: 137.05ms (27.1%) Total IO delay: 98.82ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 39.89MiB/s Concurrency adjusted uncompressed speed: 122.1MiB/s Actual uncompressed speed: 33.89MiB/s Actual speed: 7.19MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.17s Total CPU time: 1.05s Serialization time: 394.96ms (37.77%) Checksum calculation time: 362.58ms (34.68%) Compression time: 286.15ms (27.37%) Total IO delay: 187.76ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 41.81MiB/s Concurrency adjusted uncompressed speed: 119.72MiB/s Actual uncompressed speed: 31.44MiB/s Actual speed: 6.66MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 31.19s O. Stats: Wall clock time: 31.19s Total CPU time: 30.95s User wait time: 31.13s Serialization time: 87.86ms (0.28%) Checksum calculation time: 73.81ms (0.24%) Compression time: 30.78s (99.45%) Total IO delay: 107.41ms Concurrency overhead: 24.05ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 37.04MiB/s Concurrency adjusted uncompressed speed: 607.52KiB/s Actual uncompressed speed: 605.34KiB/s Actual speed: 130.14KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 1 / 1 / 0 I. Stats 1: Wall clock time: 483.42ms Total CPU time: 212.04ms Serialization time: 96.17ms (45.36%) Checksum calculation time: 48.85ms (23.04%) Compression time: 59.81ms (28.21%) Total IO delay: 404.54ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 9.81MiB/s Concurrency adjusted uncompressed speed: 29.93MiB/s Actual uncompressed speed: 38.17MiB/s Actual speed: 8.21MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.06s Total CPU time: 442.42ms Serialization time: 188.08ms (42.51%) Checksum calculation time: 120.29ms (27.19%) Compression time: 119.63ms (27.04%) Total IO delay: 795.21ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 9.97MiB/s Concurrency adjusted uncompressed speed: 29.81MiB/s Actual uncompressed speed: 34.82MiB/s Actual speed: 7.49MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 31.92s O. Stats: Wall clock time: 31.92s Total CPU time: 31.71s User wait time: 31.87s Serialization time: 208.26ms (0.66%) Checksum calculation time: 169.38ms (0.53%) Compression time: 31.33s (98.8%) Total IO delay: 92.25ms Concurrency overhead: 12ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 42.49MiB/s Concurrency adjusted uncompressed speed: 593.47KiB/s Actual uncompressed speed: 591.42KiB/s Actual speed: 125.39KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 501.39ms Total CPU time: 553.66ms Serialization time: 199.42ms (36.02%) Checksum calculation time: 201.53ms (36.4%) Compression time: 151.75ms (27.41%) Total IO delay: 72.68ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 54.29MiB/s Concurrency adjusted uncompressed speed: 29.45MiB/s Actual uncompressed speed: 36.8MiB/s Actual speed: 7.8MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.08s Total CPU time: 991.39ms Serialization time: 363.96ms (36.71%) Checksum calculation time: 380.06ms (38.34%) Compression time: 245.51ms (24.76%) Total IO delay: 177.09ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 44.17MiB/s Concurrency adjusted uncompressed speed: 31.57MiB/s Actual uncompressed speed: 34.24MiB/s Actual speed: 7.26MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 0 / 0 / 0 Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 Pending / IO / Serde / Objs: 0 / 1 / 1 / 1000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 2000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 3000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 4000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 5000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 6000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 7000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 7000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 8000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 9000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 10000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 11000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 12000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 13000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 14000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 15000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 16000 Pending / IO / Serde / Objs: 1 / 1 / 1 / 17000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 18000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 19000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 O. Stats: Wall clock time: 46.95s Total CPU time: 40.46s User wait time: 234.66us Serialization time: 7.61s (18.81%) Checksum calculation time: 21.39s (52.86%) Compression time: 4.99s (12.34%) Total IO delay: 28.94s Concurrency overhead: 38.31ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 65.92MiB/s Concurrency adjusted uncompressed speed: 218.92MiB/s Actual uncompressed speed: 40.63MiB/s Actual speed: 40.63MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Gradle Test Executor 1 finished executing tests. Finished generating test XML results (1.008 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (1.268 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Daemon worker,5,main]) completed. Took 22 mins 31.199 secs. BUILD SUCCESSFUL in 24m 11s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_armhf.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_armhf.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/10537 and its subdirectories I: Current time: Fri Feb 9 05:30:25 -12 2024 I: pbuilder-time-stamp: 1707499825