I: pbuilder: network access will be disabled during build I: Current time: Sat Feb 10 07:30:47 +14 2024 I: pbuilder-time-stamp: 1707499847 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bookworm-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Sat Dec 31 04:08:01 2022 +14 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D01_modify_environment starting debug: Running on cbxi4b. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash '/bin/sh' -> '/bin/bash' lrwxrwxrwx 1 root root 9 Feb 10 07:31 /bin/sh -> /bin/bash I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="2" [2]="15" [3]="1" [4]="release" [5]="arm-unknown-linux-gnueabihf") BASH_VERSION='5.2.15(1)-release' BUILDDIR=/build/reproducible-path BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=armhf DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=4 ' DIRSTACK=() DISTRIBUTION=bookworm EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=arm HOST_ARCH=armhf IFS=' ' INVOCATION_ID=1d3dd9102ea04150b886a99cfd666e22 LANG=C LANGUAGE=it_CH:it LC_ALL=C MACHTYPE=arm-unknown-linux-gnueabihf MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnueabihf PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=28295 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/pbuilderrc_FPwt --distribution bookworm --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/b2 --logfile b2/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID=116 SUDO_UID=112 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' http_proxy=http://10.0.0.15:3142/ I: uname -a Linux i-capture-the-hostname 6.1.0-17-armmp #1 SMP Debian 6.1.69-1 (2023-12-30) armv7l GNU/Linux I: ls -l /bin total 4964 -rwxr-xr-x 1 root root 838488 Apr 24 2023 bash -rwxr-xr-x 3 root root 67144 Sep 19 2022 bunzip2 -rwxr-xr-x 3 root root 67144 Sep 19 2022 bzcat lrwxrwxrwx 1 root root 6 Sep 19 2022 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Sep 19 2022 bzdiff lrwxrwxrwx 1 root root 6 Sep 19 2022 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4893 Nov 28 2021 bzexe lrwxrwxrwx 1 root root 6 Sep 19 2022 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Sep 19 2022 bzgrep -rwxr-xr-x 3 root root 67144 Sep 19 2022 bzip2 -rwxr-xr-x 1 root root 67112 Sep 19 2022 bzip2recover lrwxrwxrwx 1 root root 6 Sep 19 2022 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Sep 19 2022 bzmore -rwxr-xr-x 1 root root 67632 Sep 21 2022 cat -rwxr-xr-x 1 root root 67676 Sep 21 2022 chgrp -rwxr-xr-x 1 root root 67644 Sep 21 2022 chmod -rwxr-xr-x 1 root root 67684 Sep 21 2022 chown -rwxr-xr-x 1 root root 133532 Sep 21 2022 cp -rwxr-xr-x 1 root root 132868 Jan 6 2023 dash -rwxr-xr-x 1 root root 133220 Sep 21 2022 date -rwxr-xr-x 1 root root 67732 Sep 21 2022 dd -rwxr-xr-x 1 root root 68104 Sep 21 2022 df -rwxr-xr-x 1 root root 133632 Sep 21 2022 dir -rwxr-xr-x 1 root root 59128 Mar 23 2023 dmesg lrwxrwxrwx 1 root root 8 Dec 20 2022 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Dec 20 2022 domainname -> hostname -rwxr-xr-x 1 root root 67560 Sep 21 2022 echo -rwxr-xr-x 1 root root 41 Jan 25 2023 egrep -rwxr-xr-x 1 root root 67548 Sep 21 2022 false -rwxr-xr-x 1 root root 41 Jan 25 2023 fgrep -rwxr-xr-x 1 root root 55748 Mar 23 2023 findmnt -rwsr-xr-x 1 root root 26208 Mar 23 2023 fusermount -rwxr-xr-x 1 root root 128608 Jan 25 2023 grep -rwxr-xr-x 2 root root 2346 Apr 10 2022 gunzip -rwxr-xr-x 1 root root 6447 Apr 10 2022 gzexe -rwxr-xr-x 1 root root 64220 Apr 10 2022 gzip -rwxr-xr-x 1 root root 67032 Dec 20 2022 hostname -rwxr-xr-x 1 root root 67720 Sep 21 2022 ln -rwxr-xr-x 1 root root 35132 Mar 23 2023 login -rwxr-xr-x 1 root root 133632 Sep 21 2022 ls -rwxr-xr-x 1 root root 136808 Mar 23 2023 lsblk -rwxr-xr-x 1 root root 67800 Sep 21 2022 mkdir -rwxr-xr-x 1 root root 67764 Sep 21 2022 mknod -rwxr-xr-x 1 root root 67596 Sep 21 2022 mktemp -rwxr-xr-x 1 root root 38504 Mar 23 2023 more -rwsr-xr-x 1 root root 38496 Mar 23 2023 mount -rwxr-xr-x 1 root root 9824 Mar 23 2023 mountpoint -rwxr-xr-x 1 root root 133532 Sep 21 2022 mv lrwxrwxrwx 1 root root 8 Dec 20 2022 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 3 2023 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 67608 Sep 21 2022 pwd lrwxrwxrwx 1 root root 4 Apr 24 2023 rbash -> bash -rwxr-xr-x 1 root root 67600 Sep 21 2022 readlink -rwxr-xr-x 1 root root 67672 Sep 21 2022 rm -rwxr-xr-x 1 root root 67600 Sep 21 2022 rmdir -rwxr-xr-x 1 root root 14152 Jul 29 2023 run-parts -rwxr-xr-x 1 root root 133372 Jan 6 2023 sed lrwxrwxrwx 1 root root 9 Feb 10 07:31 sh -> /bin/bash -rwxr-xr-x 1 root root 67584 Sep 21 2022 sleep -rwxr-xr-x 1 root root 67644 Sep 21 2022 stty -rwsr-xr-x 1 root root 50800 Mar 23 2023 su -rwxr-xr-x 1 root root 67584 Sep 21 2022 sync -rwxr-xr-x 1 root root 336764 Apr 7 2023 tar -rwxr-xr-x 1 root root 9800 Jul 29 2023 tempfile -rwxr-xr-x 1 root root 133224 Sep 21 2022 touch -rwxr-xr-x 1 root root 67548 Sep 21 2022 true -rwxr-xr-x 1 root root 9768 Mar 23 2023 ulockmgr_server -rwsr-xr-x 1 root root 22108 Mar 23 2023 umount -rwxr-xr-x 1 root root 67572 Sep 21 2022 uname -rwxr-xr-x 2 root root 2346 Apr 10 2022 uncompress -rwxr-xr-x 1 root root 133632 Sep 21 2022 vdir -rwxr-xr-x 1 root root 42608 Mar 23 2023 wdctl lrwxrwxrwx 1 root root 8 Dec 20 2022 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Apr 10 2022 zcat -rwxr-xr-x 1 root root 1678 Apr 10 2022 zcmp -rwxr-xr-x 1 root root 6460 Apr 10 2022 zdiff -rwxr-xr-x 1 root root 29 Apr 10 2022 zegrep -rwxr-xr-x 1 root root 29 Apr 10 2022 zfgrep -rwxr-xr-x 1 root root 2081 Apr 10 2022 zforce -rwxr-xr-x 1 root root 8103 Apr 10 2022 zgrep -rwxr-xr-x 1 root root 2206 Apr 10 2022 zless -rwxr-xr-x 1 root root 1842 Apr 10 2022 zmore -rwxr-xr-x 1 root root 4577 Apr 10 2022 znew I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: armhf Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19288 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm15{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libncurses6{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} libregexp-ipv6-perl{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpm2 libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 336 newly installed, 0 to remove and 0 not upgraded. Need to get 295 MB of archives. After unpacking 712 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bookworm/main armhf libpython3.11-minimal armhf 3.11.2-6 [798 kB] Get: 2 http://deb.debian.org/debian bookworm/main armhf libexpat1 armhf 2.5.0-1 [79.9 kB] Get: 3 http://deb.debian.org/debian bookworm/main armhf python3.11-minimal armhf 3.11.2-6 [1714 kB] Get: 4 http://deb.debian.org/debian bookworm/main armhf python3-minimal armhf 3.11.2-1+b1 [26.3 kB] Get: 5 http://deb.debian.org/debian bookworm/main armhf media-types all 10.0.0 [26.1 kB] Get: 6 http://deb.debian.org/debian bookworm/main armhf readline-common all 8.2-1.3 [69.0 kB] Get: 7 http://deb.debian.org/debian bookworm/main armhf libreadline8 armhf 8.2-1.3 [144 kB] Get: 8 http://deb.debian.org/debian bookworm/main armhf libpython3.11-stdlib armhf 3.11.2-6 [1678 kB] Get: 9 http://deb.debian.org/debian bookworm/main armhf python3.11 armhf 3.11.2-6 [572 kB] Get: 10 http://deb.debian.org/debian bookworm/main armhf libpython3-stdlib armhf 3.11.2-1+b1 [9296 B] Get: 11 http://deb.debian.org/debian bookworm/main armhf python3 armhf 3.11.2-1+b1 [26.3 kB] Get: 12 http://deb.debian.org/debian bookworm/main armhf netbase all 6.4 [12.8 kB] Get: 13 http://deb.debian.org/debian bookworm/main armhf sensible-utils all 0.0.17+nmu1 [19.0 kB] Get: 14 http://deb.debian.org/debian bookworm/main armhf openssl armhf 3.0.11-1~deb12u2 [1386 kB] Get: 15 http://deb.debian.org/debian bookworm/main armhf ca-certificates all 20230311 [153 kB] Get: 16 http://deb.debian.org/debian bookworm/main armhf libmagic-mgc armhf 1:5.44-3 [305 kB] Get: 17 http://deb.debian.org/debian bookworm/main armhf libmagic1 armhf 1:5.44-3 [96.5 kB] Get: 18 http://deb.debian.org/debian bookworm/main armhf file armhf 1:5.44-3 [41.6 kB] Get: 19 http://deb.debian.org/debian bookworm/main armhf gettext-base armhf 0.21-12 [157 kB] Get: 20 http://deb.debian.org/debian bookworm/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB] Get: 21 http://deb.debian.org/debian bookworm/main armhf groff-base armhf 1.22.4-10 [825 kB] Get: 22 http://deb.debian.org/debian bookworm/main armhf bsdextrautils armhf 2.38.1-5+b1 [78.6 kB] Get: 23 http://deb.debian.org/debian bookworm/main armhf libpipeline1 armhf 1.5.7-1 [33.6 kB] Get: 24 http://deb.debian.org/debian bookworm/main armhf man-db armhf 2.11.2-2 [1351 kB] Get: 25 http://deb.debian.org/debian bookworm/main armhf hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 26 http://deb.debian.org/debian bookworm/main armhf libgdk-pixbuf2.0-common all 2.42.10+dfsg-1 [306 kB] Get: 27 http://deb.debian.org/debian bookworm/main armhf libglib2.0-0 armhf 2.74.6-2 [1227 kB] Get: 28 http://deb.debian.org/debian bookworm/main armhf libicu72 armhf 72.1-3 [9048 kB] Get: 29 http://deb.debian.org/debian bookworm/main armhf libxml2 armhf 2.9.14+dfsg-1.3~deb12u1 [591 kB] Get: 30 http://deb.debian.org/debian bookworm/main armhf shared-mime-info armhf 2.2-1 [726 kB] Get: 31 http://deb.debian.org/debian bookworm/main armhf libjpeg62-turbo armhf 1:2.1.5-2 [143 kB] Get: 32 http://deb.debian.org/debian bookworm/main armhf libpng16-16 armhf 1.6.39-2 [260 kB] Get: 33 http://deb.debian.org/debian bookworm/main armhf libdeflate0 armhf 1.14-1 [52.2 kB] Get: 34 http://deb.debian.org/debian bookworm/main armhf libjbig0 armhf 2.1-6.1 [27.1 kB] Get: 35 http://deb.debian.org/debian bookworm/main armhf liblerc4 armhf 4.0.0+ds-2 [137 kB] Get: 36 http://deb.debian.org/debian bookworm/main armhf libwebp7 armhf 1.2.4-0.2+deb12u1 [242 kB] Get: 37 http://deb.debian.org/debian bookworm/main armhf libtiff6 armhf 4.5.0-6+deb12u1 [295 kB] Get: 38 http://deb.debian.org/debian bookworm/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.10+dfsg-1+b1 [124 kB] Get: 39 http://deb.debian.org/debian bookworm/main armhf gtk-update-icon-cache armhf 3.24.38-2~deb12u1 [43.1 kB] Get: 40 http://deb.debian.org/debian bookworm/main armhf adwaita-icon-theme all 43-1 [5124 kB] Get: 41 http://deb.debian.org/debian bookworm/main armhf ca-certificates-java all 20230710~deb12u1 [11.9 kB] Get: 42 http://deb.debian.org/debian bookworm/main armhf java-common all 0.74 [6388 B] Get: 43 http://deb.debian.org/debian bookworm/main armhf libavahi-common-data armhf 0.8-10 [107 kB] Get: 44 http://deb.debian.org/debian bookworm/main armhf libavahi-common3 armhf 0.8-10 [38.3 kB] Get: 45 http://deb.debian.org/debian bookworm/main armhf libdbus-1-3 armhf 1.14.10-1~deb12u1 [178 kB] Get: 46 http://deb.debian.org/debian bookworm/main armhf libavahi-client3 armhf 0.8-10 [41.6 kB] Get: 47 http://deb.debian.org/debian bookworm/main armhf libcups2 armhf 2.4.2-3+deb12u5 [210 kB] Get: 48 http://deb.debian.org/debian bookworm/main armhf liblcms2-2 armhf 2.14-2 [125 kB] Get: 49 http://deb.debian.org/debian bookworm/main armhf libbrotli1 armhf 1.0.9-2+b6 [271 kB] Get: 50 http://deb.debian.org/debian bookworm/main armhf libfreetype6 armhf 2.12.1+dfsg-5 [332 kB] Get: 51 http://deb.debian.org/debian bookworm/main armhf fonts-dejavu-core all 2.37-6 [1068 kB] Get: 52 http://deb.debian.org/debian bookworm/main armhf fontconfig-config armhf 2.14.1-4 [315 kB] Get: 53 http://deb.debian.org/debian bookworm/main armhf libfontconfig1 armhf 2.14.1-4 [368 kB] Get: 54 http://deb.debian.org/debian bookworm/main armhf libnspr4 armhf 2:4.35-1 [91.5 kB] Get: 55 http://deb.debian.org/debian bookworm/main armhf libnss3 armhf 2:3.87.1-1 [1122 kB] Get: 56 http://deb.debian.org/debian bookworm/main armhf libasound2-data all 1.2.8-1 [20.5 kB] Get: 57 http://deb.debian.org/debian bookworm/main armhf libasound2 armhf 1.2.8-1+b1 [309 kB] Get: 58 http://deb.debian.org/debian bookworm/main armhf libgraphite2-3 armhf 1.3.14-1 [70.5 kB] Get: 59 http://deb.debian.org/debian bookworm/main armhf libharfbuzz0b armhf 6.0.0+dfsg-3 [1893 kB] Get: 60 http://deb.debian.org/debian bookworm/main armhf libpcsclite1 armhf 1.9.9-2 [46.8 kB] Get: 61 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jre-headless armhf 17.0.9+9-1~deb12u1 [38.1 MB] Get: 62 http://deb.debian.org/debian bookworm/main armhf default-jre-headless armhf 2:1.17-74 [2932 B] Get: 63 http://deb.debian.org/debian bookworm/main armhf ant all 1.10.13-1 [2161 kB] Get: 64 http://deb.debian.org/debian bookworm/main armhf ant-optional all 1.10.13-1 [449 kB] Get: 65 http://deb.debian.org/debian bookworm/main armhf libantlr-java all 2.7.7+dfsg-12 [458 kB] Get: 66 http://deb.debian.org/debian bookworm/main armhf antlr all 2.7.7+dfsg-12 [14.3 kB] Get: 67 http://deb.debian.org/debian bookworm/main armhf at-spi2-common all 2.46.0-5 [162 kB] Get: 68 http://deb.debian.org/debian bookworm/main armhf m4 armhf 1.4.19-3 [265 kB] Get: 69 http://deb.debian.org/debian bookworm/main armhf autoconf all 2.71-3 [332 kB] Get: 70 http://deb.debian.org/debian bookworm/main armhf autotools-dev all 20220109.1 [51.6 kB] Get: 71 http://deb.debian.org/debian bookworm/main armhf automake all 1:1.16.5-1.3 [823 kB] Get: 72 http://deb.debian.org/debian bookworm/main armhf autopoint all 0.21-12 [495 kB] Get: 73 http://deb.debian.org/debian bookworm/main armhf unzip armhf 6.0-28 [152 kB] Get: 74 http://deb.debian.org/debian bookworm/main armhf java-wrappers all 0.4 [8916 B] Get: 75 http://deb.debian.org/debian bookworm/main armhf libhamcrest-java all 2.2-1 [121 kB] Get: 76 http://deb.debian.org/debian bookworm/main armhf junit4 all 4.13.2-3 [348 kB] Get: 77 http://deb.debian.org/debian bookworm/main armhf libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 78 http://deb.debian.org/debian bookworm/main armhf libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 79 http://deb.debian.org/debian bookworm/main armhf libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 80 http://deb.debian.org/debian bookworm/main armhf libosgi-core-java all 8.0.0-2 [182 kB] Get: 81 http://deb.debian.org/debian bookworm/main armhf libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 82 http://deb.debian.org/debian bookworm/main armhf libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 83 http://deb.debian.org/debian bookworm/main armhf libjansi-native-java all 1.8-1 [26.0 kB] Get: 84 http://deb.debian.org/debian bookworm/main armhf libjansi1-java all 1.18-3 [66.5 kB] Get: 85 http://deb.debian.org/debian bookworm/main armhf libjline2-java all 2.14.6-5 [151 kB] Get: 86 http://deb.debian.org/debian bookworm/main armhf libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 87 http://deb.debian.org/debian bookworm/main armhf libslf4j-java all 1.7.32-1 [144 kB] Get: 88 http://deb.debian.org/debian bookworm/main armhf libxz-java all 1.9-1 [143 kB] Get: 89 http://deb.debian.org/debian bookworm/main armhf libyaml-snake-java all 1.33-2 [321 kB] Get: 90 http://deb.debian.org/debian bookworm/main armhf bnd all 5.0.1-3 [9915 kB] Get: 91 http://deb.debian.org/debian bookworm/main armhf dctrl-tools armhf 2.24-3 [96.0 kB] Get: 92 http://deb.debian.org/debian bookworm/main armhf libdebhelper-perl all 13.11.4 [81.2 kB] Get: 93 http://deb.debian.org/debian bookworm/main armhf libtool all 2.4.7-5 [517 kB] Get: 94 http://deb.debian.org/debian bookworm/main armhf dh-autoreconf all 20 [17.1 kB] Get: 95 http://deb.debian.org/debian bookworm/main armhf libarchive-zip-perl all 1.68-1 [104 kB] Get: 96 http://deb.debian.org/debian bookworm/main armhf libsub-override-perl all 0.09-4 [9304 B] Get: 97 http://deb.debian.org/debian bookworm/main armhf libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 98 http://deb.debian.org/debian bookworm/main armhf dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 99 http://deb.debian.org/debian bookworm/main armhf libelf1 armhf 0.188-2.1 [170 kB] Get: 100 http://deb.debian.org/debian bookworm/main armhf dwz armhf 0.15-1 [101 kB] Get: 101 http://deb.debian.org/debian bookworm/main armhf gettext armhf 0.21-12 [1229 kB] Get: 102 http://deb.debian.org/debian bookworm/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 103 http://deb.debian.org/debian bookworm/main armhf po-debconf all 1.0.21+nmu1 [248 kB] Get: 104 http://deb.debian.org/debian bookworm/main armhf debhelper all 13.11.4 [942 kB] Get: 105 http://deb.debian.org/debian bookworm/main armhf libgtk2.0-common all 2.24.33-2 [2700 kB] Get: 106 http://deb.debian.org/debian bookworm/main armhf libatk1.0-0 armhf 2.46.0-5 [42.4 kB] Get: 107 http://deb.debian.org/debian bookworm/main armhf libpixman-1-0 armhf 0.42.2-1 [465 kB] Get: 108 http://deb.debian.org/debian bookworm/main armhf libxau6 armhf 1:1.0.9-1 [19.0 kB] Get: 109 http://deb.debian.org/debian bookworm/main armhf libbsd0 armhf 0.11.7-2 [113 kB] Get: 110 http://deb.debian.org/debian bookworm/main armhf libxdmcp6 armhf 1:1.1.2-3 [24.9 kB] Get: 111 http://deb.debian.org/debian bookworm/main armhf libxcb1 armhf 1.15-1 [140 kB] Get: 112 http://deb.debian.org/debian bookworm/main armhf libx11-data all 2:1.8.4-2+deb12u2 [292 kB] Get: 113 http://deb.debian.org/debian bookworm/main armhf libx11-6 armhf 2:1.8.4-2+deb12u2 [695 kB] Get: 114 http://deb.debian.org/debian bookworm/main armhf libxcb-render0 armhf 1.15-1 [114 kB] Get: 115 http://deb.debian.org/debian bookworm/main armhf libxcb-shm0 armhf 1.15-1 [106 kB] Get: 116 http://deb.debian.org/debian bookworm/main armhf libxext6 armhf 2:1.3.4-1+b1 [47.8 kB] Get: 117 http://deb.debian.org/debian bookworm/main armhf libxrender1 armhf 1:0.9.10-1.1 [30.1 kB] Get: 118 http://deb.debian.org/debian bookworm/main armhf libcairo2 armhf 1.16.0-7 [493 kB] Get: 119 http://deb.debian.org/debian bookworm/main armhf fontconfig armhf 2.14.1-4 [448 kB] Get: 120 http://deb.debian.org/debian bookworm/main armhf libfribidi0 armhf 1.0.8-2.1 [63.1 kB] Get: 121 http://deb.debian.org/debian bookworm/main armhf libthai-data all 0.1.29-1 [176 kB] Get: 122 http://deb.debian.org/debian bookworm/main armhf libdatrie1 armhf 0.2.13-2+b1 [39.9 kB] Get: 123 http://deb.debian.org/debian bookworm/main armhf libthai0 armhf 0.1.29-1 [54.3 kB] Get: 124 http://deb.debian.org/debian bookworm/main armhf libpango-1.0-0 armhf 1.50.12+ds-1 [188 kB] Get: 125 http://deb.debian.org/debian bookworm/main armhf libpangoft2-1.0-0 armhf 1.50.12+ds-1 [40.9 kB] Get: 126 http://deb.debian.org/debian bookworm/main armhf libpangocairo-1.0-0 armhf 1.50.12+ds-1 [30.3 kB] Get: 127 http://deb.debian.org/debian bookworm/main armhf libxcomposite1 armhf 1:0.4.5-1 [16.1 kB] Get: 128 http://deb.debian.org/debian bookworm/main armhf libxfixes3 armhf 1:6.0.0-2 [21.1 kB] Get: 129 http://deb.debian.org/debian bookworm/main armhf libxcursor1 armhf 1:1.2.1-1 [37.9 kB] Get: 130 http://deb.debian.org/debian bookworm/main armhf libxdamage1 armhf 1:1.1.6-1 [14.6 kB] Get: 131 http://deb.debian.org/debian bookworm/main armhf libxi6 armhf 2:1.8-1+b1 [78.6 kB] Get: 132 http://deb.debian.org/debian bookworm/main armhf libxinerama1 armhf 2:1.1.4-3 [17.4 kB] Get: 133 http://deb.debian.org/debian bookworm/main armhf libxrandr2 armhf 2:1.5.2-2+b1 [36.0 kB] Get: 134 http://deb.debian.org/debian bookworm/main armhf libgtk2.0-0 armhf 2.24.33-2 [1588 kB] Get: 135 http://deb.debian.org/debian bookworm/main armhf libglvnd0 armhf 1.6.0-1 [51.9 kB] Get: 136 http://deb.debian.org/debian bookworm/main armhf libdrm-common all 2.4.114-1 [7112 B] Get: 137 http://deb.debian.org/debian bookworm/main armhf libdrm2 armhf 2.4.114-1+b1 [33.0 kB] Get: 138 http://deb.debian.org/debian bookworm/main armhf libglapi-mesa armhf 22.3.6-1+deb12u1 [41.0 kB] Get: 139 http://deb.debian.org/debian bookworm/main armhf libx11-xcb1 armhf 2:1.8.4-2+deb12u2 [192 kB] Get: 140 http://deb.debian.org/debian bookworm/main armhf libxcb-dri2-0 armhf 1.15-1 [107 kB] Get: 141 http://deb.debian.org/debian bookworm/main armhf libxcb-dri3-0 armhf 1.15-1 [107 kB] Get: 142 http://deb.debian.org/debian bookworm/main armhf libxcb-glx0 armhf 1.15-1 [120 kB] Get: 143 http://deb.debian.org/debian bookworm/main armhf libxcb-present0 armhf 1.15-1 [105 kB] Get: 144 http://deb.debian.org/debian bookworm/main armhf libxcb-randr0 armhf 1.15-1 [116 kB] Get: 145 http://deb.debian.org/debian bookworm/main armhf libxcb-sync1 armhf 1.15-1 [108 kB] Get: 146 http://deb.debian.org/debian bookworm/main armhf libxcb-xfixes0 armhf 1.15-1 [110 kB] Get: 147 http://deb.debian.org/debian bookworm/main armhf libxshmfence1 armhf 1.3-1 [8592 B] Get: 148 http://deb.debian.org/debian bookworm/main armhf libxxf86vm1 armhf 1:1.1.4-1+b2 [20.2 kB] Get: 149 http://deb.debian.org/debian bookworm/main armhf libdrm-amdgpu1 armhf 2.4.114-1+b1 [19.3 kB] Get: 150 http://deb.debian.org/debian bookworm/main armhf libdrm-nouveau2 armhf 2.4.114-1+b1 [16.7 kB] Get: 151 http://deb.debian.org/debian bookworm/main armhf libdrm-radeon1 armhf 2.4.114-1+b1 [19.3 kB] Get: 152 http://deb.debian.org/debian bookworm/main armhf libedit2 armhf 3.1-20221030-2 [77.0 kB] Get: 153 http://deb.debian.org/debian bookworm/main armhf libz3-4 armhf 4.8.12-3.1 [6061 kB] Get: 154 http://deb.debian.org/debian bookworm/main armhf libllvm15 armhf 1:15.0.6-4+b1 [20.5 MB] Get: 155 http://deb.debian.org/debian bookworm/main armhf libsensors-config all 1:3.6.0-7.1 [14.3 kB] Get: 156 http://deb.debian.org/debian bookworm/main armhf libsensors5 armhf 1:3.6.0-7.1 [31.6 kB] Get: 157 http://deb.debian.org/debian bookworm/main armhf libgl1-mesa-dri armhf 22.3.6-1+deb12u1 [5792 kB] Get: 158 http://deb.debian.org/debian bookworm/main armhf libglx-mesa0 armhf 22.3.6-1+deb12u1 [126 kB] Get: 159 http://deb.debian.org/debian bookworm/main armhf libglx0 armhf 1.6.0-1 [32.0 kB] Get: 160 http://deb.debian.org/debian bookworm/main armhf libgl1 armhf 1.6.0-1 [90.6 kB] Get: 161 http://deb.debian.org/debian bookworm/main armhf libgif7 armhf 5.2.1-2.5 [44.4 kB] Get: 162 http://deb.debian.org/debian bookworm/main armhf x11-common all 1:7.7+23 [252 kB] Get: 163 http://deb.debian.org/debian bookworm/main armhf libxtst6 armhf 2:1.2.3-1.1 [26.2 kB] Get: 164 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jre armhf 17.0.9+9-1~deb12u1 [162 kB] Get: 165 http://deb.debian.org/debian bookworm/main armhf default-jre armhf 2:1.17-74 [1056 B] Get: 166 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jdk-headless armhf 17.0.9+9-1~deb12u1 [67.4 MB] Get: 167 http://deb.debian.org/debian bookworm/main armhf default-jdk-headless armhf 2:1.17-74 [1108 B] Get: 168 http://deb.debian.org/debian bookworm/main armhf openjdk-17-jdk armhf 17.0.9+9-1~deb12u1 [2348 kB] Get: 169 http://deb.debian.org/debian bookworm/main armhf default-jdk armhf 2:1.17-74 [1068 B] Get: 170 http://deb.debian.org/debian bookworm/main armhf libassuan0 armhf 2.5.5-5 [42.0 kB] Get: 171 http://deb.debian.org/debian bookworm/main armhf gpgconf armhf 2.2.40-1.1 [547 kB] Get: 172 http://deb.debian.org/debian bookworm/main armhf libksba8 armhf 1.6.3-2 [109 kB] Get: 173 http://deb.debian.org/debian bookworm/main armhf libsasl2-modules-db armhf 2.1.28+dfsg-10 [19.0 kB] Get: 174 http://deb.debian.org/debian bookworm/main armhf libsasl2-2 armhf 2.1.28+dfsg-10 [52.3 kB] Get: 175 http://deb.debian.org/debian bookworm/main armhf libldap-2.5-0 armhf 2.5.13+dfsg-5 [158 kB] Get: 176 http://deb.debian.org/debian bookworm/main armhf libnpth0 armhf 1.6-3 [17.8 kB] Get: 177 http://deb.debian.org/debian bookworm/main armhf dirmngr armhf 2.2.40-1.1 [748 kB] Get: 178 http://deb.debian.org/debian bookworm/main armhf gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 179 http://deb.debian.org/debian bookworm/main armhf gnupg-utils armhf 2.2.40-1.1 [850 kB] Get: 180 http://deb.debian.org/debian bookworm/main armhf gpg armhf 2.2.40-1.1 [884 kB] Get: 181 http://deb.debian.org/debian bookworm/main armhf pinentry-curses armhf 1.2.1-1 [73.4 kB] Get: 182 http://deb.debian.org/debian bookworm/main armhf gpg-agent armhf 2.2.40-1.1 [652 kB] Get: 183 http://deb.debian.org/debian bookworm/main armhf gpg-wks-client armhf 2.2.40-1.1 [524 kB] Get: 184 http://deb.debian.org/debian bookworm/main armhf gpg-wks-server armhf 2.2.40-1.1 [517 kB] Get: 185 http://deb.debian.org/debian bookworm/main armhf gpgsm armhf 2.2.40-1.1 [637 kB] Get: 186 http://deb.debian.org/debian bookworm/main armhf gnupg all 2.2.40-1.1 [846 kB] Get: 187 http://deb.debian.org/debian bookworm/main armhf libfile-dirlist-perl all 0.05-3 [7600 B] Get: 188 http://deb.debian.org/debian bookworm/main armhf libfile-which-perl all 1.27-2 [15.1 kB] Get: 189 http://deb.debian.org/debian bookworm/main armhf libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 190 http://deb.debian.org/debian bookworm/main armhf libfile-touch-perl all 0.12-2 [8816 B] Get: 191 http://deb.debian.org/debian bookworm/main armhf libio-pty-perl armhf 1:1.17-1 [34.5 kB] Get: 192 http://deb.debian.org/debian bookworm/main armhf libipc-run-perl all 20220807.0-1 [104 kB] Get: 193 http://deb.debian.org/debian bookworm/main armhf libclass-method-modifiers-perl all 2.14-1 [18.1 kB] Get: 194 http://deb.debian.org/debian bookworm/main armhf libclass-xsaccessor-perl armhf 1.19-4+b1 [35.5 kB] Get: 195 http://deb.debian.org/debian bookworm/main armhf libb-hooks-op-check-perl armhf 0.22-2+b1 [10.3 kB] Get: 196 http://deb.debian.org/debian bookworm/main armhf libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 197 http://deb.debian.org/debian bookworm/main armhf libdevel-callchecker-perl armhf 0.008-2 [15.7 kB] Get: 198 http://deb.debian.org/debian bookworm/main armhf libparams-classify-perl armhf 0.015-2+b1 [21.9 kB] Get: 199 http://deb.debian.org/debian bookworm/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 200 http://deb.debian.org/debian bookworm/main armhf libimport-into-perl all 1.002005-2 [11.3 kB] Get: 201 http://deb.debian.org/debian bookworm/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 202 http://deb.debian.org/debian bookworm/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 203 http://deb.debian.org/debian bookworm/main armhf libmoo-perl all 2.005005-1 [58.0 kB] Get: 204 http://deb.debian.org/debian bookworm/main armhf libencode-locale-perl all 1.05-3 [12.9 kB] Get: 205 http://deb.debian.org/debian bookworm/main armhf libtimedate-perl all 2.3300-2 [39.3 kB] Get: 206 http://deb.debian.org/debian bookworm/main armhf libhttp-date-perl all 6.05-2 [10.5 kB] Get: 207 http://deb.debian.org/debian bookworm/main armhf libfile-listing-perl all 6.15-1 [12.6 kB] Get: 208 http://deb.debian.org/debian bookworm/main armhf libhtml-tagset-perl all 3.20-6 [11.7 kB] Get: 209 http://deb.debian.org/debian bookworm/main armhf libregexp-ipv6-perl all 0.03-3 [5212 B] Get: 210 http://deb.debian.org/debian bookworm/main armhf liburi-perl all 5.17-1 [90.4 kB] Get: 211 http://deb.debian.org/debian bookworm/main armhf libhtml-parser-perl armhf 3.81-1 [97.4 kB] Get: 212 http://deb.debian.org/debian bookworm/main armhf libhtml-tree-perl all 5.07-3 [211 kB] Get: 213 http://deb.debian.org/debian bookworm/main armhf libclone-perl armhf 0.46-1 [13.1 kB] Get: 214 http://deb.debian.org/debian bookworm/main armhf libio-html-perl all 1.004-3 [16.2 kB] Get: 215 http://deb.debian.org/debian bookworm/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 216 http://deb.debian.org/debian bookworm/main armhf libhttp-message-perl all 6.44-1 [81.7 kB] Get: 217 http://deb.debian.org/debian bookworm/main armhf libhttp-cookies-perl all 6.10-1 [19.6 kB] Get: 218 http://deb.debian.org/debian bookworm/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 219 http://deb.debian.org/debian bookworm/main armhf perl-openssl-defaults armhf 7+b1 [7916 B] Get: 220 http://deb.debian.org/debian bookworm/main armhf libnet-ssleay-perl armhf 1.92-2+b1 [298 kB] Get: 221 http://deb.debian.org/debian bookworm/main armhf libio-socket-ssl-perl all 2.081-2 [219 kB] Get: 222 http://deb.debian.org/debian bookworm/main armhf libnet-http-perl all 6.22-1 [25.3 kB] Get: 223 http://deb.debian.org/debian bookworm/main armhf liblwp-protocol-https-perl all 6.10-1 [12.2 kB] Get: 224 http://deb.debian.org/debian bookworm/main armhf libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 225 http://deb.debian.org/debian bookworm/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 226 http://deb.debian.org/debian bookworm/main armhf libwww-perl all 6.68-1 [186 kB] Get: 227 http://deb.debian.org/debian bookworm/main armhf patchutils armhf 0.4.2-1 [72.5 kB] Get: 228 http://deb.debian.org/debian bookworm/main armhf wdiff armhf 1.2.2-5 [118 kB] Get: 229 http://deb.debian.org/debian bookworm/main armhf devscripts armhf 2.23.4+deb12u1 [1072 kB] Get: 230 http://deb.debian.org/debian bookworm/main armhf ivy all 2.5.1-2 [1288 kB] Get: 231 http://deb.debian.org/debian bookworm/main armhf libasm-java all 9.4-1 [389 kB] Get: 232 http://deb.debian.org/debian bookworm/main armhf libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 233 http://deb.debian.org/debian bookworm/main armhf libcommons-cli-java all 1.5.0-1 [60.0 kB] Get: 234 http://deb.debian.org/debian bookworm/main armhf libapache-pom-java all 29-2 [5276 B] Get: 235 http://deb.debian.org/debian bookworm/main armhf libcommons-parent-java all 56-1 [10.8 kB] Get: 236 http://deb.debian.org/debian bookworm/main armhf libcommons-logging-java all 1.2-3 [62.4 kB] Get: 237 http://deb.debian.org/debian bookworm/main armhf libjansi-java all 2.4.0-2 [105 kB] Get: 238 http://deb.debian.org/debian bookworm/main armhf libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 239 http://deb.debian.org/debian bookworm/main armhf libqdox-java all 1.12.1-3 [172 kB] Get: 240 http://deb.debian.org/debian bookworm/main armhf libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 241 http://deb.debian.org/debian bookworm/main armhf libxpp3-java all 1.1.4c-3 [292 kB] Get: 242 http://deb.debian.org/debian bookworm/main armhf libxstream-java all 1.4.20-1 [565 kB] Get: 243 http://deb.debian.org/debian bookworm/main armhf groovy all 2.4.21-8 [12.9 MB] Get: 244 http://deb.debian.org/debian bookworm/main armhf libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 245 http://deb.debian.org/debian bookworm/main armhf libcommons-collections3-java all 3.2.2-2 [526 kB] Get: 246 http://deb.debian.org/debian bookworm/main armhf libcommons-compress-java all 1.22-1 [615 kB] Get: 247 http://deb.debian.org/debian bookworm/main armhf libcommons-io-java all 2.11.0-2 [319 kB] Get: 248 http://deb.debian.org/debian bookworm/main armhf libcommons-lang-java all 2.6-10 [273 kB] Get: 249 http://deb.debian.org/debian bookworm/main armhf liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 250 http://deb.debian.org/debian bookworm/main armhf libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 251 http://deb.debian.org/debian bookworm/main armhf libguava-java all 31.1-1 [2613 kB] Get: 252 http://deb.debian.org/debian bookworm/main armhf libcommons-codec-java all 1.15-1 [292 kB] Get: 253 http://deb.debian.org/debian bookworm/main armhf libhttpcore-java all 4.4.16-1 [636 kB] Get: 254 http://deb.debian.org/debian bookworm/main armhf libhttpclient-java all 4.5.14-1 [1247 kB] Get: 255 http://deb.debian.org/debian bookworm/main armhf libjarjar-java all 1.4+svn142-12 [205 kB] Get: 256 http://deb.debian.org/debian bookworm/main armhf libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 257 http://deb.debian.org/debian bookworm/main armhf libjna-jni armhf 5.13.0-2 [59.3 kB] Get: 258 http://deb.debian.org/debian bookworm/main armhf libjna-java all 5.13.0-2 [236 kB] Get: 259 http://deb.debian.org/debian bookworm/main armhf libjzlib-java all 1.1.3-2 [80.0 kB] Get: 260 http://deb.debian.org/debian bookworm/main armhf libjsch-java all 0.1.55-1 [298 kB] Get: 261 http://deb.debian.org/debian bookworm/main armhf libminlog-java all 1.3.0-1.1 [7928 B] Get: 262 http://deb.debian.org/debian bookworm/main armhf libobjenesis-java all 3.3-3 [41.3 kB] Get: 263 http://deb.debian.org/debian bookworm/main armhf libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 264 http://deb.debian.org/debian bookworm/main armhf libkryo-java all 2.20-7 [158 kB] Get: 265 http://deb.debian.org/debian bookworm/main armhf liblogback-java all 1:1.2.11-3 [700 kB] Get: 266 http://deb.debian.org/debian bookworm/main armhf libncurses6 armhf 6.4-4 [81.1 kB] Get: 267 http://deb.debian.org/debian bookworm/main armhf libnative-platform-jni armhf 0.14-5 [11.6 kB] Get: 268 http://deb.debian.org/debian bookworm/main armhf libnative-platform-java all 0.14-5 [71.0 kB] Get: 269 http://deb.debian.org/debian bookworm/main armhf libxml-commons-external-java all 1.4.01-5 [240 kB] Get: 270 http://deb.debian.org/debian bookworm/main armhf libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 271 http://deb.debian.org/debian bookworm/main armhf libxerces2-java all 2.12.2-1 [1440 kB] Get: 272 http://deb.debian.org/debian bookworm/main armhf libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 273 http://deb.debian.org/debian bookworm/main armhf libxbean-reflect-java all 4.5-8 [133 kB] Get: 274 http://deb.debian.org/debian bookworm/main armhf libgradle-core-java all 4.4.1-18 [4286 kB] Get: 275 http://deb.debian.org/debian bookworm/main armhf libbcprov-java all 1.72-2 [8225 kB] Get: 276 http://deb.debian.org/debian bookworm/main armhf libbcpg-java all 1.72-2 [383 kB] Get: 277 http://deb.debian.org/debian bookworm/main armhf libbsh-java all 2.0b4-20 [291 kB] Get: 278 http://deb.debian.org/debian bookworm/main armhf libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 279 http://deb.debian.org/debian bookworm/main armhf libjaxen-java all 1.1.6-4 [214 kB] Get: 280 http://deb.debian.org/debian bookworm/main armhf libdom4j-java all 2.1.3-2 [310 kB] Get: 281 http://deb.debian.org/debian bookworm/main armhf libbcel-java all 6.5.0-2 [634 kB] Get: 282 http://deb.debian.org/debian bookworm/main armhf libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 283 http://deb.debian.org/debian bookworm/main armhf libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 284 http://deb.debian.org/debian bookworm/main armhf libgoogle-gson-java all 2.10-1 [261 kB] Get: 285 http://deb.debian.org/debian bookworm/main armhf libaopalliance-java all 20070526-7 [8572 B] Get: 286 http://deb.debian.org/debian bookworm/main armhf libguice-java all 4.2.3-2 [1435 kB] Get: 287 http://deb.debian.org/debian bookworm/main armhf libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 288 http://deb.debian.org/debian bookworm/main armhf libjcifs-java all 1.3.19-2 [394 kB] Get: 289 http://deb.debian.org/debian bookworm/main armhf libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 290 http://deb.debian.org/debian bookworm/main armhf libjavaewah-java all 1.1.7-1 [156 kB] Get: 291 http://deb.debian.org/debian bookworm/main armhf libel-api-java all 3.0.0-3 [64.9 kB] Get: 292 http://deb.debian.org/debian bookworm/main armhf libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 293 http://deb.debian.org/debian bookworm/main armhf libjetty9-java all 9.4.50-4+deb12u2 [2981 kB] Get: 294 http://deb.debian.org/debian bookworm/main armhf libjgit-java all 4.11.9-2 [2534 kB] Get: 295 http://deb.debian.org/debian bookworm/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 296 http://deb.debian.org/debian bookworm/main armhf libcommons-lang3-java all 3.12.0-2 [561 kB] Get: 297 http://deb.debian.org/debian bookworm/main armhf libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 298 http://deb.debian.org/debian bookworm/main armhf libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 299 http://deb.debian.org/debian bookworm/main armhf libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 300 http://deb.debian.org/debian bookworm/main armhf libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 301 http://deb.debian.org/debian bookworm/main armhf libmaven-parent-java all 35-1 [6140 B] Get: 302 http://deb.debian.org/debian bookworm/main armhf libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 303 http://deb.debian.org/debian bookworm/main armhf libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 304 http://deb.debian.org/debian bookworm/main armhf libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 305 http://deb.debian.org/debian bookworm/main armhf libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 306 http://deb.debian.org/debian bookworm/main armhf libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 307 http://deb.debian.org/debian bookworm/main armhf libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 308 http://deb.debian.org/debian bookworm/main armhf libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 309 http://deb.debian.org/debian bookworm/main armhf libcdi-api-java all 1.2-3 [54.3 kB] Get: 310 http://deb.debian.org/debian bookworm/main armhf libsisu-inject-java all 0.3.4-2 [347 kB] Get: 311 http://deb.debian.org/debian bookworm/main armhf libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 312 http://deb.debian.org/debian bookworm/main armhf libmaven3-core-java all 3.8.7-1 [1572 kB] Get: 313 http://deb.debian.org/debian bookworm/main armhf libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 314 http://deb.debian.org/debian bookworm/main armhf libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 315 http://deb.debian.org/debian bookworm/main armhf librhino-java all 1.7.14-2.1 [1357 kB] Get: 316 http://deb.debian.org/debian bookworm/main armhf libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 317 http://deb.debian.org/debian bookworm/main armhf libwagon-file-java all 3.5.3-1 [8388 B] Get: 318 http://deb.debian.org/debian bookworm/main armhf libjsoup-java all 1.15.3-1 [431 kB] Get: 319 http://deb.debian.org/debian bookworm/main armhf libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 320 http://deb.debian.org/debian bookworm/main armhf libjcommander-java all 1.71-4 [73.0 kB] Get: 321 http://deb.debian.org/debian bookworm/main armhf testng all 6.9.12-4 [795 kB] Get: 322 http://deb.debian.org/debian bookworm/main armhf libgradle-plugins-java all 4.4.1-18 [5212 kB] Get: 323 http://deb.debian.org/debian bookworm/main armhf gradle all 4.4.1-18 [398 kB] Get: 324 http://deb.debian.org/debian bookworm/main armhf maven-repo-helper all 1.11 [142 kB] Get: 325 http://deb.debian.org/debian bookworm/main armhf gradle-debian-helper all 2.4 [24.5 kB] Get: 326 http://deb.debian.org/debian bookworm/main armhf javahelper all 0.78 [97.2 kB] Get: 327 http://deb.debian.org/debian bookworm/main armhf libbyte-buddy-java all 1.12.21-1 [4393 kB] Get: 328 http://deb.debian.org/debian bookworm/main armhf libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 329 http://deb.debian.org/debian bookworm/main armhf libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 330 http://deb.debian.org/debian bookworm/main armhf libjackson2-core-java all 2.14.1-1 [447 kB] Get: 331 http://deb.debian.org/debian bookworm/main armhf libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 332 http://deb.debian.org/debian bookworm/main armhf liblz4-jni armhf 1.8.0-3 [9248 B] Get: 333 http://deb.debian.org/debian bookworm/main armhf liblz4-java all 1.8.0-3 [114 kB] Get: 334 http://deb.debian.org/debian bookworm/main armhf libmockito-java all 2.23.0-2 [479 kB] Get: 335 http://deb.debian.org/debian bookworm/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 336 http://deb.debian.org/debian bookworm/main armhf libtrove3-java all 3.0.3-5 [2146 kB] Fetched 295 MB in 40s (7345 kB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:armhf. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19288 files and directories currently installed.) Preparing to unpack .../libpython3.11-minimal_3.11.2-6_armhf.deb ... Unpacking libpython3.11-minimal:armhf (3.11.2-6) ... Selecting previously unselected package libexpat1:armhf. Preparing to unpack .../libexpat1_2.5.0-1_armhf.deb ... Unpacking libexpat1:armhf (2.5.0-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.2-6_armhf.deb ... Unpacking python3.11-minimal (3.11.2-6) ... Setting up libpython3.11-minimal:armhf (3.11.2-6) ... Setting up libexpat1:armhf (2.5.0-1) ... Setting up python3.11-minimal (3.11.2-6) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.2-1+b1_armhf.deb ... Unpacking python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.0.0_all.deb ... Unpacking media-types (10.0.0) ... Selecting previously unselected package readline-common. Preparing to unpack .../2-readline-common_8.2-1.3_all.deb ... Unpacking readline-common (8.2-1.3) ... Selecting previously unselected package libreadline8:armhf. Preparing to unpack .../3-libreadline8_8.2-1.3_armhf.deb ... Unpacking libreadline8:armhf (8.2-1.3) ... Selecting previously unselected package libpython3.11-stdlib:armhf. Preparing to unpack .../4-libpython3.11-stdlib_3.11.2-6_armhf.deb ... Unpacking libpython3.11-stdlib:armhf (3.11.2-6) ... Selecting previously unselected package python3.11. Preparing to unpack .../5-python3.11_3.11.2-6_armhf.deb ... Unpacking python3.11 (3.11.2-6) ... Selecting previously unselected package libpython3-stdlib:armhf. Preparing to unpack .../6-libpython3-stdlib_3.11.2-1+b1_armhf.deb ... Unpacking libpython3-stdlib:armhf (3.11.2-1+b1) ... Setting up python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20038 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.2-1+b1_armhf.deb ... Unpacking python3 (3.11.2-1+b1) ... Selecting previously unselected package netbase. Preparing to unpack .../001-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../002-sensible-utils_0.0.17+nmu1_all.deb ... Unpacking sensible-utils (0.0.17+nmu1) ... Selecting previously unselected package openssl. Preparing to unpack .../003-openssl_3.0.11-1~deb12u2_armhf.deb ... Unpacking openssl (3.0.11-1~deb12u2) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../004-ca-certificates_20230311_all.deb ... Unpacking ca-certificates (20230311) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../005-libmagic-mgc_1%3a5.44-3_armhf.deb ... Unpacking libmagic-mgc (1:5.44-3) ... Selecting previously unselected package libmagic1:armhf. Preparing to unpack .../006-libmagic1_1%3a5.44-3_armhf.deb ... Unpacking libmagic1:armhf (1:5.44-3) ... Selecting previously unselected package file. Preparing to unpack .../007-file_1%3a5.44-3_armhf.deb ... Unpacking file (1:5.44-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../008-gettext-base_0.21-12_armhf.deb ... Unpacking gettext-base (0.21-12) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../009-libuchardet0_0.0.7-1_armhf.deb ... Unpacking libuchardet0:armhf (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../010-groff-base_1.22.4-10_armhf.deb ... Unpacking groff-base (1.22.4-10) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../011-bsdextrautils_2.38.1-5+b1_armhf.deb ... Unpacking bsdextrautils (2.38.1-5+b1) ... Selecting previously unselected package libpipeline1:armhf. Preparing to unpack .../012-libpipeline1_1.5.7-1_armhf.deb ... Unpacking libpipeline1:armhf (1.5.7-1) ... Selecting previously unselected package man-db. Preparing to unpack .../013-man-db_2.11.2-2_armhf.deb ... Unpacking man-db (2.11.2-2) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../014-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.10+dfsg-1_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Selecting previously unselected package libglib2.0-0:armhf. Preparing to unpack .../016-libglib2.0-0_2.74.6-2_armhf.deb ... Unpacking libglib2.0-0:armhf (2.74.6-2) ... Selecting previously unselected package libicu72:armhf. Preparing to unpack .../017-libicu72_72.1-3_armhf.deb ... Unpacking libicu72:armhf (72.1-3) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../018-libxml2_2.9.14+dfsg-1.3~deb12u1_armhf.deb ... Unpacking libxml2:armhf (2.9.14+dfsg-1.3~deb12u1) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.2-1_armhf.deb ... Unpacking shared-mime-info (2.2-1) ... Selecting previously unselected package libjpeg62-turbo:armhf. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-2_armhf.deb ... Unpacking libjpeg62-turbo:armhf (1:2.1.5-2) ... Selecting previously unselected package libpng16-16:armhf. Preparing to unpack .../021-libpng16-16_1.6.39-2_armhf.deb ... Unpacking libpng16-16:armhf (1.6.39-2) ... Selecting previously unselected package libdeflate0:armhf. Preparing to unpack .../022-libdeflate0_1.14-1_armhf.deb ... Unpacking libdeflate0:armhf (1.14-1) ... Selecting previously unselected package libjbig0:armhf. Preparing to unpack .../023-libjbig0_2.1-6.1_armhf.deb ... Unpacking libjbig0:armhf (2.1-6.1) ... Selecting previously unselected package liblerc4:armhf. Preparing to unpack .../024-liblerc4_4.0.0+ds-2_armhf.deb ... Unpacking liblerc4:armhf (4.0.0+ds-2) ... Selecting previously unselected package libwebp7:armhf. Preparing to unpack .../025-libwebp7_1.2.4-0.2+deb12u1_armhf.deb ... Unpacking libwebp7:armhf (1.2.4-0.2+deb12u1) ... Selecting previously unselected package libtiff6:armhf. Preparing to unpack .../026-libtiff6_4.5.0-6+deb12u1_armhf.deb ... Unpacking libtiff6:armhf (4.5.0-6+deb12u1) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf. Preparing to unpack .../027-libgdk-pixbuf-2.0-0_2.42.10+dfsg-1+b1_armhf.deb ... Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-1+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../028-gtk-update-icon-cache_3.24.38-2~deb12u1_armhf.deb ... Unpacking gtk-update-icon-cache (3.24.38-2~deb12u1) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../029-adwaita-icon-theme_43-1_all.deb ... Unpacking adwaita-icon-theme (43-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../030-ca-certificates-java_20230710~deb12u1_all.deb ... Unpacking ca-certificates-java (20230710~deb12u1) ... Selecting previously unselected package java-common. Preparing to unpack .../031-java-common_0.74_all.deb ... Unpacking java-common (0.74) ... Selecting previously unselected package libavahi-common-data:armhf. Preparing to unpack .../032-libavahi-common-data_0.8-10_armhf.deb ... Unpacking libavahi-common-data:armhf (0.8-10) ... Selecting previously unselected package libavahi-common3:armhf. Preparing to unpack .../033-libavahi-common3_0.8-10_armhf.deb ... Unpacking libavahi-common3:armhf (0.8-10) ... Selecting previously unselected package libdbus-1-3:armhf. Preparing to unpack .../034-libdbus-1-3_1.14.10-1~deb12u1_armhf.deb ... Unpacking libdbus-1-3:armhf (1.14.10-1~deb12u1) ... Selecting previously unselected package libavahi-client3:armhf. Preparing to unpack .../035-libavahi-client3_0.8-10_armhf.deb ... Unpacking libavahi-client3:armhf (0.8-10) ... Selecting previously unselected package libcups2:armhf. Preparing to unpack .../036-libcups2_2.4.2-3+deb12u5_armhf.deb ... Unpacking libcups2:armhf (2.4.2-3+deb12u5) ... Selecting previously unselected package liblcms2-2:armhf. Preparing to unpack .../037-liblcms2-2_2.14-2_armhf.deb ... Unpacking liblcms2-2:armhf (2.14-2) ... Selecting previously unselected package libbrotli1:armhf. Preparing to unpack .../038-libbrotli1_1.0.9-2+b6_armhf.deb ... Unpacking libbrotli1:armhf (1.0.9-2+b6) ... Selecting previously unselected package libfreetype6:armhf. Preparing to unpack .../039-libfreetype6_2.12.1+dfsg-5_armhf.deb ... Unpacking libfreetype6:armhf (2.12.1+dfsg-5) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-6_all.deb ... Unpacking fonts-dejavu-core (2.37-6) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.14.1-4_armhf.deb ... Unpacking fontconfig-config (2.14.1-4) ... Selecting previously unselected package libfontconfig1:armhf. Preparing to unpack .../042-libfontconfig1_2.14.1-4_armhf.deb ... Unpacking libfontconfig1:armhf (2.14.1-4) ... Selecting previously unselected package libnspr4:armhf. Preparing to unpack .../043-libnspr4_2%3a4.35-1_armhf.deb ... Unpacking libnspr4:armhf (2:4.35-1) ... Selecting previously unselected package libnss3:armhf. Preparing to unpack .../044-libnss3_2%3a3.87.1-1_armhf.deb ... Unpacking libnss3:armhf (2:3.87.1-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.8-1_all.deb ... Unpacking libasound2-data (1.2.8-1) ... Selecting previously unselected package libasound2:armhf. Preparing to unpack .../046-libasound2_1.2.8-1+b1_armhf.deb ... Unpacking libasound2:armhf (1.2.8-1+b1) ... Selecting previously unselected package libgraphite2-3:armhf. Preparing to unpack .../047-libgraphite2-3_1.3.14-1_armhf.deb ... Unpacking libgraphite2-3:armhf (1.3.14-1) ... Selecting previously unselected package libharfbuzz0b:armhf. Preparing to unpack .../048-libharfbuzz0b_6.0.0+dfsg-3_armhf.deb ... Unpacking libharfbuzz0b:armhf (6.0.0+dfsg-3) ... Selecting previously unselected package libpcsclite1:armhf. Preparing to unpack .../049-libpcsclite1_1.9.9-2_armhf.deb ... Unpacking libpcsclite1:armhf (1.9.9-2) ... Selecting previously unselected package openjdk-17-jre-headless:armhf. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jre-headless:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-74_armhf.deb ... Unpacking default-jre-headless (2:1.17-74) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.13-1_all.deb ... Unpacking ant (1.10.13-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.13-1_all.deb ... Unpacking ant-optional (1.10.13-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-12_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-12) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-12_all.deb ... Unpacking antlr (2.7.7+dfsg-12) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.46.0-5_all.deb ... Unpacking at-spi2-common (2.46.0-5) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-3_armhf.deb ... Unpacking m4 (1.4.19-3) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-12_all.deb ... Unpacking autopoint (0.21-12) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_armhf.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-1_all.deb ... Unpacking libhamcrest-java (2.2-1) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-3_all.deb ... Unpacking junit4 (4.13.2-3) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-1_all.deb ... Unpacking libjansi-native-java (1.8-1) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-3_all.deb ... Unpacking bnd (5.0.1-3) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3_armhf.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.11.4_all.deb ... Unpacking libdebhelper-perl (13.11.4) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-5_all.deb ... Unpacking libtool (2.4.7-5) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.09-4_all.deb ... Unpacking libsub-override-perl (0.09-4) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:armhf. Preparing to unpack .../088-libelf1_0.188-2.1_armhf.deb ... Unpacking libelf1:armhf (0.188-2.1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_armhf.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-12_armhf.deb ... Unpacking gettext (0.21-12) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.11.4_all.deb ... Unpacking debhelper (13.11.4) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-2_all.deb ... Unpacking libgtk2.0-common (2.24.33-2) ... Selecting previously unselected package libatk1.0-0:armhf. Preparing to unpack .../095-libatk1.0-0_2.46.0-5_armhf.deb ... Unpacking libatk1.0-0:armhf (2.46.0-5) ... Selecting previously unselected package libpixman-1-0:armhf. Preparing to unpack .../096-libpixman-1-0_0.42.2-1_armhf.deb ... Unpacking libpixman-1-0:armhf (0.42.2-1) ... Selecting previously unselected package libxau6:armhf. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_armhf.deb ... Unpacking libxau6:armhf (1:1.0.9-1) ... Selecting previously unselected package libbsd0:armhf. Preparing to unpack .../098-libbsd0_0.11.7-2_armhf.deb ... Unpacking libbsd0:armhf (0.11.7-2) ... Selecting previously unselected package libxdmcp6:armhf. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_armhf.deb ... Unpacking libxdmcp6:armhf (1:1.1.2-3) ... Selecting previously unselected package libxcb1:armhf. Preparing to unpack .../100-libxcb1_1.15-1_armhf.deb ... Unpacking libxcb1:armhf (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.4-2+deb12u2_all.deb ... Unpacking libx11-data (2:1.8.4-2+deb12u2) ... Selecting previously unselected package libx11-6:armhf. Preparing to unpack .../102-libx11-6_2%3a1.8.4-2+deb12u2_armhf.deb ... Unpacking libx11-6:armhf (2:1.8.4-2+deb12u2) ... Selecting previously unselected package libxcb-render0:armhf. Preparing to unpack .../103-libxcb-render0_1.15-1_armhf.deb ... Unpacking libxcb-render0:armhf (1.15-1) ... Selecting previously unselected package libxcb-shm0:armhf. Preparing to unpack .../104-libxcb-shm0_1.15-1_armhf.deb ... Unpacking libxcb-shm0:armhf (1.15-1) ... Selecting previously unselected package libxext6:armhf. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_armhf.deb ... Unpacking libxext6:armhf (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:armhf. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_armhf.deb ... Unpacking libxrender1:armhf (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:armhf. Preparing to unpack .../107-libcairo2_1.16.0-7_armhf.deb ... Unpacking libcairo2:armhf (1.16.0-7) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.14.1-4_armhf.deb ... Unpacking fontconfig (2.14.1-4) ... Selecting previously unselected package libfribidi0:armhf. Preparing to unpack .../109-libfribidi0_1.0.8-2.1_armhf.deb ... Unpacking libfribidi0:armhf (1.0.8-2.1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-1_all.deb ... Unpacking libthai-data (0.1.29-1) ... Selecting previously unselected package libdatrie1:armhf. Preparing to unpack .../111-libdatrie1_0.2.13-2+b1_armhf.deb ... Unpacking libdatrie1:armhf (0.2.13-2+b1) ... Selecting previously unselected package libthai0:armhf. Preparing to unpack .../112-libthai0_0.1.29-1_armhf.deb ... Unpacking libthai0:armhf (0.1.29-1) ... Selecting previously unselected package libpango-1.0-0:armhf. Preparing to unpack .../113-libpango-1.0-0_1.50.12+ds-1_armhf.deb ... Unpacking libpango-1.0-0:armhf (1.50.12+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:armhf. Preparing to unpack .../114-libpangoft2-1.0-0_1.50.12+ds-1_armhf.deb ... Unpacking libpangoft2-1.0-0:armhf (1.50.12+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:armhf. Preparing to unpack .../115-libpangocairo-1.0-0_1.50.12+ds-1_armhf.deb ... Unpacking libpangocairo-1.0-0:armhf (1.50.12+ds-1) ... Selecting previously unselected package libxcomposite1:armhf. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_armhf.deb ... Unpacking libxcomposite1:armhf (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:armhf. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_armhf.deb ... Unpacking libxfixes3:armhf (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:armhf. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_armhf.deb ... Unpacking libxcursor1:armhf (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:armhf. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_armhf.deb ... Unpacking libxdamage1:armhf (1:1.1.6-1) ... Selecting previously unselected package libxi6:armhf. Preparing to unpack .../120-libxi6_2%3a1.8-1+b1_armhf.deb ... Unpacking libxi6:armhf (2:1.8-1+b1) ... Selecting previously unselected package libxinerama1:armhf. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_armhf.deb ... Unpacking libxinerama1:armhf (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:armhf. Preparing to unpack .../122-libxrandr2_2%3a1.5.2-2+b1_armhf.deb ... Unpacking libxrandr2:armhf (2:1.5.2-2+b1) ... Selecting previously unselected package libgtk2.0-0:armhf. Preparing to unpack .../123-libgtk2.0-0_2.24.33-2_armhf.deb ... Unpacking libgtk2.0-0:armhf (2.24.33-2) ... Selecting previously unselected package libglvnd0:armhf. Preparing to unpack .../124-libglvnd0_1.6.0-1_armhf.deb ... Unpacking libglvnd0:armhf (1.6.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.114-1_all.deb ... Unpacking libdrm-common (2.4.114-1) ... Selecting previously unselected package libdrm2:armhf. Preparing to unpack .../126-libdrm2_2.4.114-1+b1_armhf.deb ... Unpacking libdrm2:armhf (2.4.114-1+b1) ... Selecting previously unselected package libglapi-mesa:armhf. Preparing to unpack .../127-libglapi-mesa_22.3.6-1+deb12u1_armhf.deb ... Unpacking libglapi-mesa:armhf (22.3.6-1+deb12u1) ... Selecting previously unselected package libx11-xcb1:armhf. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.4-2+deb12u2_armhf.deb ... Unpacking libx11-xcb1:armhf (2:1.8.4-2+deb12u2) ... Selecting previously unselected package libxcb-dri2-0:armhf. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_armhf.deb ... Unpacking libxcb-dri2-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:armhf. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_armhf.deb ... Unpacking libxcb-dri3-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-glx0:armhf. Preparing to unpack .../131-libxcb-glx0_1.15-1_armhf.deb ... Unpacking libxcb-glx0:armhf (1.15-1) ... Selecting previously unselected package libxcb-present0:armhf. Preparing to unpack .../132-libxcb-present0_1.15-1_armhf.deb ... Unpacking libxcb-present0:armhf (1.15-1) ... Selecting previously unselected package libxcb-randr0:armhf. Preparing to unpack .../133-libxcb-randr0_1.15-1_armhf.deb ... Unpacking libxcb-randr0:armhf (1.15-1) ... Selecting previously unselected package libxcb-sync1:armhf. Preparing to unpack .../134-libxcb-sync1_1.15-1_armhf.deb ... Unpacking libxcb-sync1:armhf (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:armhf. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_armhf.deb ... Unpacking libxcb-xfixes0:armhf (1.15-1) ... Selecting previously unselected package libxshmfence1:armhf. Preparing to unpack .../136-libxshmfence1_1.3-1_armhf.deb ... Unpacking libxshmfence1:armhf (1.3-1) ... Selecting previously unselected package libxxf86vm1:armhf. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_armhf.deb ... Unpacking libxxf86vm1:armhf (1:1.1.4-1+b2) ... Selecting previously unselected package libdrm-amdgpu1:armhf. Preparing to unpack .../138-libdrm-amdgpu1_2.4.114-1+b1_armhf.deb ... Unpacking libdrm-amdgpu1:armhf (2.4.114-1+b1) ... Selecting previously unselected package libdrm-nouveau2:armhf. Preparing to unpack .../139-libdrm-nouveau2_2.4.114-1+b1_armhf.deb ... Unpacking libdrm-nouveau2:armhf (2.4.114-1+b1) ... Selecting previously unselected package libdrm-radeon1:armhf. Preparing to unpack .../140-libdrm-radeon1_2.4.114-1+b1_armhf.deb ... Unpacking libdrm-radeon1:armhf (2.4.114-1+b1) ... Selecting previously unselected package libedit2:armhf. Preparing to unpack .../141-libedit2_3.1-20221030-2_armhf.deb ... Unpacking libedit2:armhf (3.1-20221030-2) ... Selecting previously unselected package libz3-4:armhf. Preparing to unpack .../142-libz3-4_4.8.12-3.1_armhf.deb ... Unpacking libz3-4:armhf (4.8.12-3.1) ... Selecting previously unselected package libllvm15:armhf. Preparing to unpack .../143-libllvm15_1%3a15.0.6-4+b1_armhf.deb ... Unpacking libllvm15:armhf (1:15.0.6-4+b1) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../144-libsensors-config_1%3a3.6.0-7.1_all.deb ... Unpacking libsensors-config (1:3.6.0-7.1) ... Selecting previously unselected package libsensors5:armhf. Preparing to unpack .../145-libsensors5_1%3a3.6.0-7.1_armhf.deb ... Unpacking libsensors5:armhf (1:3.6.0-7.1) ... Selecting previously unselected package libgl1-mesa-dri:armhf. Preparing to unpack .../146-libgl1-mesa-dri_22.3.6-1+deb12u1_armhf.deb ... Unpacking libgl1-mesa-dri:armhf (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx-mesa0:armhf. Preparing to unpack .../147-libglx-mesa0_22.3.6-1+deb12u1_armhf.deb ... Unpacking libglx-mesa0:armhf (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx0:armhf. Preparing to unpack .../148-libglx0_1.6.0-1_armhf.deb ... Unpacking libglx0:armhf (1.6.0-1) ... Selecting previously unselected package libgl1:armhf. Preparing to unpack .../149-libgl1_1.6.0-1_armhf.deb ... Unpacking libgl1:armhf (1.6.0-1) ... Selecting previously unselected package libgif7:armhf. Preparing to unpack .../150-libgif7_5.2.1-2.5_armhf.deb ... Unpacking libgif7:armhf (5.2.1-2.5) ... Selecting previously unselected package x11-common. Preparing to unpack .../151-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:armhf. Preparing to unpack .../152-libxtst6_2%3a1.2.3-1.1_armhf.deb ... Unpacking libxtst6:armhf (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:armhf. Preparing to unpack .../153-openjdk-17-jre_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jre:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jre. Preparing to unpack .../154-default-jre_2%3a1.17-74_armhf.deb ... Unpacking default-jre (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk-headless:armhf. Preparing to unpack .../155-openjdk-17-jdk-headless_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jdk-headless:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../156-default-jdk-headless_2%3a1.17-74_armhf.deb ... Unpacking default-jdk-headless (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk:armhf. Preparing to unpack .../157-openjdk-17-jdk_17.0.9+9-1~deb12u1_armhf.deb ... Unpacking openjdk-17-jdk:armhf (17.0.9+9-1~deb12u1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../158-default-jdk_2%3a1.17-74_armhf.deb ... Unpacking default-jdk (2:1.17-74) ... Selecting previously unselected package libassuan0:armhf. Preparing to unpack .../159-libassuan0_2.5.5-5_armhf.deb ... Unpacking libassuan0:armhf (2.5.5-5) ... Selecting previously unselected package gpgconf. Preparing to unpack .../160-gpgconf_2.2.40-1.1_armhf.deb ... Unpacking gpgconf (2.2.40-1.1) ... Selecting previously unselected package libksba8:armhf. Preparing to unpack .../161-libksba8_1.6.3-2_armhf.deb ... Unpacking libksba8:armhf (1.6.3-2) ... Selecting previously unselected package libsasl2-modules-db:armhf. Preparing to unpack .../162-libsasl2-modules-db_2.1.28+dfsg-10_armhf.deb ... Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg-10) ... Selecting previously unselected package libsasl2-2:armhf. Preparing to unpack .../163-libsasl2-2_2.1.28+dfsg-10_armhf.deb ... Unpacking libsasl2-2:armhf (2.1.28+dfsg-10) ... Selecting previously unselected package libldap-2.5-0:armhf. Preparing to unpack .../164-libldap-2.5-0_2.5.13+dfsg-5_armhf.deb ... Unpacking libldap-2.5-0:armhf (2.5.13+dfsg-5) ... Selecting previously unselected package libnpth0:armhf. Preparing to unpack .../165-libnpth0_1.6-3_armhf.deb ... Unpacking libnpth0:armhf (1.6-3) ... Selecting previously unselected package dirmngr. Preparing to unpack .../166-dirmngr_2.2.40-1.1_armhf.deb ... Unpacking dirmngr (2.2.40-1.1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../167-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../168-gnupg-utils_2.2.40-1.1_armhf.deb ... Unpacking gnupg-utils (2.2.40-1.1) ... Selecting previously unselected package gpg. Preparing to unpack .../169-gpg_2.2.40-1.1_armhf.deb ... Unpacking gpg (2.2.40-1.1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../170-pinentry-curses_1.2.1-1_armhf.deb ... Unpacking pinentry-curses (1.2.1-1) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../171-gpg-agent_2.2.40-1.1_armhf.deb ... Unpacking gpg-agent (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../172-gpg-wks-client_2.2.40-1.1_armhf.deb ... Unpacking gpg-wks-client (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../173-gpg-wks-server_2.2.40-1.1_armhf.deb ... Unpacking gpg-wks-server (2.2.40-1.1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../174-gpgsm_2.2.40-1.1_armhf.deb ... Unpacking gpgsm (2.2.40-1.1) ... Selecting previously unselected package gnupg. Preparing to unpack .../175-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../176-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../177-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../178-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../179-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../180-libio-pty-perl_1%3a1.17-1_armhf.deb ... Unpacking libio-pty-perl (1:1.17-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../181-libipc-run-perl_20220807.0-1_all.deb ... Unpacking libipc-run-perl (20220807.0-1) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../182-libclass-method-modifiers-perl_2.14-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.14-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../183-libclass-xsaccessor-perl_1.19-4+b1_armhf.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b1) ... Selecting previously unselected package libb-hooks-op-check-perl:armhf. Preparing to unpack .../184-libb-hooks-op-check-perl_0.22-2+b1_armhf.deb ... Unpacking libb-hooks-op-check-perl:armhf (0.22-2+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../185-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:armhf. Preparing to unpack .../186-libdevel-callchecker-perl_0.008-2_armhf.deb ... Unpacking libdevel-callchecker-perl:armhf (0.008-2) ... Selecting previously unselected package libparams-classify-perl:armhf. Preparing to unpack .../187-libparams-classify-perl_0.015-2+b1_armhf.deb ... Unpacking libparams-classify-perl:armhf (0.015-2+b1) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../188-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../189-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../190-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../191-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../192-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../193-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../194-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../195-libhttp-date-perl_6.05-2_all.deb ... Unpacking libhttp-date-perl (6.05-2) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../196-libfile-listing-perl_6.15-1_all.deb ... Unpacking libfile-listing-perl (6.15-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../197-libhtml-tagset-perl_3.20-6_all.deb ... Unpacking libhtml-tagset-perl (3.20-6) ... Selecting previously unselected package libregexp-ipv6-perl. Preparing to unpack .../198-libregexp-ipv6-perl_0.03-3_all.deb ... Unpacking libregexp-ipv6-perl (0.03-3) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../199-liburi-perl_5.17-1_all.deb ... Unpacking liburi-perl (5.17-1) ... Selecting previously unselected package libhtml-parser-perl:armhf. Preparing to unpack .../200-libhtml-parser-perl_3.81-1_armhf.deb ... Unpacking libhtml-parser-perl:armhf (3.81-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../201-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:armhf. Preparing to unpack .../202-libclone-perl_0.46-1_armhf.deb ... Unpacking libclone-perl:armhf (0.46-1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../203-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../204-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../205-libhttp-message-perl_6.44-1_all.deb ... Unpacking libhttp-message-perl (6.44-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../206-libhttp-cookies-perl_6.10-1_all.deb ... Unpacking libhttp-cookies-perl (6.10-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../207-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:armhf. Preparing to unpack .../208-perl-openssl-defaults_7+b1_armhf.deb ... Unpacking perl-openssl-defaults:armhf (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:armhf. Preparing to unpack .../209-libnet-ssleay-perl_1.92-2+b1_armhf.deb ... Unpacking libnet-ssleay-perl:armhf (1.92-2+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../210-libio-socket-ssl-perl_2.081-2_all.deb ... Unpacking libio-socket-ssl-perl (2.081-2) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../211-libnet-http-perl_6.22-1_all.deb ... Unpacking libnet-http-perl (6.22-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../212-liblwp-protocol-https-perl_6.10-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.10-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../213-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../214-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../215-libwww-perl_6.68-1_all.deb ... Unpacking libwww-perl (6.68-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../216-patchutils_0.4.2-1_armhf.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../217-wdiff_1.2.2-5_armhf.deb ... Unpacking wdiff (1.2.2-5) ... Selecting previously unselected package devscripts. Preparing to unpack .../218-devscripts_2.23.4+deb12u1_armhf.deb ... Unpacking devscripts (2.23.4+deb12u1) ... Selecting previously unselected package ivy. Preparing to unpack .../219-ivy_2.5.1-2_all.deb ... Unpacking ivy (2.5.1-2) ... Selecting previously unselected package libasm-java. Preparing to unpack .../220-libasm-java_9.4-1_all.deb ... Unpacking libasm-java (9.4-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../221-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../222-libcommons-cli-java_1.5.0-1_all.deb ... Unpacking libcommons-cli-java (1.5.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../223-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../224-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../225-libcommons-logging-java_1.2-3_all.deb ... Unpacking libcommons-logging-java (1.2-3) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../226-libjansi-java_2.4.0-2_all.deb ... Unpacking libjansi-java (2.4.0-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../227-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../228-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../229-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../230-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../231-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../232-groovy_2.4.21-8_all.deb ... Unpacking groovy (2.4.21-8) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../233-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../234-libcommons-collections3-java_3.2.2-2_all.deb ... Unpacking libcommons-collections3-java (3.2.2-2) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../235-libcommons-compress-java_1.22-1_all.deb ... Unpacking libcommons-compress-java (1.22-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../236-libcommons-io-java_2.11.0-2_all.deb ... Unpacking libcommons-io-java (2.11.0-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../237-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../238-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../239-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../240-libguava-java_31.1-1_all.deb ... Unpacking libguava-java (31.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../241-libcommons-codec-java_1.15-1_all.deb ... Unpacking libcommons-codec-java (1.15-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../242-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../243-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../244-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../245-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../246-libjna-jni_5.13.0-2_armhf.deb ... Unpacking libjna-jni (5.13.0-2) ... Selecting previously unselected package libjna-java. Preparing to unpack .../247-libjna-java_5.13.0-2_all.deb ... Unpacking libjna-java (5.13.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../248-libjzlib-java_1.1.3-2_all.deb ... Unpacking libjzlib-java (1.1.3-2) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../249-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../250-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../251-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../252-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../253-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../254-liblogback-java_1%3a1.2.11-3_all.deb ... Unpacking liblogback-java (1:1.2.11-3) ... Selecting previously unselected package libncurses6:armhf. Preparing to unpack .../255-libncurses6_6.4-4_armhf.deb ... Unpacking libncurses6:armhf (6.4-4) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../256-libnative-platform-jni_0.14-5_armhf.deb ... Unpacking libnative-platform-jni (0.14-5) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../257-libnative-platform-java_0.14-5_all.deb ... Unpacking libnative-platform-java (0.14-5) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../258-libxml-commons-external-java_1.4.01-5_all.deb ... Unpacking libxml-commons-external-java (1.4.01-5) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../259-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../260-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../261-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../262-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../263-libgradle-core-java_4.4.1-18_all.deb ... Unpacking libgradle-core-java (4.4.1-18) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../264-libbcprov-java_1.72-2_all.deb ... Unpacking libbcprov-java (1.72-2) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../265-libbcpg-java_1.72-2_all.deb ... Unpacking libbcpg-java (1.72-2) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../266-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../267-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../268-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../269-libdom4j-java_2.1.3-2_all.deb ... Unpacking libdom4j-java (2.1.3-2) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../270-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../271-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../272-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../273-libgoogle-gson-java_2.10-1_all.deb ... Unpacking libgoogle-gson-java (2.10-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../274-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../275-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../276-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../277-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../278-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../279-libjavaewah-java_1.1.7-1_all.deb ... Unpacking libjavaewah-java (1.1.7-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../280-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../281-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../282-libjetty9-java_9.4.50-4+deb12u2_all.deb ... Unpacking libjetty9-java (9.4.50-4+deb12u2) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../283-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../284-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../285-libcommons-lang3-java_3.12.0-2_all.deb ... Unpacking libcommons-lang3-java (3.12.0-2) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../286-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../287-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../288-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../289-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../290-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../291-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../292-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../293-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../294-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../295-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../296-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../297-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../298-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../299-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../300-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../301-libmaven3-core-java_3.8.7-1_all.deb ... Unpacking libmaven3-core-java (3.8.7-1) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../302-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../303-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../304-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../305-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../306-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../307-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../308-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../309-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../310-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../311-libgradle-plugins-java_4.4.1-18_all.deb ... Unpacking libgradle-plugins-java (4.4.1-18) ... Selecting previously unselected package gradle. Preparing to unpack .../312-gradle_4.4.1-18_all.deb ... Unpacking gradle (4.4.1-18) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../313-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../314-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package javahelper. Preparing to unpack .../315-javahelper_0.78_all.deb ... Unpacking javahelper (0.78) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../316-libbyte-buddy-java_1.12.21-1_all.deb ... Unpacking libbyte-buddy-java (1.12.21-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../317-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../318-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../319-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../320-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../321-liblz4-jni_1.8.0-3_armhf.deb ... Unpacking liblz4-jni (1.8.0-3) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../322-liblz4-java_1.8.0-3_all.deb ... Unpacking liblz4-java (1.8.0-3) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../323-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../324-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../325-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.72-2) ... Setting up libksba8:armhf (1.6.3-2) ... Setting up media-types (10.0.0) ... Setting up libpipeline1:armhf (1.5.7-1) ... Setting up libgraphite2-3:armhf (1.3.14-1) ... Setting up liblcms2-2:armhf (2.14-2) ... Setting up libpixman-1-0:armhf (0.42.2-1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-5) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:armhf (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:armhf (72.1-3) ... Setting up liblerc4:armhf (4.0.0+ds-2) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.38.1-5+b1) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.74) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:armhf (0.2.13-2+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.14-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.5.0-1) ... Setting up libio-pty-perl (1:1.17-1) ... Setting up libmagic-mgc (1:5.44-3) ... Setting up liblogback-java (1:1.2.11-3) ... Setting up libclone-perl:armhf (0.46-1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:armhf (2.74.6-2) ... No schema files found: doing nothing. Setting up libglvnd0:armhf (1.6.0-1) ... Setting up libgoogle-gson-java (2.10-1) ... Setting up libhtml-tagset-perl (3.20-6) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.11.4) ... Setting up libbrotli1:armhf (1.0.9-2+b6) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Setting up libasm-java (9.4-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-7.1) ... Setting up libmagic1:armhf (1:5.44-3) ... Setting up libdeflate0:armhf (1.14-1) ... Setting up perl-openssl-defaults:armhf (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-12) ... Setting up m4 (1.4.19-3) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:armhf (1.6-3) ... Setting up file (1:5.44-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:armhf (2.5.5-5) ... Setting up libjzlib-java (1.1.3-2) ... Setting up libjbig0:armhf (2.1-6.1) ... Setting up libsasl2-modules-db:armhf (2.1.28+dfsg-10) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-2) ... Setting up libasound2-data (1.2.8-1) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:armhf (4.8.12-3.1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.1.7-1) ... Setting up libjpeg62-turbo:armhf (1:2.1.5-2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.4-2+deb12u2) ... Setting up libnspr4:armhf (2:4.35-1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.0-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:armhf (0.8-10) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libncurses6:armhf (6.4-4) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:armhf (1.14.10-1~deb12u1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:armhf (1.0.8-2.1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up libpng16-16:armhf (1.6.39-2) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.13.0-2) ... Setting up autopoint (0.21-12) ... Setting up libb-hooks-op-check-perl:armhf (0.22-2+b1) ... Setting up fonts-dejavu-core (2.37-6) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20220807.0-1) ... Setting up libpcsclite1:armhf (1.9.9-2) ... Setting up libsensors5:armhf (1:3.6.0-7.1) ... Setting up libhamcrest-java (2.2-1) ... Setting up libglapi-mesa:armhf (22.3.6-1+deb12u1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:armhf (2.1.28+dfsg-10) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:armhf (1.2.4-0.2+deb12u1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libregexp-ipv6-perl (0.03-3) ... Setting up libgif7:armhf (5.2.1-2.5) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.17+nmu1) ... Setting up libxshmfence1:armhf (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.46.0-5) ... Setting up libtiff6:armhf (4.5.0-6+deb12u1) ... Setting up libuchardet0:armhf (0.0.7-1) ... Setting up libxml-commons-external-java (1.4.01-5) ... Setting up libjna-java (5.13.0-2) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:armhf (1.2.8-1+b1) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.09-4) ... Setting up libthai-data (0.1.29-1) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-5) ... Setting up libclass-xsaccessor-perl (1.19-4+b1) ... Setting up libgtk2.0-common (2.24.33-2) ... Setting up libatk1.0-0:armhf (2.46.0-5) ... Setting up liblz4-jni (1.8.0-3) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.72-2) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-12) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.0.11-1~deb12u2) ... Setting up libbsd0:armhf (0.11.7-2) ... Setting up libdrm-common (2.4.114-1) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:armhf (0.188-2.1) ... Setting up readline-common (8.2-1.3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:armhf (2.9.14+dfsg-1.3~deb12u1) ... Setting up liburi-perl (5.17-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:armhf (1.92-2+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-1) ... Setting up libdom4j-java (2.1.3-2) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-5) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.05-2) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:armhf (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-3) ... Setting up libxcb1:armhf (1.15-1) ... Setting up gettext (0.21-12) ... Setting up libjetty9-java (9.4.50-4+deb12u2) ... Setting up libxcb-xfixes0:armhf (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.15-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libtool (2.4.7-5) ... Setting up libxcb-render0:armhf (1.15-1) ... Setting up fontconfig-config (2.14.1-4) ... Setting up libxcb-glx0:armhf (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:armhf (3.1-20221030-2) ... Setting up libreadline8:armhf (8.2-1.3) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:armhf (0.8-10) ... Setting up libcommons-logging-java (1.2-3) ... Setting up libnet-http-perl (6.22-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:armhf (2:3.87.1-1) ... Setting up libxcb-shm0:armhf (1.15-1) ... Setting up libdevel-callchecker-perl:armhf (0.008-2) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:armhf (2.5.13+dfsg-5) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:armhf (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:armhf (0.1.29-1) ... Setting up ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 140 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:armhf (2.12.1+dfsg-5) ... Setting up libxcb-sync1:armhf (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.2-1) ... Setting up libcommons-lang3-java (3.12.0-2) ... Setting up libxcb-dri2-0:armhf (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:armhf (2.4.114-1+b1) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-1) ... Setting up groff-base (1.22.4-10) ... Setting up libxcb-randr0:armhf (1.15-1) ... Setting up libhtml-parser-perl:armhf (3.81-1) ... Setting up libllvm15:armhf (1:15.0.6-4+b1) ... Setting up gpgconf (2.2.40-1.1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:armhf (2:1.8.4-2+deb12u2) ... Setting up libharfbuzz0b:armhf (6.0.0+dfsg-3) ... Setting up libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-1+b1) ... Setting up libfontconfig1:armhf (2.14.1-4) ... Setting up ca-certificates-java (20230710~deb12u1) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.15-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libxcomposite1:armhf (1:0.4.5-1) ... Setting up libavahi-client3:armhf (0.8-10) ... Setting up libio-socket-ssl-perl (2.081-2) ... Setting up gpg (2.2.40-1.1) ... Setting up gnupg-utils (2.2.40-1.1) ... Setting up libhttp-message-perl (6.44-1) ... Setting up libdrm-amdgpu1:armhf (2.4.114-1+b1) ... Setting up libxcb-dri3-0:armhf (1.15-1) ... Setting up gtk-update-icon-cache (3.24.38-2~deb12u1) ... Setting up libx11-xcb1:armhf (2:1.8.4-2+deb12u2) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.14.1-4) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:armhf (2.4.114-1+b1) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:armhf (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1) ... Setting up libxrender1:armhf (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.22-1) ... Setting up libhttp-cookies-perl (6.10-1) ... Setting up libcommons-io-java (2.11.0-2) ... Setting up libdrm-radeon1:armhf (2.4.114-1+b1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:armhf (3.11.2-6) ... Setting up libparams-classify-perl:armhf (0.015-2+b1) ... Setting up gpgsm (2.2.40-1.1) ... Setting up libpango-1.0-0:armhf (1.50.12+ds-1) ... Setting up libgl1-mesa-dri:armhf (22.3.6-1+deb12u1) ... Setting up libxext6:armhf (2:1.3.4-1+b1) ... Setting up man-db (2.11.2-2) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:armhf (1.16.0-7) ... Setting up libxxf86vm1:armhf (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (43-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:armhf (1:6.0.0-2) ... Setting up libxinerama1:armhf (2:1.1.4-3) ... Setting up libxrandr2:armhf (2:1.5.2-2+b1) ... Setting up gpg-wks-server (2.2.40-1.1) ... Setting up libcups2:armhf (2.4.2-3+deb12u5) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:armhf (1.50.12+ds-1) ... Setting up libpangocairo-1.0-0:armhf (1.50.12+ds-1) ... Setting up libpython3-stdlib:armhf (3.11.2-1+b1) ... Setting up python3.11 (3.11.2-6) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:armhf (22.3.6-1+deb12u1) ... Setting up libxi6:armhf (2:1.8-1+b1) ... Setting up gpg-wks-client (2.2.40-1.1) ... Setting up libglx0:armhf (1.6.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:armhf (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:armhf (1:1.2.1-1) ... Setting up debhelper (13.11.4) ... Setting up python3 (3.11.2-1+b1) ... Setting up libgl1:armhf (1.6.0-1) ... Setting up openjdk-17-jre-headless:armhf (17.0.9+9-1~deb12u1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:armhf (2.24.33-2) ... Setting up liblwp-protocol-https-perl (6.10-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.68-1) ... Setting up devscripts (2.23.4+deb12u1) ... Setting up libguava-java (31.1-1) ... Setting up javahelper (0.78) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up libguice-java (4.2.3-2) ... Setting up libmaven3-core-java (3.8.7-1) ... Setting up libbyte-buddy-java (1.12.21-1) ... Setting up libmockito-java (2.23.0-2) ... Processing triggers for libc-bin (2.36-9+deb12u3) ... Processing triggers for ca-certificates-java (20230710~deb12u1) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068_2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:E-Tugra_Certification_Authority.pem Adding debian:E-Tugra_Global_Root_CA_ECC_v3.pem Adding debian:E-Tugra_Global_Root_CA_RSA_v3.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustCor_ECA-1.pem Adding debian:TrustCor_RootCert_CA-1.pem Adding debian:TrustCor_RootCert_CA-2.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up maven-repo-helper (1.11) ... Setting up antlr (2.7.7+dfsg-12) ... Setting up openjdk-17-jdk-headless:armhf (17.0.9+9-1~deb12u1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.1-2) ... Setting up ant (1.10.13-1) ... Setting up junit4 (4.13.2-3) ... Setting up groovy (2.4.21-8) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up default-jre-headless (2:1.17-74) ... Setting up openjdk-17-jre:armhf (17.0.9+9-1~deb12u1) ... Setting up default-jre (2:1.17-74) ... Setting up openjdk-17-jdk:armhf (17.0.9+9-1~deb12u1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up ant-optional (1.10.13-1) ... Setting up bnd (5.0.1-3) ... Setting up default-jdk-headless (2:1.17-74) ... Setting up libgradle-core-java (4.4.1-18) ... Setting up libgradle-plugins-java (4.4.1-18) ... Setting up gradle (4.4.1-18) ... Setting up default-jdk (2:1.17-74) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20230710~deb12u1) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: user script /srv/workspace/pbuilder/28295/tmp/hooks/A99_set_merged_usr starting Not re-configuring usrmerge for bookworm I: user script /srv/workspace/pbuilder/28295/tmp/hooks/A99_set_merged_usr finished hostname: Name or service not known I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 jar openjdk version "17.0.9" 2023-10-17 OpenJDK Runtime Environment (build 17.0.9+9-Debian-1deb12u1) OpenJDK Server VM (build 17.0.9+9-Debian-1deb12u1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 12.094 secs. The client will now receive all logging from the daemon (pid: 4068). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-4068.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 4 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@171efdb Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@171efdb Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@149252e Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@e005b4 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@6a8fac Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@149252e Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e059e7 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@118445b :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.06 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c78cd1 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) Up-to-date check for task ':compileJava' took 58.68 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':',5,main]) completed. Took 3 mins 34.991 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.095 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.381 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':',5,main]) completed. Took 0.011 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.009 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 1.156 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.587 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':',5,main]) completed. Took 4.876 secs. BUILD SUCCESSFUL in 4m 47s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 test openjdk version "17.0.9" 2023-10-17 OpenJDK Runtime Environment (build 17.0.9+9-Debian-1deb12u1) OpenJDK Server VM (build 17.0.9+9-Debian-1deb12u1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 21.285 secs. The client will now receive all logging from the daemon (pid: 5194). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-5194.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 4 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e51ee4 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e51ee4 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1605d8e Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@1446097 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@aeccc5 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1605d8e Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@b34035 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@13dc097 :compileJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.117 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@c1285b Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 13.996 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 14.695 secs. :processResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.119 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.167 secs. :classes (Thread[Task worker for ':' Thread 2,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.013 secs. :compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 56.355 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 3 mins 8.137 secs. :processTestResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.235 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.746 secs. :testClasses (Thread[Task worker for ':' Thread 2,5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.016 secs. :test (Thread[Task worker for ':' Thread 2,5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 15.31 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath3667783785035859980txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: 0% Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: 0% Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_deb73ebe80719a0fb16aef20d2fcff591f26029b9293800781503564500.tmp: 0% Indexing milib_deb73ebe80719a0fb16aef20d2fcff591f26029b9293800781503564500.tmp: 69.1% Indexing milib_deb73ebe80719a0fb16aef20d2fcff591f26029b9293800781503564500.tmp: done com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 24.25us 21.47us 14.21us Gradle is still running, please be patient... com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1770 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 102 -> T 68 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1257 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 69 -> T 61 - -8 Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 183 -> T 147 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 319 noHits2: 0 noHits3: 0 wrongTopHit: 40 wrongTopHitS: 23 noCorrectHitInList: 15 Timings: DescriptiveStatistics: n: 100000 min: 49336.0 max: 1.629609846E9 mean: 814562.929270187 std dev: 1.2666179029481351E7 median: 521364.0 skewness: 97.33264044772457 kurtosis: 10305.781637677557 Clusters basicSize DescriptiveStatistics: n: 99641 min: 1.0 max: 6.0 mean: 2.876867955961902 std dev: 1.110830829601105 median: 3.0 skewness: 0.27350970870742597 kurtosis: -0.7108314509884743 Top Delta DescriptiveStatistics: n: 99666 min: -19.0 max: 0.0 mean: -0.001113719824212096 std dev: 0.12909140230075208 median: 0.0 skewness: -122.7303270223829 kurtosis: 15716.514367360038 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4959 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 24.46ms Processed queries: 0 Bad percent: NaN False positive percent: 0.2457002457002457 Scoring error percent: NaN com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest FAILED java.lang.AssertionError: Bad fraction = NaN at org.junit.Assert.fail(Assert.java:89) at org.junit.Assert.assertTrue(Assert.java:42) at com.milaboratory.core.alignment.kaligner2.KAligner2Test.testSimpleRandomTest(KAligner2Test.java:123) com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1752 rTrimmed = 1650 lTrimmed = 2811 rTrimmed = 2763 com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 4.35ms C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 1.92ms C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 957.05us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 1.09ms com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=2998;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 7.87ms C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 10.28ms C=2995;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 4.53ms C=2997;I=0;M=1;ScE=1;R=0.0 AlignmentTime = 2.07ms com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99949 elements with 366.3KiB in raw nucleotide entropy serialized into 273.18KiB com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 35 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 618 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2465 com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 Gradle is still running, please be patient... com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT GTGCCCCGGGAGGTTTTGCAACGTCACATCCACGTTCTGGGTTGAAGACGTGCTAAGTGATAGGAGAATAAGGCCGCAAAGATCCGGTTCAATGGGAATTATTCAAATTCCCCTACCATGGGGGAGACGTTCGGGGTGTCAGAAACTAGTTTTAGTGGCGAACTAGAGGCCGTCCAAGACATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCGCCATGGGACGTTACTCTCGCGACCCGTTACAATGACATCTCGCTCCTGTGCTAAAGATACGAAACGCCAGATCGCGTGACGGGGTCTTGTAAAAGTAGGTTCTCGGTGGGGTTAGCAAGGCGACTGCTTTAGCTGCTGAACGACCCCGTGAGTATGATGCTAAGTGTACTATTTAAACTGGACGAGTTCACTTGTCGCCATCATACGTCGTGCTATATATCCGTCTCCATATATAAGTCCCGTGAGGGGCCGGGCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAACCAGAAGTTCAGAGCGATCTCGGGCTAATCCACTGAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGAGGGGGAAAAAACTTTACTTTTAGAGAAC AGTCCCCGGGAGGTTTACAACGTCACATCCACGTTTCTGGTTTGAAGACGTGCTAAGTGATAGGAGAATAAGGCCGCAAAGATCCGGTTCAATGGGAATTATTCGAATTCCCCTACCATGGTGAGACGGTTTCTGGGTTTCAGAACTAGTTTAGTGGCGAACTAGAGTCCGTTCAGGATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCTCCATGGGACGTTACTCCGCGGCCCTTACAATAGACATCTCGCTTCCCTGTTCTATAGATACGAAACGCACAGTCGCGCGACGGGGTTGTAAAAGAGGTCTCGGTGTGGTTAGCAAGGCGACTGCTTTAGCTGCTAACGACCCCGTGAGTATGATGCTAGTGTACTATTTAGACTAACTTGTCCATTGTCGCCATCAACGCCTTGCGCTAGTATCCGTCTCCATACTTGATAGTCCCGTAGGGGCCAGGCCTGGAGGTCGACAACAGGGCAGCAGACTCTCTCATAGCAACGGAACGCAGAAGTTCAAGCGACTCGGGCTAACCCAGAGATCTTTGCAACTGAGTACAAGAGCGAGGTTGATAGAGGGCGCGAGGGGAAAAAACTACTTTTAGAGAAC AGTCCCGGGAGTTTCAACGTCACATCCACGTTTTGGTTGAAGACGTGCTTAAGTGTTAGGGGAATAATCGCAAAGACCGGTTCAATGGGAATTATGAATTCCCCTACCATGGAGACGGTTTCTGGGTTTCAGAACATTTAGTGGGAACTAGAGTCCGTTCAGGATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCTCCCATGGGACGTTACTCCGCGGGCCGCTTACAATGTACATCTGCTTCCCTGTTCTATTGATACGAAACGCTCAGCCCGGACTGGGTTGGTAAAAGAGGTCTCGGGTGTAGTTTGCAAGGCGACTGCTTTAGCTGCTAACGAGCCCCGTGGTGTGATGCTATGTACTATTTAGACTAACTTGTACCATTGTCGCCATCAACGCCTTGTGCTAGTATCCGTCTCCAACTTGTAGTCCCGTAGGGGCCAGCGCCTGAGGTCGACAACAGGGAGCAGACTCTCTCATAGCGACGAACGCAGAAGTTCAAGCGACTCGGCTAACCCAGAGATCTTTGCAACTGAGTAAAGAGCGAGGTTGATAGAGGGCGCGTGCGGGAAACTACTTTTAGATAAC 0 AGT--CCCGGGA-G-TTT-CAACGTCACATCCACGTT-TTGGTTGAAGACGTGCTTAAGTGTTAGGGGAATAA--TCGCAAAGA-CCGGTTCAATGGGAATTA-T-GAATTCCCCTACCAT---GGAGACGGTTTCTGGGTTTCAG-AAC-A--TTTAGTGG-GAACTAGAGTCCGTTC-AG-GATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCTCCCATGGGACGTTACTC-CGCGGGCCGCTTACAATGTACATCT-GCTTCCCTGTTCTATTGATACGAAACGCTCAG--CCCG-GACTGGGT-TGGTAAAAG-AGG-TCTCGGGTGTAGTTTGCAAGGCGACTGCTTTAGCTGCT-AACGAGCCCCGTG-GTGTGATGCT-A-TGTACTATTTAGACT-AACTTGTAC-CATTGTCGCCATCA-ACGCCTTGTGCTA-GTATCCGTCTCCA-ACT-TGTAGTCCCGT-AGGGGCCAGCGCCT-GAG-GTCGACAAC-AGGG-AGCAGAC-TCTCT-CATAG-CGAC-GAACGCAGAAGTTCA-AGCGA-CTC-GGCTAA-CC-CAGAGA-TCTTTGCAACTGAGTA-AAGAGCGAGGTTGA-TAGAGGGCG-CGTGCGGG---AAAC--TACTTTTAGATAAC 589 || ||||||| | ||| |||||||||||||||||| | |||||||||||||| |||||| |||| |||||| |||||||| |||||||||||||||||| | |||||||||||||| |||||| | ||| |||| |||| ||| | |||||||| ||||||||| |||| | || ||||||||||||||||||||||||||||||||||| |||||||||||||||| |||| ||| |||||||| |||||| || | ||||| ||| |||||||||||| ||| | || ||| |||| | ||||||| ||| |||| |||| ||| ||||||||||||||||||||||| ||||| ||||||| || ||||||| | ||||||||||| ||| || || | | |||||||||||| ||| | |||||| |||||||||||| | | | |||||||| ||||||| | |||| ||| ||||||||| |||| ||||||| ||||| ||||| | || |||| |||||||||| ||||| ||| |||||| || | |||| ||| |||||| ||||| |||||||| ||||| ||||||||| || | ||| |||| |||||||||| ||| 0 -GTGCCCCGGGAGGTTTTGCAACGTCACATCCACGTTCTGGGTTGAAGACGTGC-TAAGTGATAGGAGAATAAGGCCGCAAAGATCCGGTTCAATGGGAATTATTCAAATTCCCCTACCATGGGGGAGAC-G-TTCGGGGTGTCAGAAACTAGTTTTAGTGGCGAACTAGAGGCCGTCCAAGACATCGCCTGTATCATTACCGCATCTGCCCGGGAGCC-GCCATGGGACGTTACTCTCGCGACCCG-TTACAATG-ACATCTCGC-T-CCTGTGCTAAAGATACGAAACGC-CAGATCGCGTGACGGGGTCTTGTAAAAGTAGGTTCTC-GGTGGGGTTAGCAAGGCGACTGCTTTAGCTGCTGAACGA-CCCCGTGAGTATGATGCTAAGTGTACTATTTAAACTGGACGAGTTCAC-TTGTCGCCATCATACG--TCGTGCTATATATCCGTCTCCATA-TAT-AAGTCCCGTGAGGGGCC-GGGCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAAC-CAGAAGTTCAGAGCGATCTCGGGCTAATCCACTGAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGAGGGGGAAAAAACTTTACTTTTAGAGAAC 632 [I2:G,S2:G->C,D6:C,I11:G,S12:G->T,S16:T->G,D17:G,I35:T,I35:C,D36:C,S37:T->G,D40:G,I71:G,I71:G,S71:G->C,D72:G,D74:C,I101:T,S102:T->C,D103:C,I119:G,I119:G,D121:G,D122:G,D129:T,I131:T,I132:G,D134:G,I142:A,D144:A,I148:G,S148:G->T,D151:T,I175:A,S176:A->G,I177:A,S177:G->C,D178:A,D179:C,I236:G,S236:G->A,S237:A->C,S240:C->G,D241:G,I286:A,S286:A->T,S287:T->C,S288:C->G,D289:G,I296:G,D297:G,D302:T,I304:T,D320:G,I322:G,I353:G,S353:G->A,D354:A,I377:A,S378:A->G,D379:G,I395:G,D396:G,D402:T,I404:T,D423:T,D424:C,S425:G->T,S426:T->C,S428:C->T,I429:G,I429:C,D447:T,S448:A->T,I449:A,D467:G,I469:G,I549:T,S549:T->C,I551:A,S552:A->T,D553:C,D554:T,D605:G,I607:G,I610:A,I610:A,D612:A,D614:A,I617:T,D619:T] 0 GT-GCCCCGGGA-GGTTTTGCAACGTCACATCCACGT--TCTGGGTTGAAGACGTGCTAAGTGATAGGAGAATAA--GGCCGCAAAGATCCGGTTCAATGGGAATTA-TTCAAATTCCCCTACCAT--GGGGGAGACGTT-C-GGGGTGTCAG-AAACTA-GTTTTAGTGGCGAACTAGAGGCCGTCC-AA-GACATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCGCCATGGGACGTTACTCTCGC-GACCCGTTACAATGACATCTCGCTCCTGTGCTAAAGATACGAAACGCCAG-ATCGCGTGAC-GGGGTCTT-GTAAAAGTAGGTTCTCGG-TGGGGTTAGCAAGGCGACTGCTTTAGCTGCT-GAACGACCCCGTGAGTATGATGCT-AAGTGTACTATTTAAACT-GGACGAGTT-CACTTGTCGCCATCATACGTCGTGC--TATATATCCGTCTCCATATA-TAAGTCCCGTGAGGGGCCGG-GCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAACCAGAAGTTCAGAGCGATCTCGGGCTAA-TC-CACTGAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGAGG-GGG--AAAAAAC-TTTACTTTTAGAGAAC 632 || ||| |||| | ||| ||||||||||||||||| | || |||||||||||||||||||||||||||||| | |||||||||||||||||||||||||| | ||||||||||||||| || |||||| | | || ||||||| || ||| || ||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||||||| |||||| | |||| | |||||||||||||||| | ||||||||||||||||||||||||||||||| |||||||||||||||||||||| | ||||||||||||||| | ||||| | ||||||||||||||||||| | |||||||||||||||||| |||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | | |||||||||||||||||||||||||||||||||||||||||||||||||| | ||| || | || || ||||||||||||| 0 GTGCCCC-GGGAGGTTTTG-CAACGTCACATCCACGTTCT-GGG-TTGAAGACGTGCTAAGTGATAGGAGAATAAGGC-C-GCAAAGATCCGGTTCAATGGGAATTATTC-AAATTCCCCTACCATGGGG--GAGACG-TTCGGG-GTGTCAGAAA-CTAGTTT-TAGTGGCGAACTAGAGGCCGTCCAAGAC--ATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCGCCATGGGACGTTACTCTCGCGACCCG-TTACAATGACATCTCGCTCCTGTGCTAAAGATACGAAACGCCAGATCG-CGTGACGG-GGTC-TTGTAAAAGTAGGTTCTC-GGTGGGGTTAGCAAGGCGACTGCTTTAGCTGCTGA-ACGACCCCGTGAGTATGATGCTAAG-TGTACTATTTAAACTGG-ACGAG-TTCACTTGTCGCCATCATACG--TCGTGCTATATATCCGTCTCCATA-TATAAGTCCCGTGAGGGGCC-GGGCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAACCAGAAGTTCAGAGCGATCTCGGGCTAATCCACT--GAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGA-GGGGGAAAA-A-ACTTT-ACTTTTAGAGAAC 632 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT Pending / IO / Serde: 1 / 0 / 2 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6799510 Write time: 5.37s O. Stats: Wall clock time: 5.4s Total CPU time: 10.92s User wait time: 4.02s Serialization time: 8.37s (76.63%) Checksum calculation time: 1.77s (16.25%) Compression time: 677.05ms (6.2%) Total IO delay: 534.73ms Concurrency overhead: 508.26ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 12.14MiB/s Concurrency adjusted uncompressed speed: 5.47MiB/s Actual uncompressed speed: 3.42MiB/s Actual speed: 1.2MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 Pending / IO / Serde: 2 / 1 / 0 I. Stats 1: Wall clock time: 4.3s Total CPU time: 6.48s Serialization time: 4.98s (76.87%) Checksum calculation time: 571.7ms (8.82%) Compression time: 906.91ms (13.99%) Total IO delay: 474.53ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 13.68MiB/s Concurrency adjusted uncompressed speed: 10.6MiB/s Actual uncompressed speed: 4.28MiB/s Actual speed: 1.51MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 7.74s Total CPU time: 9.73s Serialization time: 6.73s (69.16%) Checksum calculation time: 1.15s (11.77%) Compression time: 1.8s (18.52%) Total IO delay: 817.32ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 15.87MiB/s Concurrency adjusted uncompressed speed: 13.98MiB/s Actual uncompressed speed: 4.77MiB/s Actual speed: 1.68MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6791878 Write time: 3.39s O. Stats: Wall clock time: 3.4s Total CPU time: 4.04s User wait time: 2.54s Serialization time: 2.46s (60.93%) Checksum calculation time: 441.02ms (10.91%) Compression time: 1.08s (26.73%) Total IO delay: 603.73ms Concurrency overhead: 122.79ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 10.74MiB/s Concurrency adjusted uncompressed speed: 14.36MiB/s Actual uncompressed speed: 5.43MiB/s Actual speed: 1.91MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 2.25s Total CPU time: 2.43s Serialization time: 1.07s (44.04%) Checksum calculation time: 362.92ms (14.95%) Compression time: 982.8ms (40.48%) Total IO delay: 320.45ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 20.24MiB/s Concurrency adjusted uncompressed speed: 26.84MiB/s Actual uncompressed speed: 8.19MiB/s Actual speed: 2.88MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 1 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 5.23s Total CPU time: 4.83s Serialization time: 2.08s (43.04%) Checksum calculation time: 763.51ms (15.82%) Compression time: 1.95s (40.32%) Total IO delay: 610.16ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 21.24MiB/s Concurrency adjusted uncompressed speed: 27.13MiB/s Actual uncompressed speed: 7.05MiB/s Actual speed: 2.48MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: false Concurrency: 1 File size: 6799510 Write time: 4.94s O. Stats: Wall clock time: 4.95s Total CPU time: 3.44s User wait time: 4.47s Serialization time: 1.89s (54.86%) Checksum calculation time: 440.27ms (12.8%) Compression time: 1.03s (30.03%) Total IO delay: 519.92ms Concurrency overhead: 359.89ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 12.49MiB/s Concurrency adjusted uncompressed speed: 4.27MiB/s Actual uncompressed speed: 3.73MiB/s Pending / IO / Serde: 0 / 0 / 0 Actual speed: 1.31MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 0 / 1 / 0 I. Stats 1: Wall clock time: 2.29s Total CPU time: 2.77s Serialization time: 1.34s (48.51%) Checksum calculation time: 509.75ms (18.39%) Compression time: 864.51ms (31.19%) Total IO delay: 456.45ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 14.22MiB/s Concurrency adjusted uncompressed speed: 5.71MiB/s Actual uncompressed speed: 8.06MiB/s Actual speed: 2.83MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 1 / 0 I. Stats 2: Wall clock time: 5.17s Total CPU time: 5.89s Serialization time: 2.95s (50.08%) Checksum calculation time: 1.17s (19.89%) Compression time: 1.67s (28.45%) Total IO delay: 904.69ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 14.35MiB/s Concurrency adjusted uncompressed speed: 5.43MiB/s Actual uncompressed speed: 7.13MiB/s Actual speed: 2.51MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 Write time: 3.36s O. Stats: Wall clock time: 3.36s Total CPU time: 2.48s User wait time: 3.02s Serialization time: 1.54s (62.13%) Checksum calculation time: 271.45ms (10.93%) Compression time: 613.21ms (24.7%) Total IO delay: 388.62ms Concurrency overhead: 39.18ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 16.69MiB/s Concurrency adjusted uncompressed speed: 6.34MiB/s Actual uncompressed speed: 5.48MiB/s Actual speed: 1.93MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 2.2s Total CPU time: 2.37s Serialization time: 905.37ms (38.22%) Checksum calculation time: 462.73ms (19.53%) Compression time: 983.92ms (41.53%) Total IO delay: 276.17ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 23.47MiB/s Concurrency adjusted uncompressed speed: 6.97MiB/s Actual uncompressed speed: 8.4MiB/s Actual speed: 2.95MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 5.33s Total CPU time: 5.34s Serialization time: 2.05s (38.36%) Checksum calculation time: 980.68ms (18.37%) Compression time: 2.23s (41.79%) Total IO delay: 532.22ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 24.35MiB/s Concurrency adjusted uncompressed speed: 6.28MiB/s Actual uncompressed speed: 6.92MiB/s Actual speed: 2.43MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 2 Pending / IO / Serde: 2 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 53.9s O. Stats: Wall clock time: 53.93s Total CPU time: 2.45m User wait time: 50.69s Serialization time: 1.96s (1.33%) Checksum calculation time: 669.51ms (0.46%) Compression time: 2.4m (98.1%) Total IO delay: 540.62ms Concurrency overhead: 386.74ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 7.34MiB/s Concurrency adjusted uncompressed speed: 506.71KiB/s Actual uncompressed speed: 350.07KiB/s Actual speed: 75.26KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 2.12s Total CPU time: 2.96s Serialization time: 1.31s (44.18%) Checksum calculation time: 659.23ms (22.31%) Compression time: 963.67ms (32.61%) Total IO delay: 304.6ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 13.04MiB/s Concurrency adjusted uncompressed speed: 22.62MiB/s Actual uncompressed speed: 8.69MiB/s Actual speed: 1.87MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 4.66s Total CPU time: 5.57s Serialization time: 2.58s (46.29%) Checksum calculation time: 1.1s (19.78%) Compression time: 1.84s (33.09%) Total IO delay: 537.33ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 14.76MiB/s Concurrency adjusted uncompressed speed: 24.16MiB/s Actual uncompressed speed: 7.91MiB/s Actual speed: 1.7MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 1 / 0 / 1 Pending / IO / Serde: 1 / 0 / 1 Pending / IO / Serde: 1 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 1.18m O. Stats: Wall clock time: 1.18m Total CPU time: 1.98m User wait time: 1.06m Serialization time: 1.46s (1.23%) Checksum calculation time: 381.41ms (0.32%) Compression time: 1.95m (98.36%) Total IO delay: 303.63ms Concurrency overhead: 77.01ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 12.9MiB/s Concurrency adjusted uncompressed speed: 630.93KiB/s Actual uncompressed speed: 267.33KiB/s Actual speed: 56.68KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 1.61s Total CPU time: 1.81s Serialization time: 655.18ms (36.25%) Checksum calculation time: 391.67ms (21.67%) Compression time: 756.85ms (41.88%) Total IO delay: 188.37ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 20.79MiB/s Concurrency adjusted uncompressed speed: 37.02MiB/s Actual uncompressed speed: 11.44MiB/s Actual speed: 2.43MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 3.67s Total CPU time: 3.66s Serialization time: 1.33s (36.46%) Checksum calculation time: 750.01ms (20.51%) Compression time: 1.57s (42.85%) Total IO delay: 328.64ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 23.83MiB/s Concurrency adjusted uncompressed speed: 37.02MiB/s Actual uncompressed speed: 10.05MiB/s Actual speed: 2.13MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Gradle is still running, please be patient... Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 0 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 1.33m O. Stats: Wall clock time: 1.33m Total CPU time: 1.31m User wait time: 1.32m Serialization time: 963.73ms (1.22%) Checksum calculation time: 323.03ms (0.41%) Compression time: 1.29m (98.28%) Total IO delay: 279.66ms Concurrency overhead: 154.1ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 14.21MiB/s Concurrency adjusted uncompressed speed: 238.39KiB/s Actual uncompressed speed: 237.38KiB/s Actual speed: 51.03KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 1.17s Total CPU time: 1.28s Serialization time: 507.33ms (39.79%) Checksum calculation time: 292.51ms (22.94%) Compression time: 462.15ms (36.24%) Total IO delay: 205.3ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 19.34MiB/s Concurrency adjusted uncompressed speed: 12.46MiB/s Actual uncompressed speed: 15.83MiB/s Actual speed: 3.4MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 2.49s Total CPU time: 2.73s Serialization time: 1.11s (40.65%) Checksum calculation time: 650.98ms (23.87%) Compression time: 931.94ms (34.18%) Total IO delay: 434.85ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 18.27MiB/s Concurrency adjusted uncompressed speed: 11.67MiB/s Actual uncompressed speed: 14.79MiB/s Actual speed: 3.18MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 1 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 1 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 1.64m O. Stats: Wall clock time: 1.64m Total CPU time: 1.63m User wait time: 1.63m Serialization time: 1.43s (1.46%) Checksum calculation time: 380.52ms (0.39%) Compression time: 1.59m (97.58%) Total IO delay: 290.11ms Concurrency overhead: 44.51ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 13.48MiB/s Concurrency adjusted uncompressed speed: 192.94KiB/s Actual uncompressed speed: 191.41KiB/s Actual speed: 40.58KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 2.36s Total CPU time: 2.57s Serialization time: 913.26ms (35.49%) Checksum calculation time: 584.78ms (22.73%) Compression time: 1.07s (41.68%) Total IO delay: 207.97ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 18.88MiB/s Concurrency adjusted uncompressed speed: 6.63MiB/s Actual uncompressed speed: 7.82MiB/s Actual speed: 1.66MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 4.5s Total CPU time: 4.76s Serialization time: 1.66s (34.95%) Checksum calculation time: 1.06s (22.36%) Compression time: 2.01s (42.23%) Total IO delay: 330.7ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 23.69MiB/s Concurrency adjusted uncompressed speed: 7.25MiB/s Actual uncompressed speed: 8.2MiB/s Actual speed: 1.74MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 0 / 0 / 0 Pending / IO / Serde / Objs: 0 / 0 / 0 / 0 Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 Pending / IO / Serde / Objs: 0 / 0 / 4 / 0 Pending / IO / Serde / Objs: 0 / 0 / 4 / 0 Pending / IO / Serde / Objs: 0 / 0 / 3 / 1000 Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 Pending / IO / Serde / Objs: 1 / 1 / 2 / 2000 Pending / IO / Serde / Objs: 0 / 1 / 3 / 2000 Pending / IO / Serde / Objs: 0 / 1 / 3 / 2000 Pending / IO / Serde / Objs: 0 / 1 / 4 / 2000 Pending / IO / Serde / Objs: 0 / 1 / 4 / 2000 Pending / IO / Serde / Objs: 0 / 1 / 4 / 2000 Pending / IO / Serde / Objs: 0 / 0 / 4 / 2000 Pending / IO / Serde / Objs: 0 / 0 / 4 / 2000 Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 Pending / IO / Serde / Objs: 2 / 1 / 2 / 6000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 7000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 7000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 7000 Pending / IO / Serde / Objs: 4 / 1 / 0 / 9000 Pending / IO / Serde / Objs: 4 / 1 / 1 / 9000 Pending / IO / Serde / Objs: 4 / 1 / 1 / 9000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 9000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 9000 Pending / IO / Serde / Objs: 3 / 1 / 3 / 9000 Pending / IO / Serde / Objs: 3 / 1 / 3 / 9000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 10000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 10000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 10000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 11000 Pending / IO / Serde / Objs: 3 / 1 / 2 / 11000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 12000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 12000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 12000 Pending / IO / Serde / Objs: 4 / 1 / 3 / 12000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 13000 Pending / IO / Serde / Objs: 5 / 1 / 1 / 14000 Pending / IO / Serde / Objs: 5 / 1 / 2 / 14000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 14000 Pending / IO / Serde / Objs: 5 / 1 / 1 / 15000 Pending / IO / Serde / Objs: 5 / 1 / 2 / 15000 Pending / IO / Serde / Objs: 5 / 1 / 1 / 16000 Pending / IO / Serde / Objs: 5 / 1 / 1 / 16000 Pending / IO / Serde / Objs: 5 / 1 / 2 / 16000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 16000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 16000 Pending / IO / Serde / Objs: 5 / 1 / 1 / 17000 Pending / IO / Serde / Objs: 5 / 1 / 2 / 17000 Pending / IO / Serde / Objs: 4 / 1 / 2 / 17000 Pending / IO / Serde / Objs: 5 / 1 / 1 / 18000 Pending / IO / Serde / Objs: 5 / 1 / 2 / 18000 Pending / IO / Serde / Objs: 5 / 1 / 2 / 18000 Pending / IO / Serde / Objs: 5 / 1 / 2 / 18000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 4 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 4 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 3 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 3 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 2 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 2 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 O. Stats: Wall clock time: 3.34m Total CPU time: 6.51m User wait time: 3.38s Serialization time: 2.68m (41.21%) Checksum calculation time: 1.23m (18.82%) Compression time: 1.28m (19.63%) Total IO delay: 2.52m Concurrency overhead: 83.2ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 12.64MiB/s Concurrency adjusted uncompressed speed: 28.13MiB/s Actual uncompressed speed: 9.52MiB/s Actual speed: 9.52MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_4d4d3a784c5d582ceb1b218ead5ed0fcfc7963b113534665982036306643 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_d0a27808f56efe3a0932823582064c9e793f31d913202385358666746610.tmp com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 1.48s Sorting: 2.91s 1 217 41575 99492 99996 com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_7d0dc097c69ad7813703884c611ff964a6b5b5918170491752606521517 timeInCollate: 1.1m timeInCollatorInit: 43.37s timeAwaitingO: 19.33ms timeAwaitingI: 26.64s timeInFinalSorting1: 0ns timeInFinalSorting2: 127.03ms timeInFinalSorting3: 333.27ms /12S (5|27|32): objs=50000 size=3.06MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_9156ef3a9878176aa8a71c85765efc348cca0a387741342684740479724 Gradle is still running, please be patient... timeInCollate: 4.13m timeInCollatorInit: 31.35s timeAwaitingO: 19.03s timeAwaitingI: 1.16m timeInFinalSorting1: 26.53s timeInFinalSorting2: 19.44s timeInFinalSorting3: 10.4s /0N (5|27|32): objs=156806 size=9.1MiB /1N (5|27|32): objs=154771 size=8.66MiB /2N (5|27|32): objs=155155 size=8.83MiB /3N (5|27|32): objs=164341 size=9.58MiB /4N (5|27|32): objs=162751 size=9.49MiB /5N (5|27|32): objs=152538 size=8.43MiB /6N (5|27|32): objs=152899 size=8.68MiB /7N (5|27|32): objs=158319 size=8.94MiB /8N (5|27|32): objs=148320 size=8.3MiB /9N (5|27|32): objs=158610 size=9.2MiB /10N (5|27|32): objs=154443 size=8.51MiB /11N (5|27|32): objs=159396 size=8.91MiB /12N (5|27|32): objs=157208 size=9.02MiB /13N (5|27|32): objs=162588 size=9.33MiB /14N (5|27|32): objs=157262 size=8.94MiB /15N (5|27|32): objs=154456 size=8.42MiB /16N (5|27|32): objs=156726 size=8.85MiB /17N (5|27|32): objs=156721 size=8.87MiB /18N (5|27|32): objs=155697 size=8.85MiB /19N (5|27|32): objs=158234 size=8.8MiB /20N (5|27|32): objs=147752 size=8.12MiB /21N (5|27|32): objs=149218 size=8.31MiB /22N (5|27|32): objs=142336 size=7.56MiB /23N (5|27|32): objs=155518 size=8.61MiB /24N (5|27|32): objs=148777 size=8.25MiB /25N (5|27|32): objs=155156 size=8.81MiB /26N (5|27|32): objs=158594 size=9.2MiB /27N (5|27|32): objs=162778 size=9.25MiB /28N (5|27|32): objs=160593 size=9.28MiB /29N (5|27|32): objs=161072 size=9.12MiB /30N (5|27|32): objs=164536 size=9.5MiB /31N (5|27|32): objs=156429 size=9.15MiB /0/0N (2|25|36): objs=43417 size=1.04MiB /0/1N (2|25|36): objs=36605 size=881.99KiB /0/2N (2|25|36): objs=41055 size=902.11KiB /0/3S (2|25|36): objs=158 size=178B /0/4N (2|25|36): objs=2134 size=9.91KiB /0/5N (2|25|36): objs=885 size=3.58KiB /0/6S (2|25|36): objs=128 size=217B /0/7N (2|25|36): objs=3672 size=16.83KiB /0/8S (2|25|36): objs=147 size=119B /0/9N (2|25|36): objs=2246 size=9.84KiB /0/10S (2|25|36): objs=151 size=116B /0/11N (2|25|36): objs=3799 size=16.54KiB /0/12S (2|25|36): objs=138 size=326B /0/13N (2|25|36): objs=1386 size=5.75KiB /0/14S (2|25|36): objs=169 size=274B /0/15N (2|25|36): objs=2504 size=10.87KiB /0/16S (2|25|36): objs=154 size=306B /0/18S (2|25|36): objs=147 size=298B /0/19N (2|25|36): objs=2805 size=12.66KiB /0/20S (2|25|36): objs=140 size=172B /0/21N (2|25|36): objs=3494 size=14.76KiB /0/22S (2|25|36): objs=151 size=104B /0/23N (2|25|36): objs=619 size=2.15KiB /0/24S (2|25|36): objs=153 size=276B /0/25N (2|25|36): objs=4744 size=21.74KiB /0/26S (2|25|36): objs=143 size=135B /0/27N (2|25|36): objs=1385 size=5.8KiB /0/28S (2|25|36): objs=132 size=299B /0/29N (2|25|36): objs=987 size=3.78KiB /0/30S (2|25|36): objs=155 size=225B /0/31N (2|25|36): objs=2312 size=9.57KiB /0/32S (2|25|36): objs=109 size=168B /0/33N (2|25|36): objs=419 size=1.59KiB /0/34S (2|25|36): objs=163 size=332B /1/0N (2|25|36): objs=42061 size=967.22KiB /1/1N (2|25|36): objs=35647 size=635.83KiB /1/2N (2|25|36): objs=37171 size=811.3KiB /1/3S (2|25|36): objs=149 size=292B /1/4N (2|25|36): objs=792 size=3.07KiB /1/5N (2|25|36): objs=11950 size=73.02KiB /1/6S (2|25|36): objs=156 size=249B /1/7N (2|25|36): objs=1572 size=6.48KiB /1/8S (2|25|36): objs=136 size=196B /1/9N (2|25|36): objs=1003 size=3.73KiB /1/10S (2|25|36): objs=167 size=129B /1/11N (2|25|36): objs=443 size=1.32KiB /1/12S (2|25|36): objs=162 size=259B /1/13N (2|25|36): objs=3439 size=17.09KiB /1/14S (2|25|36): objs=151 size=194B /1/15N (2|25|36): objs=708 size=2.72KiB /1/16S (2|25|36): objs=159 size=280B /1/17N (2|25|36): objs=6701 size=33.08KiB /1/18S (2|25|36): objs=152 size=298B /1/19N (2|25|36): objs=309 size=869B /1/20S (2|25|36): objs=170 size=106B /1/21N (2|25|36): objs=1803 size=7.33KiB /1/22S (2|25|36): objs=164 size=150B /1/23N (2|25|36): objs=920 size=3.74KiB /1/24S (2|25|36): objs=153 size=215B /1/25N (2|25|36): objs=1109 size=4.42KiB /1/26S (2|25|36): objs=145 size=213B /1/27N (2|25|36): objs=762 size=2.96KiB /1/28S (2|25|36): objs=170 size=145B /1/30S (2|25|36): objs=130 size=172B /1/31N (2|25|36): objs=274 size=807B /1/32S (2|25|36): objs=151 size=95B /1/33N (2|25|36): objs=566 size=1.96KiB /1/34S (2|25|36): objs=129 size=327B /1/35N (2|25|36): objs=5097 size=24.07KiB /2/0N (2|25|36): objs=39973 size=917.01KiB /2/1N (2|25|36): objs=38392 size=837.36KiB /2/2N (2|25|36): objs=34839 size=703.6KiB /2/3S (2|25|36): objs=143 size=167B /2/4N (2|25|36): objs=450 size=1.49KiB /2/5S (2|25|36): objs=124 size=255B /2/6N (2|25|36): objs=881 size=3.41KiB /2/7S (2|25|36): objs=152 size=315B /2/9S (2|25|36): objs=165 size=286B /2/10N (2|25|36): objs=2573 size=11.36KiB /2/11N (2|25|36): objs=7695 size=37.06KiB /2/12S (2|25|36): objs=150 size=131B /2/13N (2|25|36): objs=2181 size=9.18KiB /2/14S (2|25|36): objs=141 size=148B /2/15N (2|25|36): objs=2330 size=10.2KiB /2/16S (2|25|36): objs=175 size=107B /2/17N (2|25|36): objs=1920 size=7.95KiB /2/18S (2|25|36): objs=139 size=124B /2/19N (2|25|36): objs=1360 size=5.84KiB /2/20S (2|25|36): objs=161 size=271B /2/21N (2|25|36): objs=4829 size=21.72KiB /2/22S (2|25|36): objs=170 size=210B /2/23N (2|25|36): objs=2585 size=10.8KiB /2/24S (2|25|36): objs=150 size=202B /2/25N (2|25|36): objs=2098 size=8.68KiB /2/26S (2|25|36): objs=153 size=214B /2/27N (2|25|36): objs=1113 size=4.62KiB /2/28S (2|25|36): objs=131 size=276B /2/29N (2|25|36): objs=5615 size=25.39KiB /2/30S (2|25|36): objs=139 size=326B /2/32S (2|25|36): objs=159 size=202B /2/33N (2|25|36): objs=3775 size=16.81KiB /2/34S (2|25|36): objs=151 size=239B /2/35S (2|25|36): objs=143 size=219B /3/0N (2|25|36): objs=40357 size=944.89KiB /3/1N (2|25|36): objs=6119 size=30.8KiB /3/2S (2|25|36): objs=161 size=109B /3/3N (2|25|36): objs=32102 size=609.45KiB /3/4N (2|25|36): objs=39847 size=844.28KiB /3/5N (2|25|36): objs=3353 size=15.25KiB /3/6S (2|25|36): objs=157 size=182B /3/7N (2|25|36): objs=10462 size=54.32KiB /3/8S (2|25|36): objs=173 size=307B /3/9N (2|25|36): objs=1700 size=7.2KiB /3/10S (2|25|36): objs=149 size=101B /3/11N (2|25|36): objs=413 size=1.46KiB /3/12S (2|25|36): objs=168 size=271B /3/13N (2|25|36): objs=1587 size=6.74KiB /3/14S (2|25|36): objs=142 size=222B /3/15N (2|25|36): objs=4990 size=22.99KiB /3/16S (2|25|36): objs=158 size=326B /3/18S (2|25|36): objs=151 size=118B /3/19N (2|25|36): objs=4282 size=19.4KiB /3/20S (2|25|36): objs=148 size=249B /3/21N (2|25|36): objs=1811 size=7.53KiB /3/22S (2|25|36): objs=163 size=152B /3/23N (2|25|36): objs=2009 size=8.42KiB /3/24S (2|25|36): objs=150 size=209B /3/26S (2|25|36): objs=172 size=201B /3/27N (2|25|36): objs=2186 size=9.56KiB /3/28S (2|25|36): objs=144 size=94B /3/29N (2|25|36): objs=1763 size=7.29KiB /3/30S (2|25|36): objs=150 size=167B /3/31N (2|25|36): objs=2192 size=9.61KiB /3/32S (2|25|36): objs=140 size=92B /3/33N (2|25|36): objs=1696 size=7.44KiB /3/34S (2|25|36): objs=144 size=313B /3/35N (2|25|36): objs=5002 size=22.92KiB /4/0N (2|25|36): objs=37867 size=852.38KiB /4/1N (2|25|36): objs=42453 size=1.07MiB /4/2N (2|25|36): objs=40242 size=1.01MiB /4/3N (2|25|36): objs=6397 size=30.89KiB /4/4S (2|25|36): objs=162 size=185B /4/5N (2|25|36): objs=451 size=1.6KiB /4/6S (2|25|36): objs=165 size=126B /4/7N (2|25|36): objs=867 size=3.42KiB /4/8S (2|25|36): objs=149 size=140B /4/9N (2|25|36): objs=1549 size=6.56KiB /4/10S (2|25|36): objs=174 size=245B /4/11N (2|25|36): objs=621 size=2.05KiB /4/12S (2|25|36): objs=155 size=179B /4/13N (2|25|36): objs=571 size=2.12KiB /4/14S (2|25|36): objs=155 size=156B /4/15N (2|25|36): objs=631 size=2.21KiB /4/16S (2|25|36): objs=156 size=293B /4/17N (2|25|36): objs=1070 size=4.37KiB /4/18S (2|25|36): objs=162 size=119B /4/20S (2|25|36): objs=145 size=245B /4/21S (2|25|36): objs=150 size=245B /4/22S (2|25|36): objs=150 size=314B /4/23N (2|25|36): objs=9534 size=43.8KiB /4/24S (2|25|36): objs=168 size=150B /4/25N (2|25|36): objs=1038 size=4.15KiB /4/26S (2|25|36): objs=156 size=160B /4/27N (2|25|36): objs=308 size=951B /4/28S (2|25|36): objs=148 size=146B /4/29N (2|25|36): objs=2762 size=12.22KiB /4/30S (2|25|36): objs=183 size=265B /4/31N (2|25|36): objs=1180 size=4.93KiB /4/32S (2|25|36): objs=138 size=326B /4/33N (2|25|36): objs=10502 size=53.92KiB /4/34S (2|25|36): objs=170 size=254B /4/35N (2|25|36): objs=2022 size=9.87KiB /5/0N (2|25|36): objs=35697 size=718.77KiB /5/1N (2|25|36): objs=38198 size=757.29KiB /5/2N (2|25|36): objs=18321 size=170.11KiB /5/3S (2|25|36): objs=167 size=332B /5/4N (2|25|36): objs=16759 size=125.4KiB /5/5N (2|25|36): objs=3038 size=13.11KiB /5/6S (2|25|36): objs=162 size=293B /5/7N (2|25|36): objs=1592 size=6.45KiB /5/8S (2|25|36): objs=131 size=97B /5/9N (2|25|36): objs=478 size=1.71KiB /5/10S (2|25|36): objs=156 size=167B /5/11N (2|25|36): objs=4865 size=20.69KiB /5/12S (2|25|36): objs=157 size=301B /5/13N (2|25|36): objs=598 size=2.07KiB /5/14S (2|25|36): objs=146 size=131B /5/15N (2|25|36): objs=1736 size=7.13KiB /5/16S (2|25|36): objs=155 size=125B /5/17N (2|25|36): objs=773 size=3.2KiB /5/18S (2|25|36): objs=164 size=91B /5/19N (2|25|36): objs=6358 size=33.95KiB /5/20S (2|25|36): objs=152 size=247B /5/21N (2|25|36): objs=1220 size=4.96KiB /5/22S (2|25|36): objs=144 size=199B /5/23N (2|25|36): objs=1859 size=7.64KiB /5/24S (2|25|36): objs=149 size=198B /5/25N (2|25|36): objs=2634 size=12.27KiB /5/26S (2|25|36): objs=161 size=233B /5/27N (2|25|36): objs=638 size=2.13KiB /5/28S (2|25|36): objs=143 size=165B /5/29N (2|25|36): objs=9544 size=55.04KiB /5/30S (2|25|36): objs=145 size=159B /5/31N (2|25|36): objs=1006 size=3.75KiB /5/32S (2|25|36): objs=149 size=300B /5/33N (2|25|36): objs=4789 size=23.09KiB /5/34S (2|25|36): objs=154 size=244B /6/0N (2|25|36): objs=18720 size=159.85KiB /6/1S (2|25|36): objs=145 size=185B /6/2N (2|25|36): objs=21231 size=219.34KiB /6/3N (2|25|36): objs=40719 size=949.46KiB /6/4N (2|25|36): objs=39725 size=1.01MiB /6/5N (2|25|36): objs=2097 size=8.9KiB /6/6S (2|25|36): objs=147 size=172B /6/7S (2|25|36): objs=156 size=299B /6/8S (2|25|36): objs=143 size=142B /6/9N (2|25|36): objs=5725 size=27.17KiB /6/10S (2|25|36): objs=143 size=169B /6/11N (2|25|36): objs=2439 size=10.16KiB /6/12S (2|25|36): objs=127 size=141B /6/13N (2|25|36): objs=1822 size=7.42KiB /6/14S (2|25|36): objs=153 size=309B /6/15N (2|25|36): objs=1991 size=8.38KiB /6/16S (2|25|36): objs=167 size=299B /6/17N (2|25|36): objs=5338 size=24.92KiB /6/18S (2|25|36): objs=159 size=193B /6/19N (2|25|36): objs=303 size=869B /6/20S (2|25|36): objs=154 size=148B /6/21N (2|25|36): objs=862 size=3.39KiB /6/22S (2|25|36): objs=154 size=99B /6/23N (2|25|36): objs=1331 size=5.57KiB /6/24S (2|25|36): objs=164 size=207B /6/25N (2|25|36): objs=1974 size=8.29KiB /6/26S (2|25|36): objs=152 size=336B /6/27N (2|25|36): objs=314 size=998B /6/28S (2|25|36): objs=158 size=146B /6/29N (2|25|36): objs=1020 size=3.95KiB /6/30S (2|25|36): objs=160 size=239B /6/31N (2|25|36): objs=3359 size=15.74KiB /6/32S (2|25|36): objs=137 size=317B /6/33N (2|25|36): objs=456 size=1.49KiB /6/34S (2|25|36): objs=138 size=309B /6/35N (2|25|36): objs=916 size=3.55KiB /7/0N (2|25|36): objs=42204 size=1.08MiB /7/1N (2|25|36): objs=36875 size=770.35KiB /7/2N (2|25|36): objs=38386 size=692.24KiB /7/3N (2|25|36): objs=7585 size=35.25KiB /7/4S (2|25|36): objs=169 size=114B /7/5N (2|25|36): objs=1415 size=5.63KiB /7/6S (2|25|36): objs=156 size=141B /7/7N (2|25|36): objs=1375 size=5.66KiB /7/8S (2|25|36): objs=160 size=198B /7/9N (2|25|36): objs=1950 size=8.29KiB /7/10S (2|25|36): objs=135 size=307B /7/11N (2|25|36): objs=4612 size=22.61KiB /7/12S (2|25|36): objs=156 size=96B /7/13N (2|25|36): objs=8452 size=40.34KiB /7/14S (2|25|36): objs=159 size=333B /7/16S (2|25|36): objs=159 size=106B /7/18S (2|25|36): objs=147 size=179B /7/19N (2|25|36): objs=1343 size=5.5KiB /7/20S (2|25|36): objs=156 size=154B /7/21N (2|25|36): objs=2775 size=13.47KiB /7/22S (2|25|36): objs=164 size=271B /7/23N (2|25|36): objs=4506 size=19.9KiB /7/24S (2|25|36): objs=185 size=207B /7/25S (2|25|36): objs=165 size=339B /7/26S (2|25|36): objs=156 size=214B /7/27N (2|25|36): objs=1172 size=4.83KiB /7/28S (2|25|36): objs=152 size=212B /7/29N (2|25|36): objs=1347 size=5.25KiB /7/30S (2|25|36): objs=150 size=235B /7/31N (2|25|36): objs=454 size=1.72KiB /7/32S (2|25|36): objs=160 size=114B /7/33N (2|25|36): objs=623 size=2.22KiB /7/34S (2|25|36): objs=132 size=254B /7/35N (2|25|36): objs=584 size=2.15KiB /8/0N (2|25|36): objs=36841 size=728.29KiB /8/1N (2|25|36): objs=34797 size=632.47KiB /8/2N (2|25|36): objs=39711 size=835.12KiB /8/3N (2|25|36): objs=15230 size=108.82KiB /8/4S (2|25|36): objs=161 size=246B /8/5N (2|25|36): objs=1707 size=6.98KiB /8/6S (2|25|36): objs=142 size=225B /8/8S (2|25|36): objs=163 size=138B /8/9N (2|25|36): objs=2376 size=10.13KiB /8/10S (2|25|36): objs=150 size=205B /8/11N (2|25|36): objs=275 size=886B /8/12S (2|25|36): objs=152 size=256B /8/13N (2|25|36): objs=415 size=1.51KiB /8/14S (2|25|36): objs=127 size=197B /8/15N (2|25|36): objs=2418 size=10.19KiB /8/16S (2|25|36): objs=150 size=296B /8/17N (2|25|36): objs=2716 size=12.61KiB /8/18S (2|25|36): objs=160 size=270B /8/19S (2|25|36): objs=148 size=201B /8/20S (2|25|36): objs=151 size=248B /8/22S (2|25|36): objs=147 size=225B /8/23S (2|25|36): objs=164 size=129B /8/24S (2|25|36): objs=150 size=172B /8/25N (2|25|36): objs=1689 size=6.84KiB /8/26S (2|25|36): objs=167 size=276B /8/28S (2|25|36): objs=147 size=339B /8/29N (2|25|36): objs=3136 size=13.27KiB /8/30S (2|25|36): objs=136 size=148B /8/32S (2|25|36): objs=155 size=314B /8/33N (2|25|36): objs=4288 size=20.87KiB /8/34S (2|25|36): objs=151 size=221B /9/0N (2|25|36): objs=41153 size=1013.84KiB /9/1N (2|25|36): objs=41583 size=972.55KiB /9/2N (2|25|36): objs=39405 size=996.66KiB /9/3N (2|25|36): objs=2091 size=8.88KiB /9/4S (2|25|36): objs=163 size=105B /9/5N (2|25|36): objs=1039 size=4.01KiB /9/6S (2|25|36): objs=145 size=138B /9/7S (2|25|36): objs=186 size=204B /9/8S (2|25|36): objs=145 size=123B /9/9N (2|25|36): objs=3539 size=16.35KiB /9/10S (2|25|36): objs=151 size=265B /9/11N (2|25|36): objs=1284 size=5.04KiB /9/12S (2|25|36): objs=168 size=330B /9/13N (2|25|36): objs=1323 size=5.22KiB /9/14S (2|25|36): objs=143 size=186B /9/15N (2|25|36): objs=3475 size=16.07KiB /9/16S (2|25|36): objs=178 size=346B /9/17N (2|25|36): objs=7537 size=33.44KiB /9/18S (2|25|36): objs=158 size=90B /9/19N (2|25|36): objs=603 size=2.25KiB /9/20S (2|25|36): objs=154 size=318B /9/21N (2|25|36): objs=297 size=769B /9/22S (2|25|36): objs=147 size=285B /9/23N (2|25|36): objs=757 size=2.77KiB /9/24S (2|25|36): objs=135 size=191B /9/25N (2|25|36): objs=1694 size=6.95KiB /9/26S (2|25|36): objs=169 size=336B /9/27N (2|25|36): objs=910 size=3.42KiB /9/28S (2|25|36): objs=142 size=161B /9/29N (2|25|36): objs=3810 size=19.44KiB /9/30S (2|25|36): objs=152 size=137B /9/31N (2|25|36): objs=751 size=3.15KiB /9/32S (2|25|36): objs=163 size=333B /9/33N (2|25|36): objs=3649 size=16.54KiB /9/34S (2|25|36): objs=137 size=110B /9/35N (2|25|36): objs=1074 size=4.1KiB /10/0N (2|25|36): objs=40273 size=864.99KiB /10/1N (2|25|36): objs=42077 size=1.01MiB /10/2N (2|25|36): objs=31317 size=528.33KiB /10/3S (2|25|36): objs=157 size=151B /10/4S (2|25|36): objs=146 size=198B /10/5S (2|25|36): objs=128 size=198B /10/6N (2|25|36): objs=272 size=987B /10/7S (2|25|36): objs=144 size=289B /10/8N (2|25|36): objs=5126 size=25.29KiB /10/9N (2|25|36): objs=1082 size=4.2KiB /10/10S (2|25|36): objs=150 size=247B /10/11N (2|25|36): objs=1972 size=8.48KiB /10/12S (2|25|36): objs=144 size=187B /10/13N (2|25|36): objs=2573 size=11.21KiB /10/14S (2|25|36): objs=134 size=265B /10/15N (2|25|36): objs=4353 size=19.48KiB /10/16S (2|25|36): objs=145 size=237B /10/17N (2|25|36): objs=4800 size=20.89KiB /10/18S (2|25|36): objs=161 size=159B /10/20S (2|25|36): objs=144 size=131B /10/21N (2|25|36): objs=2907 size=12.56KiB /10/22S (2|25|36): objs=142 size=155B /10/23N (2|25|36): objs=1497 size=5.84KiB /10/24S (2|25|36): objs=126 size=270B /10/25N (2|25|36): objs=339 size=1KiB /10/26S (2|25|36): objs=150 size=138B /10/27N (2|25|36): objs=1808 size=7.64KiB /10/28S (2|25|36): objs=163 size=239B /10/29N (2|25|36): objs=296 size=733B /10/30S (2|25|36): objs=154 size=195B /10/31N (2|25|36): objs=5948 size=29.52KiB /10/32S (2|25|36): objs=152 size=222B /10/33N (2|25|36): objs=3845 size=17.02KiB /10/34S (2|25|36): objs=152 size=90B /10/35N (2|25|36): objs=1466 size=5.9KiB /11/0N (2|25|36): objs=38519 size=896.42KiB /11/1N (2|25|36): objs=41684 size=1010.01KiB /11/2N (2|25|36): objs=40129 size=828.56KiB /11/3S (2|25|36): objs=151 size=289B /11/4N (2|25|36): objs=1101 size=4.24KiB /11/5S (2|25|36): objs=152 size=96B /11/6S (2|25|36): objs=148 size=311B /11/7S (2|25|36): objs=154 size=144B /11/8S (2|25|36): objs=170 size=124B /11/10S (2|25|36): objs=177 size=320B /11/11N (2|25|36): objs=646 size=2.19KiB /11/12S (2|25|36): objs=143 size=112B /11/13N (2|25|36): objs=1975 size=8.11KiB /11/14S (2|25|36): objs=134 size=286B /11/16S (2|25|36): objs=131 size=100B /11/17S (2|25|36): objs=158 size=211B /11/18S (2|25|36): objs=157 size=139B /11/19N (2|25|36): objs=311 size=802B /11/20S (2|25|36): objs=126 size=244B /11/21N (2|25|36): objs=4168 size=18.43KiB /11/22S (2|25|36): objs=159 size=266B /11/23N (2|25|36): objs=8112 size=38.61KiB /11/24S (2|25|36): objs=154 size=309B /11/25N (2|25|36): objs=1046 size=4.05KiB /11/26S (2|25|36): objs=154 size=330B /11/27N (2|25|36): objs=4952 size=23.61KiB /11/28S (2|25|36): objs=145 size=262B /11/29N (2|25|36): objs=775 size=2.91KiB /11/30S (2|25|36): objs=145 size=192B /11/31N (2|25|36): objs=1831 size=7.72KiB /11/32S (2|25|36): objs=158 size=349B /11/33N (2|25|36): objs=2044 size=8.92KiB /11/34S (2|25|36): objs=145 size=126B /11/35N (2|25|36): objs=9242 size=49.48KiB /12/0N (2|25|36): objs=41927 size=1021.35KiB /12/1N (2|25|36): objs=37260 size=750.13KiB /12/2N (2|25|36): objs=39780 size=969.2KiB /12/3S (2|25|36): objs=175 size=270B /12/4N (2|25|36): objs=617 size=2.27KiB /12/5N (2|25|36): objs=7042 size=32.16KiB /12/6S (2|25|36): objs=146 size=291B /12/7N (2|25|36): objs=3937 size=19.36KiB /12/8S (2|25|36): objs=154 size=312B /12/9N (2|25|36): objs=2994 size=12.86KiB /12/10S (2|25|36): objs=146 size=98B /12/11N (2|25|36): objs=1514 size=6.41KiB /12/12S (2|25|36): objs=164 size=151B /12/13N (2|25|36): objs=1997 size=8.04KiB /12/14S (2|25|36): objs=163 size=328B /12/15N (2|25|36): objs=928 size=3.58KiB /12/16S (2|25|36): objs=176 size=222B /12/17N (2|25|36): objs=305 size=816B /12/18S (2|25|36): objs=146 size=324B /12/19N (2|25|36): objs=266 size=818B /12/20S (2|25|36): objs=152 size=136B /12/21N (2|25|36): objs=3116 size=13.48KiB /12/22S (2|25|36): objs=141 size=257B /12/23N (2|25|36): objs=1083 size=4.26KiB /12/24S (2|25|36): objs=161 size=246B /12/25N (2|25|36): objs=3764 size=17.4KiB /12/26S (2|25|36): objs=155 size=254B /12/27N (2|25|36): objs=2255 size=10.71KiB /12/28S (2|25|36): objs=139 size=146B /12/29N (2|25|36): objs=305 size=928B /12/30S (2|25|36): objs=148 size=219B /12/31N (2|25|36): objs=303 size=1KiB /12/32S (2|25|36): objs=150 size=298B /12/33N (2|25|36): objs=606 size=2.34KiB /12/34S (2|25|36): objs=160 size=322B /12/35N (2|25|36): objs=4733 size=20.99KiB /13/0N (2|25|36): objs=43645 size=1022.21KiB /13/1N (2|25|36): objs=40188 size=999.23KiB /13/2N (2|25|36): objs=39394 size=896.82KiB /13/3N (2|25|36): objs=5558 size=25.37KiB /13/4S (2|25|36): objs=152 size=335B /13/5N (2|25|36): objs=2099 size=8.7KiB /13/6S (2|25|36): objs=171 size=101B /13/7N (2|25|36): objs=581 size=2.18KiB /13/8S (2|25|36): objs=154 size=313B /13/9N (2|25|36): objs=3203 size=14.69KiB /13/10S (2|25|36): objs=152 size=173B /13/11N (2|25|36): objs=1013 size=4.07KiB /13/12S (2|25|36): objs=135 size=113B /13/13N (2|25|36): objs=5646 size=27.7KiB /13/14S (2|25|36): objs=156 size=341B /13/15N (2|25|36): objs=2627 size=11.01KiB /13/16S (2|25|36): objs=146 size=276B /13/17N (2|25|36): objs=4362 size=20.42KiB /13/18S (2|25|36): objs=156 size=241B /13/19S (2|25|36): objs=141 size=129B /13/20S (2|25|36): objs=166 size=189B /13/21N (2|25|36): objs=2500 size=10.26KiB /13/22S (2|25|36): objs=178 size=225B /13/23N (2|25|36): objs=917 size=3.5KiB /13/24S (2|25|36): objs=170 size=293B /13/25S (2|25|36): objs=148 size=231B /13/26S (2|25|36): objs=152 size=254B /13/27N (2|25|36): objs=902 size=3.41KiB /13/28S (2|25|36): objs=148 size=250B /13/29N (2|25|36): objs=615 size=2.31KiB /13/30S (2|25|36): objs=164 size=200B /13/32S (2|25|36): objs=199 size=300B /13/33N (2|25|36): objs=1292 size=5.13KiB /13/34S (2|25|36): objs=135 size=304B /13/35N (2|25|36): objs=5223 size=24.67KiB /14/0N (2|25|36): objs=41030 size=1012.18KiB /14/1N (2|25|36): objs=37603 size=821.72KiB /14/2N (2|25|36): objs=37580 size=762.37KiB /14/3N (2|25|36): objs=793 size=2.87KiB /14/4S (2|25|36): objs=147 size=219B /14/5N (2|25|36): objs=3489 size=15.56KiB /14/6S (2|25|36): objs=177 size=332B /14/7N (2|25|36): objs=4475 size=19.92KiB /14/8S (2|25|36): objs=173 size=214B /14/9N (2|25|36): objs=1825 size=7.33KiB /14/10S (2|25|36): objs=133 size=308B /14/11N (2|25|36): objs=3029 size=13.34KiB /14/12S (2|25|36): objs=150 size=340B /14/13N (2|25|36): objs=2312 size=9.7KiB /14/14S (2|25|36): objs=144 size=253B /14/15N (2|25|36): objs=2061 size=8.83KiB /14/16S (2|25|36): objs=160 size=139B /14/17N (2|25|36): objs=2361 size=10.53KiB /14/18S (2|25|36): objs=171 size=155B /14/19N (2|25|36): objs=1811 size=7.74KiB /14/20S (2|25|36): objs=180 size=247B /14/21N (2|25|36): objs=1325 size=5.27KiB /14/22S (2|25|36): objs=148 size=266B /14/23N (2|25|36): objs=312 size=943B /14/24S (2|25|36): objs=137 size=203B /14/25N (2|25|36): objs=1662 size=7KiB /14/26S (2|25|36): objs=149 size=103B /14/27N (2|25|36): objs=2916 size=13.28KiB /14/28S (2|25|36): objs=138 size=319B /14/29N (2|25|36): objs=468 size=1.65KiB /14/30S (2|25|36): objs=150 size=168B /14/31N (2|25|36): objs=7871 size=38.87KiB /14/32S (2|25|36): objs=163 size=346B /14/33N (2|25|36): objs=460 size=1.63KiB /14/34S (2|25|36): objs=164 size=212B /14/35N (2|25|36): objs=1395 size=5.66KiB /15/0N (2|25|36): objs=40429 size=842.24KiB /15/1N (2|25|36): objs=38626 size=859.42KiB /15/2N (2|25|36): objs=35835 size=649.62KiB /15/3N (2|25|36): objs=920 size=3.46KiB /15/4S (2|25|36): objs=142 size=306B /15/5S (2|25|36): objs=178 size=130B /15/6S (2|25|36): objs=149 size=283B /15/8S (2|25|36): objs=131 size=104B /15/9N (2|25|36): objs=761 size=2.98KiB /15/10S (2|25|36): objs=164 size=242B /15/11N (2|25|36): objs=2290 size=9.76KiB /15/12S (2|25|36): objs=143 size=120B /15/13N (2|25|36): objs=889 size=3.42KiB /15/14S (2|25|36): objs=165 size=148B /15/15N (2|25|36): objs=1405 size=5.53KiB /15/16S (2|25|36): objs=145 size=322B /15/17N (2|25|36): objs=1272 size=5.13KiB /15/18S (2|25|36): objs=148 size=116B /15/19N (2|25|36): objs=2874 size=12.32KiB /15/20S (2|25|36): objs=150 size=232B /15/21N (2|25|36): objs=3515 size=15.47KiB /15/22S (2|25|36): objs=143 size=110B /15/23S (2|25|36): objs=157 size=327B /15/24S (2|25|36): objs=166 size=341B /15/25N (2|25|36): objs=7681 size=35.87KiB /15/26S (2|25|36): objs=155 size=332B /15/27N (2|25|36): objs=4459 size=19.5KiB /15/28S (2|25|36): objs=157 size=292B /15/29N (2|25|36): objs=1662 size=6.6KiB /15/30S (2|25|36): objs=141 size=94B /15/31N (2|25|36): objs=1812 size=7.25KiB /15/32S (2|25|36): objs=140 size=269B /15/33N (2|25|36): objs=2627 size=10.9KiB /15/34S (2|25|36): objs=166 size=147B /15/35N (2|25|36): objs=4659 size=21.71KiB /16/0N (2|25|36): objs=33615 size=624.04KiB /16/1S (2|25|36): objs=166 size=168B /16/2N (2|25|36): objs=6934 size=30.37KiB /16/3N (2|25|36): objs=37357 size=744.9KiB /16/4N (2|25|36): objs=38242 size=927.79KiB /16/5S (2|25|36): objs=161 size=239B /16/6N (2|25|36): objs=3773 size=16.29KiB /16/7N (2|25|36): objs=1428 size=5.83KiB /16/8S (2|25|36): objs=163 size=230B /16/9N (2|25|36): objs=6718 size=29.91KiB /16/10S (2|25|36): objs=160 size=159B /16/11N (2|25|36): objs=4356 size=20.73KiB /16/12S (2|25|36): objs=147 size=167B /16/13N (2|25|36): objs=803 size=3.08KiB /16/14S (2|25|36): objs=154 size=315B /16/15N (2|25|36): objs=627 size=2.28KiB /16/16S (2|25|36): objs=149 size=231B /16/17N (2|25|36): objs=2645 size=12KiB /16/18S (2|25|36): objs=149 size=322B /16/19N (2|25|36): objs=7051 size=39.42KiB /16/20S (2|25|36): objs=141 size=122B /16/21N (2|25|36): objs=286 size=958B /16/22S (2|25|36): objs=175 size=263B /16/23S (2|25|36): objs=163 size=93B /16/24S (2|25|36): objs=172 size=252B /16/25N (2|25|36): objs=1388 size=5.63KiB /16/26S (2|25|36): objs=159 size=289B /16/27N (2|25|36): objs=1214 size=4.84KiB /16/28S (2|25|36): objs=152 size=230B /16/29N (2|25|36): objs=2921 size=12.79KiB /16/30S (2|25|36): objs=150 size=103B /16/31N (2|25|36): objs=1811 size=7.78KiB /16/32S (2|25|36): objs=166 size=99B /16/33N (2|25|36): objs=1759 size=7.56KiB /16/34S (2|25|36): objs=152 size=106B /16/35N (2|25|36): objs=1119 size=4.37KiB /17/0N (2|25|36): objs=36615 size=764.19KiB /17/1N (2|25|36): objs=10520 size=80.83KiB /17/2S (2|25|36): objs=155 size=329B /17/3N (2|25|36): objs=27217 size=483.62KiB /17/4N (2|25|36): objs=39642 size=842.41KiB /17/5N (2|25|36): objs=12623 size=70.02KiB /17/6S (2|25|36): objs=158 size=343B /17/7N (2|25|36): objs=930 size=3.52KiB /17/8S (2|25|36): objs=174 size=325B /17/9N (2|25|36): objs=1073 size=4.2KiB /17/10S (2|25|36): objs=177 size=237B /17/11N (2|25|36): objs=477 size=1.63KiB /17/12S (2|25|36): objs=173 size=342B /17/13N (2|25|36): objs=1357 size=5.55KiB /17/14S (2|25|36): objs=182 size=307B /17/15N (2|25|36): objs=288 size=1010B /17/16S (2|25|36): objs=151 size=221B /17/18S (2|25|36): objs=135 size=246B /17/19N (2|25|36): objs=2058 size=8.4KiB /17/20S (2|25|36): objs=132 size=285B /17/21N (2|25|36): objs=1514 size=6.15KiB /17/22S (2|25|36): objs=167 size=173B /17/23N (2|25|36): objs=3969 size=18.21KiB /17/24S (2|25|36): objs=148 size=252B /17/26S (2|25|36): objs=153 size=258B /17/27N (2|25|36): objs=2412 size=10.18KiB /17/28S (2|25|36): objs=160 size=121B /17/29S (2|25|36): objs=163 size=188B /17/30S (2|25|36): objs=166 size=134B /17/31N (2|25|36): objs=5162 size=30.09KiB /17/32S (2|25|36): objs=157 size=181B /17/33N (2|25|36): objs=1271 size=4.76KiB /17/34S (2|25|36): objs=171 size=101B /17/35N (2|25|36): objs=6871 size=34.73KiB /18/0N (2|25|36): objs=35491 size=745.92KiB /18/1N (2|25|36): objs=47513 size=1.23MiB /18/2N (2|25|36): objs=35737 size=691.82KiB /18/3N (2|25|36): objs=3806 size=17.61KiB /18/4S (2|25|36): objs=154 size=260B /18/5N (2|25|36): objs=2440 size=10.71KiB /18/6S (2|25|36): objs=176 size=277B /18/7S (2|25|36): objs=143 size=128B /18/8S (2|25|36): objs=153 size=202B /18/9N (2|25|36): objs=714 size=2.96KiB /18/10S (2|25|36): objs=131 size=260B /18/11N (2|25|36): objs=9045 size=45.45KiB /18/12S (2|25|36): objs=158 size=259B /18/13N (2|25|36): objs=614 size=2.16KiB /18/14S (2|25|36): objs=143 size=163B /18/15N (2|25|36): objs=4435 size=20.81KiB /18/16S (2|25|36): objs=150 size=242B /18/17N (2|25|36): objs=1856 size=7.77KiB /18/18S (2|25|36): objs=152 size=104B /18/19N (2|25|36): objs=446 size=1.41KiB /18/20S (2|25|36): objs=140 size=255B /18/21N (2|25|36): objs=297 size=980B /18/22S (2|25|36): objs=143 size=221B /18/23N (2|25|36): objs=5898 size=31.02KiB /18/24S (2|25|36): objs=160 size=141B /18/26S (2|25|36): objs=159 size=255B /18/27N (2|25|36): objs=466 size=1.47KiB /18/28S (2|25|36): objs=173 size=278B /18/30S (2|25|36): objs=165 size=359B /18/31N (2|25|36): objs=1853 size=7.92KiB /18/32S (2|25|36): objs=131 size=238B /18/33N (2|25|36): objs=1088 size=4.4KiB /18/34S (2|25|36): objs=159 size=343B /18/35N (2|25|36): objs=1408 size=5.86KiB /19/0N (2|25|36): objs=41459 size=943.34KiB /19/1N (2|25|36): objs=38935 size=786.05KiB /19/2N (2|25|36): objs=23810 size=301.96KiB /19/3S (2|25|36): objs=187 size=278B /19/4N (2|25|36): objs=11005 size=61.22KiB /19/5S (2|25|36): objs=156 size=101B /19/6N (2|25|36): objs=1058 size=4.21KiB /19/7N (2|25|36): objs=1229 size=4.97KiB /19/8S (2|25|36): objs=163 size=271B /19/9N (2|25|36): objs=1313 size=5.14KiB /19/10S (2|25|36): objs=152 size=139B /19/11N (2|25|36): objs=1196 size=4.69KiB /19/12S (2|25|36): objs=142 size=124B /19/13S (2|25|36): objs=146 size=202B /19/14S (2|25|36): objs=128 size=303B /19/15N (2|25|36): objs=1829 size=7.57KiB /19/16S (2|25|36): objs=128 size=177B /19/17N (2|25|36): objs=1091 size=4.14KiB /19/18S (2|25|36): objs=147 size=151B /19/19N (2|25|36): objs=749 size=2.82KiB /19/20S (2|25|36): objs=153 size=250B /19/21N (2|25|36): objs=1874 size=7.73KiB /19/22S (2|25|36): objs=165 size=100B /19/23N (2|25|36): objs=1091 size=4.51KiB /19/24S (2|25|36): objs=168 size=97B /19/25N (2|25|36): objs=403 size=1.48KiB /19/26S (2|25|36): objs=156 size=105B /19/27N (2|25|36): objs=8954 size=42.77KiB /19/28S (2|25|36): objs=178 size=282B /19/29N (2|25|36): objs=1036 size=4.03KiB /19/30S (2|25|36): objs=148 size=225B /19/31N (2|25|36): objs=14339 size=125.59KiB /19/32S (2|25|36): objs=148 size=97B /19/33N (2|25|36): objs=1790 size=7.43KiB /19/34S (2|25|36): objs=157 size=262B /19/35N (2|25|36): objs=2451 size=10.73KiB /20/0N (2|25|36): objs=36715 size=716.32KiB /20/1N (2|25|36): objs=34558 size=689.09KiB /20/2N (2|25|36): objs=41189 size=932.5KiB /20/3N (2|25|36): objs=12131 size=64.72KiB /20/4S (2|25|36): objs=178 size=258B /20/6S (2|25|36): objs=153 size=201B /20/7N (2|25|36): objs=1499 size=6.53KiB /20/8S (2|25|36): objs=163 size=350B /20/9N (2|25|36): objs=1843 size=7.48KiB /20/10S (2|25|36): objs=160 size=348B /20/11N (2|25|36): objs=753 size=2.98KiB /20/12S (2|25|36): objs=149 size=173B /20/13N (2|25|36): objs=574 size=2.2KiB /20/14S (2|25|36): objs=144 size=133B /20/16S (2|25|36): objs=177 size=111B /20/17N (2|25|36): objs=2075 size=8.61KiB /20/18S (2|25|36): objs=168 size=274B /20/19N (2|25|36): objs=5063 size=25.19KiB /20/20S (2|25|36): objs=148 size=215B /20/21N (2|25|36): objs=2312 size=9.86KiB /20/22S (2|25|36): objs=163 size=110B /20/23N (2|25|36): objs=3914 size=17.34KiB /20/24S (2|25|36): objs=145 size=281B /20/25S (2|25|36): objs=142 size=122B /20/26S (2|25|36): objs=143 size=85B /20/27N (2|25|36): objs=592 size=2.13KiB /20/28S (2|25|36): objs=155 size=140B /20/29N (2|25|36): objs=1555 size=6.44KiB /20/30S (2|25|36): objs=171 size=200B /20/32S (2|25|36): objs=142 size=235B /20/33S (2|25|36): objs=164 size=237B /20/34S (2|25|36): objs=144 size=178B /20/35S (2|25|36): objs=170 size=184B /21/0N (2|25|36): objs=35743 size=818.02KiB /21/1N (2|25|36): objs=38333 size=855.3KiB /21/2N (2|25|36): objs=35925 size=643.5KiB /21/3S (2|25|36): objs=156 size=290B /21/4N (2|25|36): objs=2296 size=9.96KiB /21/5S (2|25|36): objs=166 size=298B /21/6N (2|25|36): objs=954 size=3.72KiB /21/7N (2|25|36): objs=2699 size=11.51KiB /21/8S (2|25|36): objs=150 size=183B /21/9N (2|25|36): objs=1533 size=6.23KiB /21/10S (2|25|36): objs=145 size=88B /21/11N (2|25|36): objs=264 size=868B /21/12S (2|25|36): objs=170 size=352B /21/13N (2|25|36): objs=1578 size=6.47KiB /21/14S (2|25|36): objs=141 size=293B /21/15N (2|25|36): objs=3644 size=16.05KiB /21/16S (2|25|36): objs=147 size=237B /21/17N (2|25|36): objs=3996 size=17.99KiB /21/18S (2|25|36): objs=160 size=319B /21/19N (2|25|36): objs=1780 size=7.04KiB /21/20S (2|25|36): objs=196 size=371B /21/21N (2|25|36): objs=747 size=2.69KiB /21/22S (2|25|36): objs=165 size=308B /21/23N (2|25|36): objs=2681 size=12.36KiB /21/24S (2|25|36): objs=167 size=132B /21/25N (2|25|36): objs=746 size=2.75KiB /21/26S (2|25|36): objs=162 size=148B /21/27N (2|25|36): objs=473 size=1.63KiB /21/28S (2|25|36): objs=154 size=107B /21/29N (2|25|36): objs=474 size=1.46KiB /21/30S (2|25|36): objs=145 size=280B /21/31N (2|25|36): objs=7025 size=36.52KiB /21/32S (2|25|36): objs=162 size=192B /21/33N (2|25|36): objs=339 size=1010B /21/34S (2|25|36): objs=155 size=249B /21/35N (2|25|36): objs=5447 size=26.71KiB /22/0N (1|26|34): objs=67950 size=2.39MiB /22/1N (1|26|34): objs=38761 size=750.27KiB /22/2S (1|26|34): objs=140 size=142B /22/3N (1|26|34): objs=346 size=896B /22/4S (1|26|34): objs=162 size=268B /22/5N (1|26|34): objs=780 size=3.07KiB /22/6S (1|26|34): objs=149 size=279B /22/7N (1|26|34): objs=4657 size=21.6KiB /22/8S (1|26|34): objs=171 size=156B /22/9N (1|26|34): objs=3067 size=12.95KiB /22/10S (1|26|34): objs=147 size=282B /22/11N (1|26|34): objs=2611 size=10.96KiB /22/12S (1|26|34): objs=151 size=129B /22/13N (1|26|34): objs=1785 size=7.56KiB /22/14S (1|26|34): objs=145 size=186B /22/15N (1|26|34): objs=300 size=1KiB /22/16S (1|26|34): objs=152 size=124B /22/17N (1|26|34): objs=597 size=2.12KiB /22/18S (1|26|34): objs=158 size=220B /22/19N (1|26|34): objs=330 size=817B /22/20S (1|26|34): objs=159 size=233B /22/21N (1|26|34): objs=3619 size=16.08KiB /22/22S (1|26|34): objs=169 size=343B /22/23N (1|26|34): objs=1697 size=6.92KiB /22/24S (1|26|34): objs=140 size=291B /22/25N (1|26|34): objs=3463 size=15.71KiB /22/26S (1|26|34): objs=159 size=97B /22/27N (1|26|34): objs=2008 size=8.49KiB /22/28S (1|26|34): objs=143 size=318B /22/30S (1|26|34): objs=155 size=103B /22/31N (1|26|34): objs=7476 size=38.67KiB /22/32S (1|26|34): objs=147 size=209B /22/33N (1|26|34): objs=442 size=1.44KiB /23/0N (2|25|36): objs=40619 size=920.54KiB /23/1N (2|25|36): objs=41832 size=921.17KiB /23/2N (2|25|36): objs=30422 size=550.17KiB /23/3S (2|25|36): objs=140 size=260B /23/4N (2|25|36): objs=1502 size=6.28KiB /23/5S (2|25|36): objs=145 size=146B /23/6N (2|25|36): objs=613 size=2.1KiB /23/7S (2|25|36): objs=162 size=175B /23/8N (2|25|36): objs=574 size=2.03KiB /23/9S (2|25|36): objs=172 size=158B /23/10N (2|25|36): objs=1375 size=5.64KiB /23/11S (2|25|36): objs=148 size=160B /23/12N (2|25|36): objs=327 size=817B /23/13N (2|25|36): objs=4611 size=20.06KiB /23/14S (2|25|36): objs=156 size=247B /23/15N (2|25|36): objs=3064 size=13.1KiB /23/16S (2|25|36): objs=151 size=138B /23/17N (2|25|36): objs=2250 size=9.44KiB /23/18S (2|25|36): objs=154 size=163B /23/19N (2|25|36): objs=2118 size=8.96KiB /23/20S (2|25|36): objs=138 size=236B /23/21N (2|25|36): objs=773 size=2.9KiB /23/22S (2|25|36): objs=167 size=94B /23/23N (2|25|36): objs=2230 size=9.18KiB /23/24S (2|25|36): objs=162 size=285B /23/25N (2|25|36): objs=2489 size=10.57KiB /23/26S (2|25|36): objs=134 size=239B /23/27N (2|25|36): objs=3826 size=18.41KiB /23/28S (2|25|36): objs=147 size=138B /23/29N (2|25|36): objs=9020 size=51.54KiB /23/30S (2|25|36): objs=148 size=142B /23/31N (2|25|36): objs=1536 size=6.42KiB /23/32S (2|25|36): objs=152 size=188B /23/33N (2|25|36): objs=3924 size=19.59KiB /23/34S (2|25|36): objs=137 size=173B /24/0N (2|25|36): objs=34751 size=697.52KiB /24/1N (2|25|36): objs=40660 size=1.09MiB /24/2N (2|25|36): objs=9135 size=51.29KiB /24/3S (2|25|36): objs=160 size=344B /24/4N (2|25|36): objs=23813 size=329.2KiB /24/5N (2|25|36): objs=6884 size=29.89KiB /24/6S (2|25|36): objs=173 size=126B /24/7N (2|25|36): objs=4178 size=18.65KiB /24/8S (2|25|36): objs=158 size=143B /24/9N (2|25|36): objs=2869 size=12.94KiB /24/10S (2|25|36): objs=142 size=274B /24/11N (2|25|36): objs=1238 size=4.88KiB /24/12S (2|25|36): objs=147 size=89B /24/13N (2|25|36): objs=1190 size=4.72KiB /24/14S (2|25|36): objs=155 size=272B /24/15N (2|25|36): objs=887 size=3.35KiB /24/16S (2|25|36): objs=152 size=142B /24/17N (2|25|36): objs=472 size=1.52KiB /24/18S (2|25|36): objs=151 size=160B /24/19N (2|25|36): objs=909 size=3.39KiB /24/20S (2|25|36): objs=151 size=154B /24/21N (2|25|36): objs=1084 size=4.17KiB /24/22S (2|25|36): objs=174 size=95B /24/23N (2|25|36): objs=922 size=3.72KiB /24/24S (2|25|36): objs=141 size=142B /24/25N (2|25|36): objs=2547 size=11.81KiB /24/26S (2|25|36): objs=161 size=219B /24/27N (2|25|36): objs=6203 size=29.85KiB /24/28S (2|25|36): objs=149 size=194B /24/29N (2|25|36): objs=988 size=3.87KiB /24/30S (2|25|36): objs=159 size=344B /24/31N (2|25|36): objs=902 size=3.49KiB /24/32S (2|25|36): objs=143 size=316B /24/33N (2|25|36): objs=4834 size=21.98KiB /24/34S (2|25|36): objs=167 size=215B /24/35N (2|25|36): objs=1828 size=7.86KiB /25/0N (2|25|36): objs=38353 size=913.27KiB /25/1N (2|25|36): objs=37016 size=741.63KiB /25/2N (2|25|36): objs=38084 size=809.62KiB /25/3N (2|25|36): objs=4761 size=22.76KiB /25/4S (2|25|36): objs=134 size=232B /25/5S (2|25|36): objs=140 size=237B /25/6S (2|25|36): objs=143 size=115B /25/7S (2|25|36): objs=151 size=338B /25/8S (2|25|36): objs=124 size=105B /25/9N (2|25|36): objs=750 size=2.98KiB /25/10S (2|25|36): objs=142 size=307B /25/11N (2|25|36): objs=2271 size=9.29KiB /25/12S (2|25|36): objs=178 size=259B /25/13N (2|25|36): objs=2807 size=11.77KiB /25/14S (2|25|36): objs=143 size=145B /25/15N (2|25|36): objs=5379 size=26.47KiB /25/16S (2|25|36): objs=136 size=226B /25/17N (2|25|36): objs=4122 size=18.9KiB /25/18S (2|25|36): objs=158 size=91B /25/19S (2|25|36): objs=146 size=111B /25/20S (2|25|36): objs=176 size=295B /25/21N (2|25|36): objs=6225 size=32KiB /25/22S (2|25|36): objs=151 size=100B /25/23N (2|25|36): objs=1145 size=4.7KiB /25/24S (2|25|36): objs=157 size=242B /25/25N (2|25|36): objs=2681 size=12.12KiB /25/26S (2|25|36): objs=158 size=190B /25/27S (2|25|36): objs=147 size=239B /25/28S (2|25|36): objs=141 size=165B /25/29N (2|25|36): objs=3419 size=14.91KiB /25/30S (2|25|36): objs=145 size=244B /25/31N (2|25|36): objs=924 size=3.77KiB /25/32S (2|25|36): objs=159 size=346B /25/33N (2|25|36): objs=3796 size=17.43KiB /25/34S (2|25|36): objs=166 size=287B /25/35N (2|25|36): objs=428 size=1.45KiB /26/0N (2|25|36): objs=40540 size=861.33KiB /26/1N (2|25|36): objs=38641 size=972.64KiB /26/2N (2|25|36): objs=38659 size=908.9KiB /26/3N (2|25|36): objs=9953 size=52.27KiB /26/4S (2|25|36): objs=153 size=271B /26/5N (2|25|36): objs=612 size=2.12KiB /26/6S (2|25|36): objs=174 size=293B /26/7S (2|25|36): objs=161 size=154B /26/8S (2|25|36): objs=160 size=149B /26/9S (2|25|36): objs=161 size=149B /26/10S (2|25|36): objs=158 size=321B /26/11N (2|25|36): objs=2613 size=10.92KiB /26/12S (2|25|36): objs=151 size=103B /26/13N (2|25|36): objs=3222 size=13.92KiB /26/14S (2|25|36): objs=160 size=204B /26/16S (2|25|36): objs=149 size=166B /26/17N (2|25|36): objs=1493 size=6.37KiB /26/18S (2|25|36): objs=142 size=260B /26/20S (2|25|36): objs=156 size=237B /26/21N (2|25|36): objs=6354 size=29.4KiB /26/22S (2|25|36): objs=157 size=333B /26/23N (2|25|36): objs=774 size=3.11KiB /26/24S (2|25|36): objs=160 size=201B /26/25N (2|25|36): objs=3542 size=15.85KiB /26/26S (2|25|36): objs=169 size=267B /26/27N (2|25|36): objs=4645 size=20.15KiB /26/28S (2|25|36): objs=165 size=348B /26/29N (2|25|36): objs=1241 size=5.07KiB /26/30S (2|25|36): objs=133 size=244B /26/31N (2|25|36): objs=1536 size=6.29KiB /26/32S (2|25|36): objs=140 size=309B /26/33N (2|25|36): objs=1637 size=6.89KiB /26/34S (2|25|36): objs=172 size=117B /26/35N (2|25|36): objs=311 size=995B /27/0N (2|25|36): objs=42887 size=1MiB /27/1N (2|25|36): objs=38913 size=836.42KiB /27/2N (2|25|36): objs=38162 size=874.97KiB /27/3N (2|25|36): objs=6315 size=31.61KiB /27/4S (2|25|36): objs=147 size=299B /27/5N (2|25|36): objs=1833 size=7.55KiB /27/6S (2|25|36): objs=134 size=251B /27/7N (2|25|36): objs=1947 size=7.92KiB /27/8S (2|25|36): objs=161 size=208B /27/9N (2|25|36): objs=4911 size=23.99KiB /27/10S (2|25|36): objs=151 size=294B /27/11N (2|25|36): objs=4451 size=20.57KiB /27/12S (2|25|36): objs=141 size=101B /27/13N (2|25|36): objs=913 size=3.69KiB /27/14S (2|25|36): objs=149 size=108B /27/15S (2|25|36): objs=154 size=318B /27/16S (2|25|36): objs=143 size=128B /27/17N (2|25|36): objs=3013 size=13.58KiB /27/18S (2|25|36): objs=181 size=90B /27/19N (2|25|36): objs=459 size=1.58KiB /27/20S (2|25|36): objs=139 size=300B /27/21N (2|25|36): objs=1704 size=6.86KiB /27/22S (2|25|36): objs=145 size=334B /27/23N (2|25|36): objs=2414 size=10.46KiB /27/24S (2|25|36): objs=176 size=111B /27/25N (2|25|36): objs=1329 size=5.42KiB /27/26S (2|25|36): objs=147 size=102B /27/27N (2|25|36): objs=2747 size=11.57KiB /27/28S (2|25|36): objs=192 size=276B /27/29N (2|25|36): objs=877 size=3.53KiB /27/30S (2|25|36): objs=171 size=132B /27/31N (2|25|36): objs=2342 size=11.13KiB /27/32S (2|25|36): objs=169 size=341B /27/33N (2|25|36): objs=2745 size=11.55KiB /27/34S (2|25|36): objs=151 size=287B /27/35N (2|25|36): objs=2165 size=9.17KiB /28/0N (2|25|36): objs=38812 size=927.08KiB /28/1N (2|25|36): objs=39361 size=849.9KiB /28/2N (2|25|36): objs=41361 size=956.06KiB /28/3N (2|25|36): objs=5847 size=25.43KiB /28/4S (2|25|36): objs=145 size=248B /28/5S (2|25|36): objs=124 size=252B /28/6S (2|25|36): objs=149 size=265B /28/7N (2|25|36): objs=1806 size=7.51KiB /28/8S (2|25|36): objs=144 size=180B /28/9N (2|25|36): objs=422 size=1.53KiB /28/10S (2|25|36): objs=137 size=174B /28/11N (2|25|36): objs=2122 size=8.82KiB /28/12S (2|25|36): objs=149 size=326B /28/13N (2|25|36): objs=740 size=2.84KiB /28/14S (2|25|36): objs=149 size=262B /28/15N (2|25|36): objs=476 size=1.68KiB /28/16S (2|25|36): objs=161 size=292B /28/17N (2|25|36): objs=3746 size=16.84KiB /28/18S (2|25|36): objs=143 size=270B /28/19N (2|25|36): objs=3583 size=16.21KiB /28/20S (2|25|36): objs=141 size=164B /28/21N (2|25|36): objs=3013 size=13.72KiB /28/22S (2|25|36): objs=127 size=293B /28/23N (2|25|36): objs=795 size=2.89KiB /28/24S (2|25|36): objs=141 size=90B /28/25N (2|25|36): objs=2064 size=8.83KiB /28/26S (2|25|36): objs=170 size=339B /28/27N (2|25|36): objs=616 size=2.25KiB /28/28S (2|25|36): objs=155 size=316B /28/29N (2|25|36): objs=1488 size=6.02KiB /28/30S (2|25|36): objs=159 size=128B /28/31N (2|25|36): objs=3611 size=18.14KiB /28/32S (2|25|36): objs=165 size=213B /28/33N (2|25|36): objs=1049 size=4.27KiB /28/34S (2|25|36): objs=140 size=213B /28/35N (2|25|36): objs=7182 size=35.51KiB /29/0N (2|25|36): objs=39697 size=895.1KiB /29/1N (2|25|36): objs=35534 size=654.36KiB /29/2N (2|25|36): objs=42681 size=1.01MiB /29/3N (2|25|36): objs=6318 size=34.76KiB /29/4S (2|25|36): objs=148 size=269B /29/5N (2|25|36): objs=2688 size=12.87KiB /29/6S (2|25|36): objs=143 size=312B /29/7N (2|25|36): objs=1062 size=4.3KiB /29/8S (2|25|36): objs=168 size=347B /29/9N (2|25|36): objs=1953 size=8.01KiB /29/10S (2|25|36): objs=148 size=282B /29/11N (2|25|36): objs=1504 size=6.33KiB /29/12S (2|25|36): objs=150 size=317B /29/13N (2|25|36): objs=1516 size=6.12KiB /29/14S (2|25|36): objs=163 size=292B /29/15N (2|25|36): objs=905 size=3.47KiB /29/16S (2|25|36): objs=137 size=115B /29/17N (2|25|36): objs=3797 size=16.75KiB /29/18S (2|25|36): objs=162 size=199B /29/19N (2|25|36): objs=612 size=2.21KiB /29/20S (2|25|36): objs=186 size=297B /29/21N (2|25|36): objs=1685 size=6.98KiB /29/22S (2|25|36): objs=153 size=213B /29/23N (2|25|36): objs=446 size=1.64KiB /29/24S (2|25|36): objs=138 size=92B /29/25N (2|25|36): objs=3359 size=16.35KiB /29/26S (2|25|36): objs=153 size=107B /29/27N (2|25|36): objs=3846 size=16.51KiB /29/28S (2|25|36): objs=157 size=173B /29/29N (2|25|36): objs=1865 size=7.75KiB /29/30S (2|25|36): objs=162 size=93B /29/31N (2|25|36): objs=1360 size=5.51KiB /29/32S (2|25|36): objs=172 size=232B /29/33N (2|25|36): objs=5301 size=24.57KiB /29/34S (2|25|36): objs=167 size=146B /29/35N (2|25|36): objs=2436 size=10.49KiB /30/0N (2|25|36): objs=42958 size=1.05MiB /30/1N (2|25|36): objs=41939 size=1003.3KiB /30/2N (2|25|36): objs=3939 size=17.23KiB /30/3S (2|25|36): objs=156 size=86B /30/4N (2|25|36): objs=3842 size=17.06KiB /30/5S (2|25|36): objs=147 size=209B /30/6N (2|25|36): objs=31233 size=612.76KiB /30/7S (2|25|36): objs=160 size=252B /30/8S (2|25|36): objs=151 size=211B /30/9S (2|25|36): objs=153 size=180B /30/10N (2|25|36): objs=303 size=741B /30/11S (2|25|36): objs=143 size=316B /30/12N (2|25|36): objs=1222 size=5.14KiB /30/13S (2|25|36): objs=135 size=113B /30/14S (2|25|36): objs=143 size=185B /30/15N (2|25|36): objs=4849 size=21.08KiB /30/16S (2|25|36): objs=153 size=144B /30/17N (2|25|36): objs=2868 size=12.9KiB /30/18S (2|25|36): objs=159 size=304B /30/19S (2|25|36): objs=152 size=117B /30/20S (2|25|36): objs=160 size=106B /30/21N (2|25|36): objs=6975 size=33.25KiB /30/22S (2|25|36): objs=147 size=127B /30/23N (2|25|36): objs=9123 size=53.31KiB /30/24S (2|25|36): objs=161 size=221B /30/25N (2|25|36): objs=2450 size=10.55KiB /30/26S (2|25|36): objs=131 size=325B /30/27N (2|25|36): objs=7083 size=31.71KiB /30/28S (2|25|36): objs=141 size=261B /30/29N (2|25|36): objs=1652 size=6.81KiB /30/30S (2|25|36): objs=153 size=255B /30/31N (2|25|36): objs=1076 size=4.58KiB /30/32S (2|25|36): objs=162 size=87B /30/33S (2|25|36): objs=156 size=280B /30/34S (2|25|36): objs=161 size=165B /31/0N (2|25|36): objs=42194 size=1.02MiB /31/1N (2|25|36): objs=38519 size=949.86KiB /31/2N (2|25|36): objs=7190 size=39.19KiB /31/3S (2|25|36): objs=137 size=296B /31/4N (2|25|36): objs=29224 size=454.18KiB /31/5N (2|25|36): objs=4340 size=19.94KiB /31/6S (2|25|36): objs=160 size=158B /31/7N (2|25|36): objs=2239 size=9.9KiB /31/8S (2|25|36): objs=149 size=252B /31/9S (2|25|36): objs=149 size=310B /31/10S (2|25|36): objs=156 size=325B /31/11N (2|25|36): objs=1500 size=6.26KiB /31/12S (2|25|36): objs=188 size=327B /31/13N (2|25|36): objs=4702 size=20.35KiB /31/14S (2|25|36): objs=155 size=265B /31/16S (2|25|36): objs=153 size=108B /31/17N (2|25|36): objs=2924 size=12.94KiB /31/18S (2|25|36): objs=159 size=332B /31/19N (2|25|36): objs=3446 size=15.38KiB /31/20S (2|25|36): objs=166 size=328B /31/21S (2|25|36): objs=169 size=160B /31/22S (2|25|36): objs=143 size=126B /31/23N (2|25|36): objs=1428 size=5.86KiB /31/24S (2|25|36): objs=182 size=197B /31/25N (2|25|36): objs=306 size=892B /31/26S (2|25|36): objs=164 size=342B /31/27N (2|25|36): objs=3676 size=16.52KiB /31/28S (2|25|36): objs=146 size=270B /31/29N (2|25|36): objs=2183 size=9.22KiB /31/30S (2|25|36): objs=156 size=155B /31/32S (2|25|36): objs=147 size=318B /31/33N (2|25|36): objs=4158 size=17.98KiB /31/34S (2|25|36): objs=161 size=338B /31/35N (2|25|36): objs=5560 size=26.31KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 2.75us Addition to hash set (per operation): 8.28us Hash set removal (per operation): 4.92us a com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. Gradle Test Executor 1 finished executing tests. WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release 501 tests completed, 1 failed, 17 skipped Finished generating test XML results (3.82 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (5.451 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test FAILED :test (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 43 mins 9.049 secs. FAILURE: Build failed with an exception. * What went wrong: Execution failed for task ':test'. > There were failing tests. See the report at: file:///build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test/index.html * Try: Run with --debug option to get more log output. Run with --scan to get full insights. * Exception is: org.gradle.api.tasks.TaskExecutionException: Execution failed for task ':test'. at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.executeActions(ExecuteActionsTaskExecuter.java:100) at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.execute(ExecuteActionsTaskExecuter.java:70) at org.gradle.api.internal.tasks.execution.OutputDirectoryCreatingTaskExecuter.execute(OutputDirectoryCreatingTaskExecuter.java:51) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:62) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) Caused by: org.gradle.api.GradleException: There were failing tests. See the report at: file:///build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test/index.html at org.gradle.api.tasks.testing.AbstractTestTask.handleTestFailures(AbstractTestTask.java:547) at org.gradle.api.tasks.testing.AbstractTestTask.executeTests(AbstractTestTask.java:464) at org.gradle.api.tasks.testing.Test.executeTests(Test.java:530) at java.base/jdk.internal.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at java.base/jdk.internal.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:77) at java.base/jdk.internal.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) at org.gradle.internal.reflect.JavaMethod.invoke(JavaMethod.java:73) at org.gradle.api.internal.project.taskfactory.StandardTaskAction.doExecute(StandardTaskAction.java:46) at org.gradle.api.internal.project.taskfactory.StandardTaskAction.execute(StandardTaskAction.java:39) at org.gradle.api.internal.project.taskfactory.StandardTaskAction.execute(StandardTaskAction.java:26) at org.gradle.api.internal.AbstractTask$TaskActionWrapper.execute(AbstractTask.java:780) at org.gradle.api.internal.AbstractTask$TaskActionWrapper.execute(AbstractTask.java:747) at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter$1.run(ExecuteActionsTaskExecuter.java:121) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.executeAction(ExecuteActionsTaskExecuter.java:110) at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.executeActions(ExecuteActionsTaskExecuter.java:92) ... 29 more * Get more help at https://help.gradle.org BUILD FAILED in 48m 8s 5 actionable tasks: 3 executed, 2 up-to-date dh_auto_test: error: gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 test returned exit code 1 make: *** [debian/rules:6: binary] Error 25 dpkg-buildpackage: error: debian/rules binary subprocess returned exit status 2 I: copying local configuration E: Failed autobuilding of package I: user script /srv/workspace/pbuilder/28295/tmp/hooks/C01_cleanup starting debug output: disk usage on i-capture-the-hostname at Fri Feb 9 18:30:39 UTC 2024 Filesystem Size Used Avail Use% Mounted on tmpfs 1.9G 0 1.9G 0% /dev/shm I: user script /srv/workspace/pbuilder/28295/tmp/hooks/C01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/28295 and its subdirectories