I: pbuilder: network access will be disabled during build I: Current time: Wed Jun 12 19:49:35 +14 2024 I: pbuilder-time-stamp: 1718171375 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bookworm-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: using eatmydata during job I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Sat Dec 31 04:08:01 2022 +14 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/70124/tmp/hooks/D01_modify_environment starting debug: Running on ionos16-i386. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash '/bin/sh' -> '/bin/bash' lrwxrwxrwx 1 root root 9 Jun 12 19:49 /bin/sh -> /bin/bash I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/70124/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/70124/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="2" [2]="15" [3]="1" [4]="release" [5]="i686-pc-linux-gnu") BASH_VERSION='5.2.15(1)-release' BUILDDIR=/build BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=i386 DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=15' DIRSTACK=() DISTRIBUTION=bookworm EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=i686 HOST_ARCH=i386 IFS=' ' INVOCATION_ID=cde87efd34ee407395c33c48d9452851 LANG=C LANGUAGE=de_CH:de LC_ALL=C LD_LIBRARY_PATH=/usr/lib/libeatmydata LD_PRELOAD=libeatmydata.so MACHTYPE=i686-pc-linux-gnu MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnu PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=70124 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.kGPYLzJ6/pbuilderrc_qFr9 --distribution bookworm --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.kGPYLzJ6/b2 --logfile b2/build.log --extrapackages usrmerge milib_2.2.0+dfsg-1.dsc' SUDO_GID=112 SUDO_UID=107 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' http_proxy=http://85.184.249.68:3128 I: uname -a Linux i-capture-the-hostname 5.10.0-22-amd64 #1 SMP Debian 5.10.178-3 (2023-04-22) x86_64 GNU/Linux I: ls -l /bin total 6036 -rwxr-xr-x 1 root root 1408088 Apr 24 2023 bash -rwxr-xr-x 3 root root 38404 Sep 19 2022 bunzip2 -rwxr-xr-x 3 root root 38404 Sep 19 2022 bzcat lrwxrwxrwx 1 root root 6 Sep 19 2022 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Sep 19 2022 bzdiff lrwxrwxrwx 1 root root 6 Sep 19 2022 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4893 Nov 28 2021 bzexe lrwxrwxrwx 1 root root 6 Sep 19 2022 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Sep 19 2022 bzgrep -rwxr-xr-x 3 root root 38404 Sep 19 2022 bzip2 -rwxr-xr-x 1 root root 17892 Sep 19 2022 bzip2recover lrwxrwxrwx 1 root root 6 Sep 19 2022 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Sep 19 2022 bzmore -rwxr-xr-x 1 root root 42920 Sep 21 2022 cat -rwxr-xr-x 1 root root 79816 Sep 21 2022 chgrp -rwxr-xr-x 1 root root 67496 Sep 21 2022 chmod -rwxr-xr-x 1 root root 79816 Sep 21 2022 chown -rwxr-xr-x 1 root root 162024 Sep 21 2022 cp -rwxr-xr-x 1 root root 136916 Jan 6 2023 dash -rwxr-xr-x 1 root root 137160 Sep 21 2022 date -rwxr-xr-x 1 root root 100364 Sep 21 2022 dd -rwxr-xr-x 1 root root 108940 Sep 21 2022 df -rwxr-xr-x 1 root root 162152 Sep 21 2022 dir -rwxr-xr-x 1 root root 87760 Mar 24 2023 dmesg lrwxrwxrwx 1 root root 8 Dec 20 2022 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Dec 20 2022 domainname -> hostname -rwxr-xr-x 1 root root 38760 Sep 21 2022 echo -rwxr-xr-x 1 root root 41 Jan 25 2023 egrep -rwxr-xr-x 1 root root 34664 Sep 21 2022 false -rwxr-xr-x 1 root root 41 Jan 25 2023 fgrep -rwxr-xr-x 1 root root 84272 Mar 24 2023 findmnt -rwsr-xr-x 1 root root 30240 Mar 23 2023 fusermount -rwxr-xr-x 1 root root 218680 Jan 25 2023 grep -rwxr-xr-x 2 root root 2346 Apr 10 2022 gunzip -rwxr-xr-x 1 root root 6447 Apr 10 2022 gzexe -rwxr-xr-x 1 root root 100952 Apr 10 2022 gzip -rwxr-xr-x 1 root root 21916 Dec 20 2022 hostname -rwxr-xr-x 1 root root 75756 Sep 21 2022 ln -rwxr-xr-x 1 root root 55600 Mar 24 2023 login -rwxr-xr-x 1 root root 162152 Sep 21 2022 ls -rwxr-xr-x 1 root root 214568 Mar 24 2023 lsblk -rwxr-xr-x 1 root root 96328 Sep 21 2022 mkdir -rwxr-xr-x 1 root root 84008 Sep 21 2022 mknod -rwxr-xr-x 1 root root 38792 Sep 21 2022 mktemp -rwxr-xr-x 1 root root 63016 Mar 24 2023 more -rwsr-xr-x 1 root root 58912 Mar 24 2023 mount -rwxr-xr-x 1 root root 13856 Mar 24 2023 mountpoint -rwxr-xr-x 1 root root 157932 Sep 21 2022 mv lrwxrwxrwx 1 root root 8 Dec 20 2022 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 3 2023 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 38792 Sep 21 2022 pwd lrwxrwxrwx 1 root root 4 Apr 24 2023 rbash -> bash -rwxr-xr-x 1 root root 51080 Sep 21 2022 readlink -rwxr-xr-x 1 root root 75720 Sep 21 2022 rm -rwxr-xr-x 1 root root 51080 Sep 21 2022 rmdir -rwxr-xr-x 1 root root 22308 Nov 3 2022 run-parts -rwxr-xr-x 1 root root 133224 Jan 6 2023 sed lrwxrwxrwx 1 root root 9 Jun 12 19:49 sh -> /bin/bash -rwxr-xr-x 1 root root 38760 Sep 21 2022 sleep -rwxr-xr-x 1 root root 87976 Sep 21 2022 stty -rwsr-xr-x 1 root root 83492 Mar 24 2023 su -rwxr-xr-x 1 root root 38792 Sep 21 2022 sync -rwxr-xr-x 1 root root 598456 Apr 7 2023 tar -rwxr-xr-x 1 root root 13860 Nov 3 2022 tempfile -rwxr-xr-x 1 root root 120776 Sep 21 2022 touch -rwxr-xr-x 1 root root 34664 Sep 21 2022 true -rwxr-xr-x 1 root root 17892 Mar 23 2023 ulockmgr_server -rwsr-xr-x 1 root root 30236 Mar 24 2023 umount -rwxr-xr-x 1 root root 38760 Sep 21 2022 uname -rwxr-xr-x 2 root root 2346 Apr 10 2022 uncompress -rwxr-xr-x 1 root root 162152 Sep 21 2022 vdir -rwxr-xr-x 1 root root 71216 Mar 24 2023 wdctl lrwxrwxrwx 1 root root 8 Dec 20 2022 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Apr 10 2022 zcat -rwxr-xr-x 1 root root 1678 Apr 10 2022 zcmp -rwxr-xr-x 1 root root 6460 Apr 10 2022 zdiff -rwxr-xr-x 1 root root 29 Apr 10 2022 zegrep -rwxr-xr-x 1 root root 29 Apr 10 2022 zfgrep -rwxr-xr-x 1 root root 2081 Apr 10 2022 zforce -rwxr-xr-x 1 root root 8103 Apr 10 2022 zgrep -rwxr-xr-x 1 root root 2206 Apr 10 2022 zless -rwxr-xr-x 1 root root 1842 Apr 10 2022 zmore -rwxr-xr-x 1 root root 4577 Apr 10 2022 znew I: user script /srv/workspace/pbuilder/70124/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: i386 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-intel1{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm15{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libncurses6{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpciaccess0{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} libregexp-ipv6-perl{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpm2 libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 338 newly installed, 0 to remove and 0 not upgraded. Need to get 556 MB of archives. After unpacking 1044 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bookworm/main i386 libpython3.11-minimal i386 3.11.2-6 [813 kB] Get: 2 http://deb.debian.org/debian bookworm/main i386 libexpat1 i386 2.5.0-1 [103 kB] Get: 3 http://deb.debian.org/debian bookworm/main i386 python3.11-minimal i386 3.11.2-6 [2130 kB] Get: 4 http://deb.debian.org/debian bookworm/main i386 python3-minimal i386 3.11.2-1+b1 [26.3 kB] Get: 5 http://deb.debian.org/debian bookworm/main i386 media-types all 10.0.0 [26.1 kB] Get: 6 http://deb.debian.org/debian bookworm/main i386 readline-common all 8.2-1.3 [69.0 kB] Get: 7 http://deb.debian.org/debian bookworm/main i386 libreadline8 i386 8.2-1.3 [171 kB] Get: 8 http://deb.debian.org/debian bookworm/main i386 libpython3.11-stdlib i386 3.11.2-6 [1799 kB] Get: 9 http://deb.debian.org/debian bookworm/main i386 python3.11 i386 3.11.2-6 [572 kB] Get: 10 http://deb.debian.org/debian bookworm/main i386 libpython3-stdlib i386 3.11.2-1+b1 [9308 B] Get: 11 http://deb.debian.org/debian bookworm/main i386 python3 i386 3.11.2-1+b1 [26.3 kB] Get: 12 http://deb.debian.org/debian bookworm/main i386 netbase all 6.4 [12.8 kB] Get: 13 http://deb.debian.org/debian bookworm/main i386 sensible-utils all 0.0.17+nmu1 [19.0 kB] Get: 14 http://deb.debian.org/debian bookworm/main i386 openssl i386 3.0.8-1 [1412 kB] Get: 15 http://deb.debian.org/debian bookworm/main i386 ca-certificates all 20230311 [153 kB] Get: 16 http://deb.debian.org/debian bookworm/main i386 libmagic-mgc i386 1:5.44-3 [305 kB] Get: 17 http://deb.debian.org/debian bookworm/main i386 libmagic1 i386 1:5.44-3 [114 kB] Get: 18 http://deb.debian.org/debian bookworm/main i386 file i386 1:5.44-3 [42.5 kB] Get: 19 http://deb.debian.org/debian bookworm/main i386 gettext-base i386 0.21-12 [162 kB] Get: 20 http://deb.debian.org/debian bookworm/main i386 libuchardet0 i386 0.0.7-1 [67.9 kB] Get: 21 http://deb.debian.org/debian bookworm/main i386 groff-base i386 1.22.4-10 [932 kB] Get: 22 http://deb.debian.org/debian bookworm/main i386 bsdextrautils i386 2.38.1-5+b1 [90.3 kB] Get: 23 http://deb.debian.org/debian bookworm/main i386 libpipeline1 i386 1.5.7-1 [40.0 kB] Get: 24 http://deb.debian.org/debian bookworm/main i386 man-db i386 2.11.2-2 [1397 kB] Get: 25 http://deb.debian.org/debian bookworm/main i386 hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 26 http://deb.debian.org/debian bookworm/main i386 libgdk-pixbuf2.0-common all 2.42.10+dfsg-1 [306 kB] Get: 27 http://deb.debian.org/debian bookworm/main i386 libglib2.0-0 i386 2.74.6-2 [1467 kB] Get: 28 http://deb.debian.org/debian bookworm/main i386 libicu72 i386 72.1-3 [9541 kB] Get: 29 http://deb.debian.org/debian bookworm/main i386 libxml2 i386 2.9.14+dfsg-1.2 [720 kB] Get: 30 http://deb.debian.org/debian bookworm/main i386 shared-mime-info i386 2.2-1 [730 kB] Get: 31 http://deb.debian.org/debian bookworm/main i386 libjpeg62-turbo i386 1:2.1.5-2 [169 kB] Get: 32 http://deb.debian.org/debian bookworm/main i386 libpng16-16 i386 1.6.39-2 [283 kB] Get: 33 http://deb.debian.org/debian bookworm/main i386 libdeflate0 i386 1.14-1 [57.5 kB] Get: 34 http://deb.debian.org/debian bookworm/main i386 libjbig0 i386 2.1-6.1 [31.6 kB] Get: 35 http://deb.debian.org/debian bookworm/main i386 liblerc4 i386 4.0.0+ds-2 [181 kB] Get: 36 http://deb.debian.org/debian bookworm/main i386 libwebp7 i386 1.2.4-0.1 [293 kB] Get: 37 http://deb.debian.org/debian bookworm/main i386 libtiff6 i386 4.5.0-5 [332 kB] Get: 38 http://deb.debian.org/debian bookworm/main i386 libgdk-pixbuf-2.0-0 i386 2.42.10+dfsg-1+b1 [147 kB] Get: 39 http://deb.debian.org/debian bookworm/main i386 gtk-update-icon-cache i386 3.24.37-2 [43.9 kB] Get: 40 http://deb.debian.org/debian bookworm/main i386 adwaita-icon-theme all 43-1 [5124 kB] Get: 41 http://deb.debian.org/debian bookworm/main i386 ca-certificates-java all 20230103 [11.4 kB] Get: 42 http://deb.debian.org/debian bookworm/main i386 java-common all 0.74 [6388 B] Get: 43 http://deb.debian.org/debian bookworm/main i386 libavahi-common-data i386 0.8-10 [107 kB] Get: 44 http://deb.debian.org/debian bookworm/main i386 libavahi-common3 i386 0.8-10 [43.5 kB] Get: 45 http://deb.debian.org/debian bookworm/main i386 libdbus-1-3 i386 1.14.6-1 [213 kB] Get: 46 http://deb.debian.org/debian bookworm/main i386 libavahi-client3 i386 0.8-10 [47.6 kB] Get: 47 http://deb.debian.org/debian bookworm/main i386 libcups2 i386 2.4.2-3 [261 kB] Get: 48 http://deb.debian.org/debian bookworm/main i386 liblcms2-2 i386 2.14-2 [165 kB] Get: 49 http://deb.debian.org/debian bookworm/main i386 libbrotli1 i386 1.0.9-2+b6 [275 kB] Get: 50 http://deb.debian.org/debian bookworm/main i386 libfreetype6 i386 2.12.1+dfsg-5 [410 kB] Get: 51 http://deb.debian.org/debian bookworm/main i386 fonts-dejavu-core all 2.37-6 [1068 kB] Get: 52 http://deb.debian.org/debian bookworm/main i386 fontconfig-config i386 2.14.1-4 [315 kB] Get: 53 http://deb.debian.org/debian bookworm/main i386 libfontconfig1 i386 2.14.1-4 [398 kB] Get: 54 http://deb.debian.org/debian bookworm/main i386 libnspr4 i386 2:4.35-1 [123 kB] Get: 55 http://deb.debian.org/debian bookworm/main i386 libnss3 i386 2:3.87.1-1 [1439 kB] Get: 56 http://deb.debian.org/debian bookworm/main i386 libasound2-data all 1.2.8-1 [20.5 kB] Get: 57 http://deb.debian.org/debian bookworm/main i386 libasound2 i386 1.2.8-1+b1 [388 kB] Get: 58 http://deb.debian.org/debian bookworm/main i386 libgraphite2-3 i386 1.3.14-1 [84.0 kB] Get: 59 http://deb.debian.org/debian bookworm/main i386 libharfbuzz0b i386 6.0.0+dfsg-3 [1966 kB] Get: 60 http://deb.debian.org/debian bookworm/main i386 libpcsclite1 i386 1.9.9-2 [50.9 kB] Get: 61 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jre-headless i386 17.0.6+10-1 [42.2 MB] Get: 62 http://deb.debian.org/debian bookworm/main i386 default-jre-headless i386 2:1.17-74 [2932 B] Get: 63 http://deb.debian.org/debian bookworm/main i386 ant all 1.10.13-1 [2161 kB] Get: 64 http://deb.debian.org/debian bookworm/main i386 ant-optional all 1.10.13-1 [449 kB] Get: 65 http://deb.debian.org/debian bookworm/main i386 libantlr-java all 2.7.7+dfsg-12 [458 kB] Get: 66 http://deb.debian.org/debian bookworm/main i386 antlr all 2.7.7+dfsg-12 [14.3 kB] Get: 67 http://deb.debian.org/debian bookworm/main i386 at-spi2-common all 2.46.0-5 [162 kB] Get: 68 http://deb.debian.org/debian bookworm/main i386 m4 i386 1.4.19-3 [294 kB] Get: 69 http://deb.debian.org/debian bookworm/main i386 autoconf all 2.71-3 [332 kB] Get: 70 http://deb.debian.org/debian bookworm/main i386 autotools-dev all 20220109.1 [51.6 kB] Get: 71 http://deb.debian.org/debian bookworm/main i386 automake all 1:1.16.5-1.3 [823 kB] Get: 72 http://deb.debian.org/debian bookworm/main i386 autopoint all 0.21-12 [495 kB] Get: 73 http://deb.debian.org/debian bookworm/main i386 unzip i386 6.0-28 [166 kB] Get: 74 http://deb.debian.org/debian bookworm/main i386 java-wrappers all 0.4 [8916 B] Get: 75 http://deb.debian.org/debian bookworm/main i386 libhamcrest-java all 2.2-1 [121 kB] Get: 76 http://deb.debian.org/debian bookworm/main i386 junit4 all 4.13.2-3 [348 kB] Get: 77 http://deb.debian.org/debian bookworm/main i386 libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 78 http://deb.debian.org/debian bookworm/main i386 libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 79 http://deb.debian.org/debian bookworm/main i386 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 80 http://deb.debian.org/debian bookworm/main i386 libosgi-core-java all 8.0.0-2 [182 kB] Get: 81 http://deb.debian.org/debian bookworm/main i386 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 82 http://deb.debian.org/debian bookworm/main i386 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 83 http://deb.debian.org/debian bookworm/main i386 libjansi-native-java all 1.8-1 [26.0 kB] Get: 84 http://deb.debian.org/debian bookworm/main i386 libjansi1-java all 1.18-3 [66.5 kB] Get: 85 http://deb.debian.org/debian bookworm/main i386 libjline2-java all 2.14.6-5 [151 kB] Get: 86 http://deb.debian.org/debian bookworm/main i386 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 87 http://deb.debian.org/debian bookworm/main i386 libslf4j-java all 1.7.32-1 [144 kB] Get: 88 http://deb.debian.org/debian bookworm/main i386 libxz-java all 1.9-1 [143 kB] Get: 89 http://deb.debian.org/debian bookworm/main i386 libyaml-snake-java all 1.33-2 [321 kB] Get: 90 http://deb.debian.org/debian bookworm/main i386 bnd all 5.0.1-3 [9915 kB] Get: 91 http://deb.debian.org/debian bookworm/main i386 dctrl-tools i386 2.24-3 [105 kB] Get: 92 http://deb.debian.org/debian bookworm/main i386 libdebhelper-perl all 13.11.4 [81.2 kB] Get: 93 http://deb.debian.org/debian bookworm/main i386 libtool all 2.4.7-5 [517 kB] Get: 94 http://deb.debian.org/debian bookworm/main i386 dh-autoreconf all 20 [17.1 kB] Get: 95 http://deb.debian.org/debian bookworm/main i386 libarchive-zip-perl all 1.68-1 [104 kB] Get: 96 http://deb.debian.org/debian bookworm/main i386 libsub-override-perl all 0.09-4 [9304 B] Get: 97 http://deb.debian.org/debian bookworm/main i386 libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 98 http://deb.debian.org/debian bookworm/main i386 dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 99 http://deb.debian.org/debian bookworm/main i386 libelf1 i386 0.188-2.1 [179 kB] Get: 100 http://deb.debian.org/debian bookworm/main i386 dwz i386 0.15-1 [118 kB] Get: 101 http://deb.debian.org/debian bookworm/main i386 gettext i386 0.21-12 [1311 kB] Get: 102 http://deb.debian.org/debian bookworm/main i386 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 103 http://deb.debian.org/debian bookworm/main i386 po-debconf all 1.0.21+nmu1 [248 kB] Get: 104 http://deb.debian.org/debian bookworm/main i386 debhelper all 13.11.4 [942 kB] Get: 105 http://deb.debian.org/debian bookworm/main i386 libgtk2.0-common all 2.24.33-2 [2700 kB] Get: 106 http://deb.debian.org/debian bookworm/main i386 libatk1.0-0 i386 2.46.0-5 [49.4 kB] Get: 107 http://deb.debian.org/debian bookworm/main i386 libpixman-1-0 i386 0.42.2-1 [548 kB] Get: 108 http://deb.debian.org/debian bookworm/main i386 libxau6 i386 1:1.0.9-1 [20.0 kB] Get: 109 http://deb.debian.org/debian bookworm/main i386 libbsd0 i386 0.11.7-2 [121 kB] Get: 110 http://deb.debian.org/debian bookworm/main i386 libxdmcp6 i386 1:1.1.2-3 [26.7 kB] Get: 111 http://deb.debian.org/debian bookworm/main i386 libxcb1 i386 1.15-1 [148 kB] Get: 112 http://deb.debian.org/debian bookworm/main i386 libx11-data all 2:1.8.4-2 [292 kB] Get: 113 http://deb.debian.org/debian bookworm/main i386 libx11-6 i386 2:1.8.4-2 [782 kB] Get: 114 http://deb.debian.org/debian bookworm/main i386 libxcb-render0 i386 1.15-1 [116 kB] Get: 115 http://deb.debian.org/debian bookworm/main i386 libxcb-shm0 i386 1.15-1 [106 kB] Get: 116 http://deb.debian.org/debian bookworm/main i386 libxext6 i386 2:1.3.4-1+b1 [55.3 kB] Get: 117 http://deb.debian.org/debian bookworm/main i386 libxrender1 i386 1:0.9.10-1.1 [34.1 kB] Get: 118 http://deb.debian.org/debian bookworm/main i386 libcairo2 i386 1.16.0-7 [627 kB] Get: 119 http://deb.debian.org/debian bookworm/main i386 fontconfig i386 2.14.1-4 [450 kB] Get: 120 http://deb.debian.org/debian bookworm/main i386 libfribidi0 i386 1.0.8-2.1 [65.6 kB] Get: 121 http://deb.debian.org/debian bookworm/main i386 libthai-data all 0.1.29-1 [176 kB] Get: 122 http://deb.debian.org/debian bookworm/main i386 libdatrie1 i386 0.2.13-2+b1 [45.0 kB] Get: 123 http://deb.debian.org/debian bookworm/main i386 libthai0 i386 0.1.29-1 [58.6 kB] Get: 124 http://deb.debian.org/debian bookworm/main i386 libpango-1.0-0 i386 1.50.12+ds-1 [220 kB] Get: 125 http://deb.debian.org/debian bookworm/main i386 libpangoft2-1.0-0 i386 1.50.12+ds-1 [50.5 kB] Get: 126 http://deb.debian.org/debian bookworm/main i386 libpangocairo-1.0-0 i386 1.50.12+ds-1 [35.4 kB] Get: 127 http://deb.debian.org/debian bookworm/main i386 libxcomposite1 i386 1:0.4.5-1 [16.9 kB] Get: 128 http://deb.debian.org/debian bookworm/main i386 libxfixes3 i386 1:6.0.0-2 [23.0 kB] Get: 129 http://deb.debian.org/debian bookworm/main i386 libxcursor1 i386 1:1.2.1-1 [42.4 kB] Get: 130 http://deb.debian.org/debian bookworm/main i386 libxdamage1 i386 1:1.1.6-1 [15.3 kB] Get: 131 http://deb.debian.org/debian bookworm/main i386 libxi6 i386 2:1.8-1+b1 [86.2 kB] Get: 132 http://deb.debian.org/debian bookworm/main i386 libxinerama1 i386 2:1.1.4-3 [18.1 kB] Get: 133 http://deb.debian.org/debian bookworm/main i386 libxrandr2 i386 2:1.5.2-2+b1 [40.8 kB] Get: 134 http://deb.debian.org/debian bookworm/main i386 libgtk2.0-0 i386 2.24.33-2 [1970 kB] Get: 135 http://deb.debian.org/debian bookworm/main i386 libglvnd0 i386 1.6.0-1 [42.7 kB] Get: 136 http://deb.debian.org/debian bookworm/main i386 libdrm-common all 2.4.114-1 [7112 B] Get: 137 http://deb.debian.org/debian bookworm/main i386 libdrm2 i386 2.4.114-1+b1 [40.8 kB] Get: 138 http://deb.debian.org/debian bookworm/main i386 libglapi-mesa i386 22.3.6-1+deb12u1 [35.6 kB] Get: 139 http://deb.debian.org/debian bookworm/main i386 libx11-xcb1 i386 2:1.8.4-2 [192 kB] Get: 140 http://deb.debian.org/debian bookworm/main i386 libxcb-dri2-0 i386 1.15-1 [107 kB] Get: 141 http://deb.debian.org/debian bookworm/main i386 libxcb-dri3-0 i386 1.15-1 [107 kB] Get: 142 http://deb.debian.org/debian bookworm/main i386 libxcb-glx0 i386 1.15-1 [124 kB] Get: 143 http://deb.debian.org/debian bookworm/main i386 libxcb-present0 i386 1.15-1 [106 kB] Get: 144 http://deb.debian.org/debian bookworm/main i386 libxcb-randr0 i386 1.15-1 [118 kB] Get: 145 http://deb.debian.org/debian bookworm/main i386 libxcb-sync1 i386 1.15-1 [109 kB] Get: 146 http://deb.debian.org/debian bookworm/main i386 libxcb-xfixes0 i386 1.15-1 [110 kB] Get: 147 http://deb.debian.org/debian bookworm/main i386 libxshmfence1 i386 1.3-1 [8976 B] Get: 148 http://deb.debian.org/debian bookworm/main i386 libxxf86vm1 i386 1:1.1.4-1+b2 [21.7 kB] Get: 149 http://deb.debian.org/debian bookworm/main i386 libdrm-amdgpu1 i386 2.4.114-1+b1 [24.1 kB] Get: 150 http://deb.debian.org/debian bookworm/main i386 libpciaccess0 i386 0.17-2 [53.4 kB] Get: 151 http://deb.debian.org/debian bookworm/main i386 libdrm-intel1 i386 2.4.114-1+b1 [67.9 kB] Get: 152 http://deb.debian.org/debian bookworm/main i386 libdrm-nouveau2 i386 2.4.114-1+b1 [20.7 kB] Get: 153 http://deb.debian.org/debian bookworm/main i386 libdrm-radeon1 i386 2.4.114-1+b1 [22.8 kB] Get: 154 http://deb.debian.org/debian bookworm/main i386 libedit2 i386 3.1-20221030-2 [97.2 kB] Get: 155 http://deb.debian.org/debian bookworm/main i386 libz3-4 i386 4.8.12-3.1 [7853 kB] Get: 156 http://deb.debian.org/debian bookworm/main i386 libllvm15 i386 1:15.0.6-4+b1 [26.5 MB] Get: 157 http://deb.debian.org/debian bookworm/main i386 libsensors-config all 1:3.6.0-7.1 [14.3 kB] Get: 158 http://deb.debian.org/debian bookworm/main i386 libsensors5 i386 1:3.6.0-7.1 [35.1 kB] Get: 159 http://deb.debian.org/debian bookworm/main i386 libgl1-mesa-dri i386 22.3.6-1+deb12u1 [7417 kB] Get: 160 http://deb.debian.org/debian bookworm/main i386 libglx-mesa0 i386 22.3.6-1+deb12u1 [156 kB] Get: 161 http://deb.debian.org/debian bookworm/main i386 libglx0 i386 1.6.0-1 [36.6 kB] Get: 162 http://deb.debian.org/debian bookworm/main i386 libgl1 i386 1.6.0-1 [82.1 kB] Get: 163 http://deb.debian.org/debian bookworm/main i386 libgif7 i386 5.2.1-2.5 [48.3 kB] Get: 164 http://deb.debian.org/debian bookworm/main i386 x11-common all 1:7.7+23 [252 kB] Get: 165 http://deb.debian.org/debian bookworm/main i386 libxtst6 i386 2:1.2.3-1.1 [28.6 kB] Get: 166 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jre i386 17.0.6+10-1 [167 kB] Get: 167 http://deb.debian.org/debian bookworm/main i386 default-jre i386 2:1.17-74 [1056 B] Get: 168 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jdk-headless i386 17.0.6+10-1 [309 MB] Get: 169 http://deb.debian.org/debian bookworm/main i386 default-jdk-headless i386 2:1.17-74 [1108 B] Get: 170 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jdk i386 17.0.6+10-1 [4538 kB] Get: 171 http://deb.debian.org/debian bookworm/main i386 default-jdk i386 2:1.17-74 [1068 B] Get: 172 http://deb.debian.org/debian bookworm/main i386 libassuan0 i386 2.5.5-5 [50.3 kB] Get: 173 http://deb.debian.org/debian bookworm/main i386 gpgconf i386 2.2.40-1.1 [572 kB] Get: 174 http://deb.debian.org/debian bookworm/main i386 libksba8 i386 1.6.3-2 [135 kB] Get: 175 http://deb.debian.org/debian bookworm/main i386 libsasl2-modules-db i386 2.1.28+dfsg-10 [21.4 kB] Get: 176 http://deb.debian.org/debian bookworm/main i386 libsasl2-2 i386 2.1.28+dfsg-10 [62.7 kB] Get: 177 http://deb.debian.org/debian bookworm/main i386 libldap-2.5-0 i386 2.5.13+dfsg-5 [196 kB] Get: 178 http://deb.debian.org/debian bookworm/main i386 libnpth0 i386 1.6-3 [19.1 kB] Get: 179 http://deb.debian.org/debian bookworm/main i386 dirmngr i386 2.2.40-1.1 [819 kB] Get: 180 http://deb.debian.org/debian bookworm/main i386 gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 181 http://deb.debian.org/debian bookworm/main i386 gnupg-utils i386 2.2.40-1.1 [973 kB] Get: 182 http://deb.debian.org/debian bookworm/main i386 gpg i386 2.2.40-1.1 [991 kB] Get: 183 http://deb.debian.org/debian bookworm/main i386 pinentry-curses i386 1.2.1-1 [79.0 kB] Get: 184 http://deb.debian.org/debian bookworm/main i386 gpg-agent i386 2.2.40-1.1 [715 kB] Get: 185 http://deb.debian.org/debian bookworm/main i386 gpg-wks-client i386 2.2.40-1.1 [551 kB] Get: 186 http://deb.debian.org/debian bookworm/main i386 gpg-wks-server i386 2.2.40-1.1 [541 kB] Get: 187 http://deb.debian.org/debian bookworm/main i386 gpgsm i386 2.2.40-1.1 [691 kB] Get: 188 http://deb.debian.org/debian bookworm/main i386 gnupg all 2.2.40-1.1 [846 kB] Get: 189 http://deb.debian.org/debian bookworm/main i386 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 190 http://deb.debian.org/debian bookworm/main i386 libfile-which-perl all 1.27-2 [15.1 kB] Get: 191 http://deb.debian.org/debian bookworm/main i386 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 192 http://deb.debian.org/debian bookworm/main i386 libfile-touch-perl all 0.12-2 [8816 B] Get: 193 http://deb.debian.org/debian bookworm/main i386 libio-pty-perl i386 1:1.17-1 [36.5 kB] Get: 194 http://deb.debian.org/debian bookworm/main i386 libipc-run-perl all 20220807.0-1 [104 kB] Get: 195 http://deb.debian.org/debian bookworm/main i386 libclass-method-modifiers-perl all 2.14-1 [18.1 kB] Get: 196 http://deb.debian.org/debian bookworm/main i386 libclass-xsaccessor-perl i386 1.19-4+b1 [38.0 kB] Get: 197 http://deb.debian.org/debian bookworm/main i386 libb-hooks-op-check-perl i386 0.22-2+b1 [10.6 kB] Get: 198 http://deb.debian.org/debian bookworm/main i386 libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 199 http://deb.debian.org/debian bookworm/main i386 libdevel-callchecker-perl i386 0.008-2 [15.8 kB] Get: 200 http://deb.debian.org/debian bookworm/main i386 libparams-classify-perl i386 0.015-2+b1 [23.7 kB] Get: 201 http://deb.debian.org/debian bookworm/main i386 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 202 http://deb.debian.org/debian bookworm/main i386 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 203 http://deb.debian.org/debian bookworm/main i386 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 204 http://deb.debian.org/debian bookworm/main i386 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 205 http://deb.debian.org/debian bookworm/main i386 libmoo-perl all 2.005005-1 [58.0 kB] Get: 206 http://deb.debian.org/debian bookworm/main i386 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 207 http://deb.debian.org/debian bookworm/main i386 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 208 http://deb.debian.org/debian bookworm/main i386 libhttp-date-perl all 6.05-2 [10.5 kB] Get: 209 http://deb.debian.org/debian bookworm/main i386 libfile-listing-perl all 6.15-1 [12.6 kB] Get: 210 http://deb.debian.org/debian bookworm/main i386 libhtml-tagset-perl all 3.20-6 [11.7 kB] Get: 211 http://deb.debian.org/debian bookworm/main i386 libregexp-ipv6-perl all 0.03-3 [5212 B] Get: 212 http://deb.debian.org/debian bookworm/main i386 liburi-perl all 5.17-1 [90.4 kB] Get: 213 http://deb.debian.org/debian bookworm/main i386 libhtml-parser-perl i386 3.81-1 [102 kB] Get: 214 http://deb.debian.org/debian bookworm/main i386 libhtml-tree-perl all 5.07-3 [211 kB] Get: 215 http://deb.debian.org/debian bookworm/main i386 libclone-perl i386 0.46-1 [13.8 kB] Get: 216 http://deb.debian.org/debian bookworm/main i386 libio-html-perl all 1.004-3 [16.2 kB] Get: 217 http://deb.debian.org/debian bookworm/main i386 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 218 http://deb.debian.org/debian bookworm/main i386 libhttp-message-perl all 6.44-1 [81.7 kB] Get: 219 http://deb.debian.org/debian bookworm/main i386 libhttp-cookies-perl all 6.10-1 [19.6 kB] Get: 220 http://deb.debian.org/debian bookworm/main i386 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 221 http://deb.debian.org/debian bookworm/main i386 perl-openssl-defaults i386 7+b1 [7920 B] Get: 222 http://deb.debian.org/debian bookworm/main i386 libnet-ssleay-perl i386 1.92-2+b1 [318 kB] Get: 223 http://deb.debian.org/debian bookworm/main i386 libio-socket-ssl-perl all 2.081-2 [219 kB] Get: 224 http://deb.debian.org/debian bookworm/main i386 libnet-http-perl all 6.22-1 [25.3 kB] Get: 225 http://deb.debian.org/debian bookworm/main i386 liblwp-protocol-https-perl all 6.10-1 [12.2 kB] Get: 226 http://deb.debian.org/debian bookworm/main i386 libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 227 http://deb.debian.org/debian bookworm/main i386 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 228 http://deb.debian.org/debian bookworm/main i386 libwww-perl all 6.68-1 [186 kB] Get: 229 http://deb.debian.org/debian bookworm/main i386 patchutils i386 0.4.2-1 [79.6 kB] Get: 230 http://deb.debian.org/debian bookworm/main i386 wdiff i386 1.2.2-5 [120 kB] Get: 231 http://deb.debian.org/debian bookworm/main i386 devscripts i386 2.23.3 [1072 kB] Get: 232 http://deb.debian.org/debian bookworm/main i386 ivy all 2.5.1-2 [1288 kB] Get: 233 http://deb.debian.org/debian bookworm/main i386 libasm-java all 9.4-1 [389 kB] Get: 234 http://deb.debian.org/debian bookworm/main i386 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 235 http://deb.debian.org/debian bookworm/main i386 libcommons-cli-java all 1.5.0-1 [60.0 kB] Get: 236 http://deb.debian.org/debian bookworm/main i386 libapache-pom-java all 29-2 [5276 B] Get: 237 http://deb.debian.org/debian bookworm/main i386 libcommons-parent-java all 56-1 [10.8 kB] Get: 238 http://deb.debian.org/debian bookworm/main i386 libcommons-logging-java all 1.2-3 [62.4 kB] Get: 239 http://deb.debian.org/debian bookworm/main i386 libjansi-java all 2.4.0-2 [105 kB] Get: 240 http://deb.debian.org/debian bookworm/main i386 libqdox-java all 1.12.1-3 [172 kB] Get: 241 http://deb.debian.org/debian bookworm/main i386 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 242 http://deb.debian.org/debian bookworm/main i386 libxpp3-java all 1.1.4c-3 [292 kB] Get: 243 http://deb.debian.org/debian bookworm/main i386 libxstream-java all 1.4.20-1 [565 kB] Get: 244 http://deb.debian.org/debian bookworm/main i386 groovy all 2.4.21-7 [12.9 MB] Get: 245 http://deb.debian.org/debian bookworm/main i386 libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 246 http://deb.debian.org/debian bookworm/main i386 libcommons-collections3-java all 3.2.2-2 [526 kB] Get: 247 http://deb.debian.org/debian bookworm/main i386 libcommons-compress-java all 1.22-1 [615 kB] Get: 248 http://deb.debian.org/debian bookworm/main i386 libcommons-io-java all 2.11.0-2 [319 kB] Get: 249 http://deb.debian.org/debian bookworm/main i386 libcommons-lang-java all 2.6-10 [273 kB] Get: 250 http://deb.debian.org/debian bookworm/main i386 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 251 http://deb.debian.org/debian bookworm/main i386 libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 252 http://deb.debian.org/debian bookworm/main i386 libguava-java all 31.1-1 [2613 kB] Get: 253 http://deb.debian.org/debian bookworm/main i386 libcommons-codec-java all 1.15-1 [292 kB] Get: 254 http://deb.debian.org/debian bookworm/main i386 libhttpcore-java all 4.4.16-1 [636 kB] Get: 255 http://deb.debian.org/debian bookworm/main i386 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 256 http://deb.debian.org/debian bookworm/main i386 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 257 http://deb.debian.org/debian bookworm/main i386 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 258 http://deb.debian.org/debian bookworm/main i386 libjna-jni i386 5.13.0-2 [63.2 kB] Get: 259 http://deb.debian.org/debian bookworm/main i386 libjna-java all 5.13.0-2 [236 kB] Get: 260 http://deb.debian.org/debian bookworm/main i386 libjzlib-java all 1.1.3-2 [80.0 kB] Get: 261 http://deb.debian.org/debian bookworm/main i386 libjsch-java all 0.1.55-1 [298 kB] Get: 262 http://deb.debian.org/debian bookworm/main i386 libminlog-java all 1.3.0-1.1 [7928 B] Get: 263 http://deb.debian.org/debian bookworm/main i386 libobjenesis-java all 3.3-3 [41.3 kB] Get: 264 http://deb.debian.org/debian bookworm/main i386 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 265 http://deb.debian.org/debian bookworm/main i386 libkryo-java all 2.20-7 [158 kB] Get: 266 http://deb.debian.org/debian bookworm/main i386 liblogback-java all 1:1.2.11-2 [700 kB] Get: 267 http://deb.debian.org/debian bookworm/main i386 libncurses6 i386 6.4-2 [111 kB] Get: 268 http://deb.debian.org/debian bookworm/main i386 libnative-platform-jni i386 0.14-5 [13.7 kB] Get: 269 http://deb.debian.org/debian bookworm/main i386 libnative-platform-java all 0.14-5 [71.0 kB] Get: 270 http://deb.debian.org/debian bookworm/main i386 libxml-commons-external-java all 1.4.01-5 [240 kB] Get: 271 http://deb.debian.org/debian bookworm/main i386 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 272 http://deb.debian.org/debian bookworm/main i386 libxerces2-java all 2.12.2-1 [1440 kB] Get: 273 http://deb.debian.org/debian bookworm/main i386 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 274 http://deb.debian.org/debian bookworm/main i386 libxbean-reflect-java all 4.5-8 [133 kB] Get: 275 http://deb.debian.org/debian bookworm/main i386 libgradle-core-java all 4.4.1-18 [4286 kB] Get: 276 http://deb.debian.org/debian bookworm/main i386 libbcprov-java all 1.72-2 [8225 kB] Get: 277 http://deb.debian.org/debian bookworm/main i386 libbcpg-java all 1.72-2 [383 kB] Get: 278 http://deb.debian.org/debian bookworm/main i386 libbsh-java all 2.0b4-20 [291 kB] Get: 279 http://deb.debian.org/debian bookworm/main i386 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 280 http://deb.debian.org/debian bookworm/main i386 libjaxen-java all 1.1.6-4 [214 kB] Get: 281 http://deb.debian.org/debian bookworm/main i386 libdom4j-java all 2.1.3-2 [310 kB] Get: 282 http://deb.debian.org/debian bookworm/main i386 libbcel-java all 6.5.0-2 [634 kB] Get: 283 http://deb.debian.org/debian bookworm/main i386 libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 284 http://deb.debian.org/debian bookworm/main i386 libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 285 http://deb.debian.org/debian bookworm/main i386 libgoogle-gson-java all 2.10-1 [261 kB] Get: 286 http://deb.debian.org/debian bookworm/main i386 libaopalliance-java all 20070526-7 [8572 B] Get: 287 http://deb.debian.org/debian bookworm/main i386 libguice-java all 4.2.3-2 [1435 kB] Get: 288 http://deb.debian.org/debian bookworm/main i386 libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 289 http://deb.debian.org/debian bookworm/main i386 libjcifs-java all 1.3.19-2 [394 kB] Get: 290 http://deb.debian.org/debian bookworm/main i386 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 291 http://deb.debian.org/debian bookworm/main i386 libjavaewah-java all 1.1.7-1 [156 kB] Get: 292 http://deb.debian.org/debian bookworm/main i386 libel-api-java all 3.0.0-3 [64.9 kB] Get: 293 http://deb.debian.org/debian bookworm/main i386 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 294 http://deb.debian.org/debian bookworm/main i386 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 295 http://deb.debian.org/debian bookworm/main i386 libjetty9-java all 9.4.50-3 [2962 kB] Get: 296 http://deb.debian.org/debian bookworm/main i386 libjgit-java all 4.11.9-2 [2534 kB] Get: 297 http://deb.debian.org/debian bookworm/main i386 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 298 http://deb.debian.org/debian bookworm/main i386 libcommons-lang3-java all 3.12.0-2 [561 kB] Get: 299 http://deb.debian.org/debian bookworm/main i386 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 300 http://deb.debian.org/debian bookworm/main i386 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 301 http://deb.debian.org/debian bookworm/main i386 libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 302 http://deb.debian.org/debian bookworm/main i386 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 303 http://deb.debian.org/debian bookworm/main i386 libmaven-parent-java all 35-1 [6140 B] Get: 304 http://deb.debian.org/debian bookworm/main i386 libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 305 http://deb.debian.org/debian bookworm/main i386 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 306 http://deb.debian.org/debian bookworm/main i386 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 307 http://deb.debian.org/debian bookworm/main i386 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 308 http://deb.debian.org/debian bookworm/main i386 libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 309 http://deb.debian.org/debian bookworm/main i386 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 310 http://deb.debian.org/debian bookworm/main i386 libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 311 http://deb.debian.org/debian bookworm/main i386 libcdi-api-java all 1.2-3 [54.3 kB] Get: 312 http://deb.debian.org/debian bookworm/main i386 libsisu-inject-java all 0.3.4-2 [347 kB] Get: 313 http://deb.debian.org/debian bookworm/main i386 libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 314 http://deb.debian.org/debian bookworm/main i386 libmaven3-core-java all 3.8.7-1 [1572 kB] Get: 315 http://deb.debian.org/debian bookworm/main i386 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 316 http://deb.debian.org/debian bookworm/main i386 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 317 http://deb.debian.org/debian bookworm/main i386 librhino-java all 1.7.14-2.1 [1357 kB] Get: 318 http://deb.debian.org/debian bookworm/main i386 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 319 http://deb.debian.org/debian bookworm/main i386 libwagon-file-java all 3.5.3-1 [8388 B] Get: 320 http://deb.debian.org/debian bookworm/main i386 libjsoup-java all 1.15.3-1 [431 kB] Get: 321 http://deb.debian.org/debian bookworm/main i386 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 322 http://deb.debian.org/debian bookworm/main i386 libjcommander-java all 1.71-4 [73.0 kB] Get: 323 http://deb.debian.org/debian bookworm/main i386 testng all 6.9.12-4 [795 kB] Get: 324 http://deb.debian.org/debian bookworm/main i386 libgradle-plugins-java all 4.4.1-18 [5212 kB] Get: 325 http://deb.debian.org/debian bookworm/main i386 gradle all 4.4.1-18 [398 kB] Get: 326 http://deb.debian.org/debian bookworm/main i386 maven-repo-helper all 1.11 [142 kB] Get: 327 http://deb.debian.org/debian bookworm/main i386 gradle-debian-helper all 2.4 [24.5 kB] Get: 328 http://deb.debian.org/debian bookworm/main i386 javahelper all 0.78 [97.2 kB] Get: 329 http://deb.debian.org/debian bookworm/main i386 libbyte-buddy-java all 1.12.21-1 [4393 kB] Get: 330 http://deb.debian.org/debian bookworm/main i386 libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 331 http://deb.debian.org/debian bookworm/main i386 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 332 http://deb.debian.org/debian bookworm/main i386 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 333 http://deb.debian.org/debian bookworm/main i386 libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 334 http://deb.debian.org/debian bookworm/main i386 liblz4-jni i386 1.8.0-3 [9916 B] Get: 335 http://deb.debian.org/debian bookworm/main i386 liblz4-java all 1.8.0-3 [114 kB] Get: 336 http://deb.debian.org/debian bookworm/main i386 libmockito-java all 2.23.0-2 [479 kB] Get: 337 http://deb.debian.org/debian bookworm/main i386 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 338 http://deb.debian.org/debian bookworm/main i386 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 556 MB in 60s (9347 kB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:i386. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../libpython3.11-minimal_3.11.2-6_i386.deb ... Unpacking libpython3.11-minimal:i386 (3.11.2-6) ... Selecting previously unselected package libexpat1:i386. Preparing to unpack .../libexpat1_2.5.0-1_i386.deb ... Unpacking libexpat1:i386 (2.5.0-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.2-6_i386.deb ... Unpacking python3.11-minimal (3.11.2-6) ... Setting up libpython3.11-minimal:i386 (3.11.2-6) ... Setting up libexpat1:i386 (2.5.0-1) ... Setting up python3.11-minimal (3.11.2-6) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19920 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.2-1+b1_i386.deb ... Unpacking python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.0.0_all.deb ... Unpacking media-types (10.0.0) ... Selecting previously unselected package readline-common. Preparing to unpack .../2-readline-common_8.2-1.3_all.deb ... Unpacking readline-common (8.2-1.3) ... Selecting previously unselected package libreadline8:i386. Preparing to unpack .../3-libreadline8_8.2-1.3_i386.deb ... Unpacking libreadline8:i386 (8.2-1.3) ... Selecting previously unselected package libpython3.11-stdlib:i386. Preparing to unpack .../4-libpython3.11-stdlib_3.11.2-6_i386.deb ... Unpacking libpython3.11-stdlib:i386 (3.11.2-6) ... Selecting previously unselected package python3.11. Preparing to unpack .../5-python3.11_3.11.2-6_i386.deb ... Unpacking python3.11 (3.11.2-6) ... Selecting previously unselected package libpython3-stdlib:i386. Preparing to unpack .../6-libpython3-stdlib_3.11.2-1+b1_i386.deb ... Unpacking libpython3-stdlib:i386 (3.11.2-1+b1) ... Setting up python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20354 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.2-1+b1_i386.deb ... Unpacking python3 (3.11.2-1+b1) ... Selecting previously unselected package netbase. Preparing to unpack .../001-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../002-sensible-utils_0.0.17+nmu1_all.deb ... Unpacking sensible-utils (0.0.17+nmu1) ... Selecting previously unselected package openssl. Preparing to unpack .../003-openssl_3.0.8-1_i386.deb ... Unpacking openssl (3.0.8-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../004-ca-certificates_20230311_all.deb ... Unpacking ca-certificates (20230311) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../005-libmagic-mgc_1%3a5.44-3_i386.deb ... Unpacking libmagic-mgc (1:5.44-3) ... Selecting previously unselected package libmagic1:i386. Preparing to unpack .../006-libmagic1_1%3a5.44-3_i386.deb ... Unpacking libmagic1:i386 (1:5.44-3) ... Selecting previously unselected package file. Preparing to unpack .../007-file_1%3a5.44-3_i386.deb ... Unpacking file (1:5.44-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../008-gettext-base_0.21-12_i386.deb ... Unpacking gettext-base (0.21-12) ... Selecting previously unselected package libuchardet0:i386. Preparing to unpack .../009-libuchardet0_0.0.7-1_i386.deb ... Unpacking libuchardet0:i386 (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../010-groff-base_1.22.4-10_i386.deb ... Unpacking groff-base (1.22.4-10) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../011-bsdextrautils_2.38.1-5+b1_i386.deb ... Unpacking bsdextrautils (2.38.1-5+b1) ... Selecting previously unselected package libpipeline1:i386. Preparing to unpack .../012-libpipeline1_1.5.7-1_i386.deb ... Unpacking libpipeline1:i386 (1.5.7-1) ... Selecting previously unselected package man-db. Preparing to unpack .../013-man-db_2.11.2-2_i386.deb ... Unpacking man-db (2.11.2-2) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../014-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.10+dfsg-1_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Selecting previously unselected package libglib2.0-0:i386. Preparing to unpack .../016-libglib2.0-0_2.74.6-2_i386.deb ... Unpacking libglib2.0-0:i386 (2.74.6-2) ... Selecting previously unselected package libicu72:i386. Preparing to unpack .../017-libicu72_72.1-3_i386.deb ... Unpacking libicu72:i386 (72.1-3) ... Selecting previously unselected package libxml2:i386. Preparing to unpack .../018-libxml2_2.9.14+dfsg-1.2_i386.deb ... Unpacking libxml2:i386 (2.9.14+dfsg-1.2) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.2-1_i386.deb ... Unpacking shared-mime-info (2.2-1) ... Selecting previously unselected package libjpeg62-turbo:i386. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-2_i386.deb ... Unpacking libjpeg62-turbo:i386 (1:2.1.5-2) ... Selecting previously unselected package libpng16-16:i386. Preparing to unpack .../021-libpng16-16_1.6.39-2_i386.deb ... Unpacking libpng16-16:i386 (1.6.39-2) ... Selecting previously unselected package libdeflate0:i386. Preparing to unpack .../022-libdeflate0_1.14-1_i386.deb ... Unpacking libdeflate0:i386 (1.14-1) ... Selecting previously unselected package libjbig0:i386. Preparing to unpack .../023-libjbig0_2.1-6.1_i386.deb ... Unpacking libjbig0:i386 (2.1-6.1) ... Selecting previously unselected package liblerc4:i386. Preparing to unpack .../024-liblerc4_4.0.0+ds-2_i386.deb ... Unpacking liblerc4:i386 (4.0.0+ds-2) ... Selecting previously unselected package libwebp7:i386. Preparing to unpack .../025-libwebp7_1.2.4-0.1_i386.deb ... Unpacking libwebp7:i386 (1.2.4-0.1) ... Selecting previously unselected package libtiff6:i386. Preparing to unpack .../026-libtiff6_4.5.0-5_i386.deb ... Unpacking libtiff6:i386 (4.5.0-5) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:i386. Preparing to unpack .../027-libgdk-pixbuf-2.0-0_2.42.10+dfsg-1+b1_i386.deb ... Unpacking libgdk-pixbuf-2.0-0:i386 (2.42.10+dfsg-1+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../028-gtk-update-icon-cache_3.24.37-2_i386.deb ... Unpacking gtk-update-icon-cache (3.24.37-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../029-adwaita-icon-theme_43-1_all.deb ... Unpacking adwaita-icon-theme (43-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../030-ca-certificates-java_20230103_all.deb ... Unpacking ca-certificates-java (20230103) ... Selecting previously unselected package java-common. Preparing to unpack .../031-java-common_0.74_all.deb ... Unpacking java-common (0.74) ... Selecting previously unselected package libavahi-common-data:i386. Preparing to unpack .../032-libavahi-common-data_0.8-10_i386.deb ... Unpacking libavahi-common-data:i386 (0.8-10) ... Selecting previously unselected package libavahi-common3:i386. Preparing to unpack .../033-libavahi-common3_0.8-10_i386.deb ... Unpacking libavahi-common3:i386 (0.8-10) ... Selecting previously unselected package libdbus-1-3:i386. Preparing to unpack .../034-libdbus-1-3_1.14.6-1_i386.deb ... Unpacking libdbus-1-3:i386 (1.14.6-1) ... Selecting previously unselected package libavahi-client3:i386. Preparing to unpack .../035-libavahi-client3_0.8-10_i386.deb ... Unpacking libavahi-client3:i386 (0.8-10) ... Selecting previously unselected package libcups2:i386. Preparing to unpack .../036-libcups2_2.4.2-3_i386.deb ... Unpacking libcups2:i386 (2.4.2-3) ... Selecting previously unselected package liblcms2-2:i386. Preparing to unpack .../037-liblcms2-2_2.14-2_i386.deb ... Unpacking liblcms2-2:i386 (2.14-2) ... Selecting previously unselected package libbrotli1:i386. Preparing to unpack .../038-libbrotli1_1.0.9-2+b6_i386.deb ... Unpacking libbrotli1:i386 (1.0.9-2+b6) ... Selecting previously unselected package libfreetype6:i386. Preparing to unpack .../039-libfreetype6_2.12.1+dfsg-5_i386.deb ... Unpacking libfreetype6:i386 (2.12.1+dfsg-5) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-6_all.deb ... Unpacking fonts-dejavu-core (2.37-6) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.14.1-4_i386.deb ... Unpacking fontconfig-config (2.14.1-4) ... Selecting previously unselected package libfontconfig1:i386. Preparing to unpack .../042-libfontconfig1_2.14.1-4_i386.deb ... Unpacking libfontconfig1:i386 (2.14.1-4) ... Selecting previously unselected package libnspr4:i386. Preparing to unpack .../043-libnspr4_2%3a4.35-1_i386.deb ... Unpacking libnspr4:i386 (2:4.35-1) ... Selecting previously unselected package libnss3:i386. Preparing to unpack .../044-libnss3_2%3a3.87.1-1_i386.deb ... Unpacking libnss3:i386 (2:3.87.1-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.8-1_all.deb ... Unpacking libasound2-data (1.2.8-1) ... Selecting previously unselected package libasound2:i386. Preparing to unpack .../046-libasound2_1.2.8-1+b1_i386.deb ... Unpacking libasound2:i386 (1.2.8-1+b1) ... Selecting previously unselected package libgraphite2-3:i386. Preparing to unpack .../047-libgraphite2-3_1.3.14-1_i386.deb ... Unpacking libgraphite2-3:i386 (1.3.14-1) ... Selecting previously unselected package libharfbuzz0b:i386. Preparing to unpack .../048-libharfbuzz0b_6.0.0+dfsg-3_i386.deb ... Unpacking libharfbuzz0b:i386 (6.0.0+dfsg-3) ... Selecting previously unselected package libpcsclite1:i386. Preparing to unpack .../049-libpcsclite1_1.9.9-2_i386.deb ... Unpacking libpcsclite1:i386 (1.9.9-2) ... Selecting previously unselected package openjdk-17-jre-headless:i386. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jre-headless:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-74_i386.deb ... Unpacking default-jre-headless (2:1.17-74) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.13-1_all.deb ... Unpacking ant (1.10.13-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.13-1_all.deb ... Unpacking ant-optional (1.10.13-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-12_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-12) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-12_all.deb ... Unpacking antlr (2.7.7+dfsg-12) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.46.0-5_all.deb ... Unpacking at-spi2-common (2.46.0-5) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-3_i386.deb ... Unpacking m4 (1.4.19-3) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-12_all.deb ... Unpacking autopoint (0.21-12) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_i386.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-1_all.deb ... Unpacking libhamcrest-java (2.2-1) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-3_all.deb ... Unpacking junit4 (4.13.2-3) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-1_all.deb ... Unpacking libjansi-native-java (1.8-1) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-3_all.deb ... Unpacking bnd (5.0.1-3) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3_i386.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.11.4_all.deb ... Unpacking libdebhelper-perl (13.11.4) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-5_all.deb ... Unpacking libtool (2.4.7-5) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.09-4_all.deb ... Unpacking libsub-override-perl (0.09-4) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:i386. Preparing to unpack .../088-libelf1_0.188-2.1_i386.deb ... Unpacking libelf1:i386 (0.188-2.1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_i386.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-12_i386.deb ... Unpacking gettext (0.21-12) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.11.4_all.deb ... Unpacking debhelper (13.11.4) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-2_all.deb ... Unpacking libgtk2.0-common (2.24.33-2) ... Selecting previously unselected package libatk1.0-0:i386. Preparing to unpack .../095-libatk1.0-0_2.46.0-5_i386.deb ... Unpacking libatk1.0-0:i386 (2.46.0-5) ... Selecting previously unselected package libpixman-1-0:i386. Preparing to unpack .../096-libpixman-1-0_0.42.2-1_i386.deb ... Unpacking libpixman-1-0:i386 (0.42.2-1) ... Selecting previously unselected package libxau6:i386. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_i386.deb ... Unpacking libxau6:i386 (1:1.0.9-1) ... Selecting previously unselected package libbsd0:i386. Preparing to unpack .../098-libbsd0_0.11.7-2_i386.deb ... Unpacking libbsd0:i386 (0.11.7-2) ... Selecting previously unselected package libxdmcp6:i386. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_i386.deb ... Unpacking libxdmcp6:i386 (1:1.1.2-3) ... Selecting previously unselected package libxcb1:i386. Preparing to unpack .../100-libxcb1_1.15-1_i386.deb ... Unpacking libxcb1:i386 (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.4-2_all.deb ... Unpacking libx11-data (2:1.8.4-2) ... Selecting previously unselected package libx11-6:i386. Preparing to unpack .../102-libx11-6_2%3a1.8.4-2_i386.deb ... Unpacking libx11-6:i386 (2:1.8.4-2) ... Selecting previously unselected package libxcb-render0:i386. Preparing to unpack .../103-libxcb-render0_1.15-1_i386.deb ... Unpacking libxcb-render0:i386 (1.15-1) ... Selecting previously unselected package libxcb-shm0:i386. Preparing to unpack .../104-libxcb-shm0_1.15-1_i386.deb ... Unpacking libxcb-shm0:i386 (1.15-1) ... Selecting previously unselected package libxext6:i386. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_i386.deb ... Unpacking libxext6:i386 (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:i386. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_i386.deb ... Unpacking libxrender1:i386 (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:i386. Preparing to unpack .../107-libcairo2_1.16.0-7_i386.deb ... Unpacking libcairo2:i386 (1.16.0-7) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.14.1-4_i386.deb ... Unpacking fontconfig (2.14.1-4) ... Selecting previously unselected package libfribidi0:i386. Preparing to unpack .../109-libfribidi0_1.0.8-2.1_i386.deb ... Unpacking libfribidi0:i386 (1.0.8-2.1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-1_all.deb ... Unpacking libthai-data (0.1.29-1) ... Selecting previously unselected package libdatrie1:i386. Preparing to unpack .../111-libdatrie1_0.2.13-2+b1_i386.deb ... Unpacking libdatrie1:i386 (0.2.13-2+b1) ... Selecting previously unselected package libthai0:i386. Preparing to unpack .../112-libthai0_0.1.29-1_i386.deb ... Unpacking libthai0:i386 (0.1.29-1) ... Selecting previously unselected package libpango-1.0-0:i386. Preparing to unpack .../113-libpango-1.0-0_1.50.12+ds-1_i386.deb ... Unpacking libpango-1.0-0:i386 (1.50.12+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:i386. Preparing to unpack .../114-libpangoft2-1.0-0_1.50.12+ds-1_i386.deb ... Unpacking libpangoft2-1.0-0:i386 (1.50.12+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:i386. Preparing to unpack .../115-libpangocairo-1.0-0_1.50.12+ds-1_i386.deb ... Unpacking libpangocairo-1.0-0:i386 (1.50.12+ds-1) ... Selecting previously unselected package libxcomposite1:i386. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_i386.deb ... Unpacking libxcomposite1:i386 (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:i386. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_i386.deb ... Unpacking libxfixes3:i386 (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:i386. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_i386.deb ... Unpacking libxcursor1:i386 (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:i386. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_i386.deb ... Unpacking libxdamage1:i386 (1:1.1.6-1) ... Selecting previously unselected package libxi6:i386. Preparing to unpack .../120-libxi6_2%3a1.8-1+b1_i386.deb ... Unpacking libxi6:i386 (2:1.8-1+b1) ... Selecting previously unselected package libxinerama1:i386. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_i386.deb ... Unpacking libxinerama1:i386 (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:i386. Preparing to unpack .../122-libxrandr2_2%3a1.5.2-2+b1_i386.deb ... Unpacking libxrandr2:i386 (2:1.5.2-2+b1) ... Selecting previously unselected package libgtk2.0-0:i386. Preparing to unpack .../123-libgtk2.0-0_2.24.33-2_i386.deb ... Unpacking libgtk2.0-0:i386 (2.24.33-2) ... Selecting previously unselected package libglvnd0:i386. Preparing to unpack .../124-libglvnd0_1.6.0-1_i386.deb ... Unpacking libglvnd0:i386 (1.6.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.114-1_all.deb ... Unpacking libdrm-common (2.4.114-1) ... Selecting previously unselected package libdrm2:i386. Preparing to unpack .../126-libdrm2_2.4.114-1+b1_i386.deb ... Unpacking libdrm2:i386 (2.4.114-1+b1) ... Selecting previously unselected package libglapi-mesa:i386. Preparing to unpack .../127-libglapi-mesa_22.3.6-1+deb12u1_i386.deb ... Unpacking libglapi-mesa:i386 (22.3.6-1+deb12u1) ... Selecting previously unselected package libx11-xcb1:i386. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.4-2_i386.deb ... Unpacking libx11-xcb1:i386 (2:1.8.4-2) ... Selecting previously unselected package libxcb-dri2-0:i386. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_i386.deb ... Unpacking libxcb-dri2-0:i386 (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:i386. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_i386.deb ... Unpacking libxcb-dri3-0:i386 (1.15-1) ... Selecting previously unselected package libxcb-glx0:i386. Preparing to unpack .../131-libxcb-glx0_1.15-1_i386.deb ... Unpacking libxcb-glx0:i386 (1.15-1) ... Selecting previously unselected package libxcb-present0:i386. Preparing to unpack .../132-libxcb-present0_1.15-1_i386.deb ... Unpacking libxcb-present0:i386 (1.15-1) ... Selecting previously unselected package libxcb-randr0:i386. Preparing to unpack .../133-libxcb-randr0_1.15-1_i386.deb ... Unpacking libxcb-randr0:i386 (1.15-1) ... Selecting previously unselected package libxcb-sync1:i386. Preparing to unpack .../134-libxcb-sync1_1.15-1_i386.deb ... Unpacking libxcb-sync1:i386 (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:i386. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_i386.deb ... Unpacking libxcb-xfixes0:i386 (1.15-1) ... Selecting previously unselected package libxshmfence1:i386. Preparing to unpack .../136-libxshmfence1_1.3-1_i386.deb ... Unpacking libxshmfence1:i386 (1.3-1) ... Selecting previously unselected package libxxf86vm1:i386. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_i386.deb ... Unpacking libxxf86vm1:i386 (1:1.1.4-1+b2) ... Selecting previously unselected package libdrm-amdgpu1:i386. Preparing to unpack .../138-libdrm-amdgpu1_2.4.114-1+b1_i386.deb ... Unpacking libdrm-amdgpu1:i386 (2.4.114-1+b1) ... Selecting previously unselected package libpciaccess0:i386. Preparing to unpack .../139-libpciaccess0_0.17-2_i386.deb ... Unpacking libpciaccess0:i386 (0.17-2) ... Selecting previously unselected package libdrm-intel1:i386. Preparing to unpack .../140-libdrm-intel1_2.4.114-1+b1_i386.deb ... Unpacking libdrm-intel1:i386 (2.4.114-1+b1) ... Selecting previously unselected package libdrm-nouveau2:i386. Preparing to unpack .../141-libdrm-nouveau2_2.4.114-1+b1_i386.deb ... Unpacking libdrm-nouveau2:i386 (2.4.114-1+b1) ... Selecting previously unselected package libdrm-radeon1:i386. Preparing to unpack .../142-libdrm-radeon1_2.4.114-1+b1_i386.deb ... Unpacking libdrm-radeon1:i386 (2.4.114-1+b1) ... Selecting previously unselected package libedit2:i386. Preparing to unpack .../143-libedit2_3.1-20221030-2_i386.deb ... Unpacking libedit2:i386 (3.1-20221030-2) ... Selecting previously unselected package libz3-4:i386. Preparing to unpack .../144-libz3-4_4.8.12-3.1_i386.deb ... Unpacking libz3-4:i386 (4.8.12-3.1) ... Selecting previously unselected package libllvm15:i386. Preparing to unpack .../145-libllvm15_1%3a15.0.6-4+b1_i386.deb ... Unpacking libllvm15:i386 (1:15.0.6-4+b1) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../146-libsensors-config_1%3a3.6.0-7.1_all.deb ... Unpacking libsensors-config (1:3.6.0-7.1) ... Selecting previously unselected package libsensors5:i386. Preparing to unpack .../147-libsensors5_1%3a3.6.0-7.1_i386.deb ... Unpacking libsensors5:i386 (1:3.6.0-7.1) ... Selecting previously unselected package libgl1-mesa-dri:i386. Preparing to unpack .../148-libgl1-mesa-dri_22.3.6-1+deb12u1_i386.deb ... Unpacking libgl1-mesa-dri:i386 (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx-mesa0:i386. Preparing to unpack .../149-libglx-mesa0_22.3.6-1+deb12u1_i386.deb ... Unpacking libglx-mesa0:i386 (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx0:i386. Preparing to unpack .../150-libglx0_1.6.0-1_i386.deb ... Unpacking libglx0:i386 (1.6.0-1) ... Selecting previously unselected package libgl1:i386. Preparing to unpack .../151-libgl1_1.6.0-1_i386.deb ... Unpacking libgl1:i386 (1.6.0-1) ... Selecting previously unselected package libgif7:i386. Preparing to unpack .../152-libgif7_5.2.1-2.5_i386.deb ... Unpacking libgif7:i386 (5.2.1-2.5) ... Selecting previously unselected package x11-common. Preparing to unpack .../153-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:i386. Preparing to unpack .../154-libxtst6_2%3a1.2.3-1.1_i386.deb ... Unpacking libxtst6:i386 (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:i386. Preparing to unpack .../155-openjdk-17-jre_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jre:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../156-default-jre_2%3a1.17-74_i386.deb ... Unpacking default-jre (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk-headless:i386. Preparing to unpack .../157-openjdk-17-jdk-headless_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jdk-headless:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../158-default-jdk-headless_2%3a1.17-74_i386.deb ... Unpacking default-jdk-headless (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk:i386. Preparing to unpack .../159-openjdk-17-jdk_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jdk:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../160-default-jdk_2%3a1.17-74_i386.deb ... Unpacking default-jdk (2:1.17-74) ... Selecting previously unselected package libassuan0:i386. Preparing to unpack .../161-libassuan0_2.5.5-5_i386.deb ... Unpacking libassuan0:i386 (2.5.5-5) ... Selecting previously unselected package gpgconf. Preparing to unpack .../162-gpgconf_2.2.40-1.1_i386.deb ... Unpacking gpgconf (2.2.40-1.1) ... Selecting previously unselected package libksba8:i386. Preparing to unpack .../163-libksba8_1.6.3-2_i386.deb ... Unpacking libksba8:i386 (1.6.3-2) ... Selecting previously unselected package libsasl2-modules-db:i386. Preparing to unpack .../164-libsasl2-modules-db_2.1.28+dfsg-10_i386.deb ... Unpacking libsasl2-modules-db:i386 (2.1.28+dfsg-10) ... Selecting previously unselected package libsasl2-2:i386. Preparing to unpack .../165-libsasl2-2_2.1.28+dfsg-10_i386.deb ... Unpacking libsasl2-2:i386 (2.1.28+dfsg-10) ... Selecting previously unselected package libldap-2.5-0:i386. Preparing to unpack .../166-libldap-2.5-0_2.5.13+dfsg-5_i386.deb ... Unpacking libldap-2.5-0:i386 (2.5.13+dfsg-5) ... Selecting previously unselected package libnpth0:i386. Preparing to unpack .../167-libnpth0_1.6-3_i386.deb ... Unpacking libnpth0:i386 (1.6-3) ... Selecting previously unselected package dirmngr. Preparing to unpack .../168-dirmngr_2.2.40-1.1_i386.deb ... Unpacking dirmngr (2.2.40-1.1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../169-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../170-gnupg-utils_2.2.40-1.1_i386.deb ... Unpacking gnupg-utils (2.2.40-1.1) ... Selecting previously unselected package gpg. Preparing to unpack .../171-gpg_2.2.40-1.1_i386.deb ... Unpacking gpg (2.2.40-1.1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../172-pinentry-curses_1.2.1-1_i386.deb ... Unpacking pinentry-curses (1.2.1-1) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../173-gpg-agent_2.2.40-1.1_i386.deb ... Unpacking gpg-agent (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../174-gpg-wks-client_2.2.40-1.1_i386.deb ... Unpacking gpg-wks-client (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../175-gpg-wks-server_2.2.40-1.1_i386.deb ... Unpacking gpg-wks-server (2.2.40-1.1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../176-gpgsm_2.2.40-1.1_i386.deb ... Unpacking gpgsm (2.2.40-1.1) ... Selecting previously unselected package gnupg. Preparing to unpack .../177-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../178-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../179-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../180-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../181-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../182-libio-pty-perl_1%3a1.17-1_i386.deb ... Unpacking libio-pty-perl (1:1.17-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../183-libipc-run-perl_20220807.0-1_all.deb ... Unpacking libipc-run-perl (20220807.0-1) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../184-libclass-method-modifiers-perl_2.14-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.14-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../185-libclass-xsaccessor-perl_1.19-4+b1_i386.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b1) ... Selecting previously unselected package libb-hooks-op-check-perl:i386. Preparing to unpack .../186-libb-hooks-op-check-perl_0.22-2+b1_i386.deb ... Unpacking libb-hooks-op-check-perl:i386 (0.22-2+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../187-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:i386. Preparing to unpack .../188-libdevel-callchecker-perl_0.008-2_i386.deb ... Unpacking libdevel-callchecker-perl:i386 (0.008-2) ... Selecting previously unselected package libparams-classify-perl:i386. Preparing to unpack .../189-libparams-classify-perl_0.015-2+b1_i386.deb ... Unpacking libparams-classify-perl:i386 (0.015-2+b1) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../190-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../191-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../192-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../193-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../194-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../195-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../196-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../197-libhttp-date-perl_6.05-2_all.deb ... Unpacking libhttp-date-perl (6.05-2) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../198-libfile-listing-perl_6.15-1_all.deb ... Unpacking libfile-listing-perl (6.15-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../199-libhtml-tagset-perl_3.20-6_all.deb ... Unpacking libhtml-tagset-perl (3.20-6) ... Selecting previously unselected package libregexp-ipv6-perl. Preparing to unpack .../200-libregexp-ipv6-perl_0.03-3_all.deb ... Unpacking libregexp-ipv6-perl (0.03-3) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../201-liburi-perl_5.17-1_all.deb ... Unpacking liburi-perl (5.17-1) ... Selecting previously unselected package libhtml-parser-perl:i386. Preparing to unpack .../202-libhtml-parser-perl_3.81-1_i386.deb ... Unpacking libhtml-parser-perl:i386 (3.81-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../203-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:i386. Preparing to unpack .../204-libclone-perl_0.46-1_i386.deb ... Unpacking libclone-perl:i386 (0.46-1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../205-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../206-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../207-libhttp-message-perl_6.44-1_all.deb ... Unpacking libhttp-message-perl (6.44-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../208-libhttp-cookies-perl_6.10-1_all.deb ... Unpacking libhttp-cookies-perl (6.10-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../209-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:i386. Preparing to unpack .../210-perl-openssl-defaults_7+b1_i386.deb ... Unpacking perl-openssl-defaults:i386 (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:i386. Preparing to unpack .../211-libnet-ssleay-perl_1.92-2+b1_i386.deb ... Unpacking libnet-ssleay-perl:i386 (1.92-2+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../212-libio-socket-ssl-perl_2.081-2_all.deb ... Unpacking libio-socket-ssl-perl (2.081-2) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../213-libnet-http-perl_6.22-1_all.deb ... Unpacking libnet-http-perl (6.22-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../214-liblwp-protocol-https-perl_6.10-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.10-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../215-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../216-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../217-libwww-perl_6.68-1_all.deb ... Unpacking libwww-perl (6.68-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../218-patchutils_0.4.2-1_i386.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../219-wdiff_1.2.2-5_i386.deb ... Unpacking wdiff (1.2.2-5) ... Selecting previously unselected package devscripts. Preparing to unpack .../220-devscripts_2.23.3_i386.deb ... Unpacking devscripts (2.23.3) ... Selecting previously unselected package ivy. Preparing to unpack .../221-ivy_2.5.1-2_all.deb ... Unpacking ivy (2.5.1-2) ... Selecting previously unselected package libasm-java. Preparing to unpack .../222-libasm-java_9.4-1_all.deb ... Unpacking libasm-java (9.4-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../223-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../224-libcommons-cli-java_1.5.0-1_all.deb ... Unpacking libcommons-cli-java (1.5.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../225-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../226-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../227-libcommons-logging-java_1.2-3_all.deb ... Unpacking libcommons-logging-java (1.2-3) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../228-libjansi-java_2.4.0-2_all.deb ... Unpacking libjansi-java (2.4.0-2) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../229-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../230-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../231-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../232-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../233-groovy_2.4.21-7_all.deb ... Unpacking groovy (2.4.21-7) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../234-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../235-libcommons-collections3-java_3.2.2-2_all.deb ... Unpacking libcommons-collections3-java (3.2.2-2) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../236-libcommons-compress-java_1.22-1_all.deb ... Unpacking libcommons-compress-java (1.22-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../237-libcommons-io-java_2.11.0-2_all.deb ... Unpacking libcommons-io-java (2.11.0-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../238-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../239-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../240-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../241-libguava-java_31.1-1_all.deb ... Unpacking libguava-java (31.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../242-libcommons-codec-java_1.15-1_all.deb ... Unpacking libcommons-codec-java (1.15-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../243-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../244-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../245-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../246-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../247-libjna-jni_5.13.0-2_i386.deb ... Unpacking libjna-jni (5.13.0-2) ... Selecting previously unselected package libjna-java. Preparing to unpack .../248-libjna-java_5.13.0-2_all.deb ... Unpacking libjna-java (5.13.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../249-libjzlib-java_1.1.3-2_all.deb ... Unpacking libjzlib-java (1.1.3-2) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../250-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../251-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../252-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../253-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../254-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../255-liblogback-java_1%3a1.2.11-2_all.deb ... Unpacking liblogback-java (1:1.2.11-2) ... Selecting previously unselected package libncurses6:i386. Preparing to unpack .../256-libncurses6_6.4-2_i386.deb ... Unpacking libncurses6:i386 (6.4-2) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../257-libnative-platform-jni_0.14-5_i386.deb ... Unpacking libnative-platform-jni (0.14-5) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../258-libnative-platform-java_0.14-5_all.deb ... Unpacking libnative-platform-java (0.14-5) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../259-libxml-commons-external-java_1.4.01-5_all.deb ... Unpacking libxml-commons-external-java (1.4.01-5) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../260-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../261-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../262-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../263-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../264-libgradle-core-java_4.4.1-18_all.deb ... Unpacking libgradle-core-java (4.4.1-18) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../265-libbcprov-java_1.72-2_all.deb ... Unpacking libbcprov-java (1.72-2) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../266-libbcpg-java_1.72-2_all.deb ... Unpacking libbcpg-java (1.72-2) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../267-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../268-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../269-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../270-libdom4j-java_2.1.3-2_all.deb ... Unpacking libdom4j-java (2.1.3-2) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../271-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../272-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../273-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../274-libgoogle-gson-java_2.10-1_all.deb ... Unpacking libgoogle-gson-java (2.10-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../275-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../276-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../277-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../278-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../279-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../280-libjavaewah-java_1.1.7-1_all.deb ... Unpacking libjavaewah-java (1.1.7-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../281-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../282-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../283-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../284-libjetty9-java_9.4.50-3_all.deb ... Unpacking libjetty9-java (9.4.50-3) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../285-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../286-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../287-libcommons-lang3-java_3.12.0-2_all.deb ... Unpacking libcommons-lang3-java (3.12.0-2) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../288-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../289-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../290-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../291-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../292-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../293-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../294-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../295-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../296-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../297-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../298-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../299-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../300-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../301-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../302-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../303-libmaven3-core-java_3.8.7-1_all.deb ... Unpacking libmaven3-core-java (3.8.7-1) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../304-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../305-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../306-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../307-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../308-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../309-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../310-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../311-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../312-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../313-libgradle-plugins-java_4.4.1-18_all.deb ... Unpacking libgradle-plugins-java (4.4.1-18) ... Selecting previously unselected package gradle. Preparing to unpack .../314-gradle_4.4.1-18_all.deb ... Unpacking gradle (4.4.1-18) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../315-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../316-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package javahelper. Preparing to unpack .../317-javahelper_0.78_all.deb ... Unpacking javahelper (0.78) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../318-libbyte-buddy-java_1.12.21-1_all.deb ... Unpacking libbyte-buddy-java (1.12.21-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../319-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../320-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../321-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../322-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../323-liblz4-jni_1.8.0-3_i386.deb ... Unpacking liblz4-jni (1.8.0-3) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../324-liblz4-java_1.8.0-3_all.deb ... Unpacking liblz4-java (1.8.0-3) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../325-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../326-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../327-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.72-2) ... Setting up libksba8:i386 (1.6.3-2) ... Setting up media-types (10.0.0) ... Setting up libpipeline1:i386 (1.5.7-1) ... Setting up libgraphite2-3:i386 (1.3.14-1) ... Setting up liblcms2-2:i386 (2.14-2) ... Setting up libpixman-1-0:i386 (0.42.2-1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-5) ... Setting up libpciaccess0:i386 (0.17-2) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:i386 (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:i386 (72.1-3) ... Setting up liblerc4:i386 (4.0.0+ds-2) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.38.1-5+b1) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.74) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:i386 (0.2.13-2+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.14-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.5.0-1) ... Setting up libio-pty-perl (1:1.17-1) ... Setting up libmagic-mgc (1:5.44-3) ... Setting up liblogback-java (1:1.2.11-2) ... Setting up libclone-perl:i386 (0.46-1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:i386 (2.74.6-2) ... No schema files found: doing nothing. Setting up libglvnd0:i386 (1.6.0-1) ... Setting up libgoogle-gson-java (2.10-1) ... Setting up libhtml-tagset-perl (3.20-6) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.11.4) ... Setting up libbrotli1:i386 (1.0.9-2+b6) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Setting up libasm-java (9.4-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-7.1) ... Setting up libmagic1:i386 (1:5.44-3) ... Setting up libdeflate0:i386 (1.14-1) ... Setting up perl-openssl-defaults:i386 (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-12) ... Setting up m4 (1.4.19-3) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:i386 (1.6-3) ... Setting up file (1:5.44-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:i386 (2.5.5-5) ... Setting up libjzlib-java (1.1.3-2) ... Setting up libjbig0:i386 (2.1-6.1) ... Setting up libsasl2-modules-db:i386 (2.1.28+dfsg-10) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-2) ... Setting up libasound2-data (1.2.8-1) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:i386 (4.8.12-3.1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.1.7-1) ... Setting up libjpeg62-turbo:i386 (1:2.1.5-2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.4-2) ... Setting up libnspr4:i386 (2:4.35-1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.0-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:i386 (0.8-10) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libncurses6:i386 (6.4-2) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:i386 (1.14.6-1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:i386 (1.0.8-2.1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up libpng16-16:i386 (1.6.39-2) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.13.0-2) ... Setting up autopoint (0.21-12) ... Setting up libb-hooks-op-check-perl:i386 (0.22-2+b1) ... Setting up fonts-dejavu-core (2.37-6) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20220807.0-1) ... Setting up libpcsclite1:i386 (1.9.9-2) ... Setting up libsensors5:i386 (1:3.6.0-7.1) ... Setting up libhamcrest-java (2.2-1) ... Setting up libglapi-mesa:i386 (22.3.6-1+deb12u1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:i386 (2.1.28+dfsg-10) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:i386 (1.2.4-0.1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libregexp-ipv6-perl (0.03-3) ... Setting up libgif7:i386 (5.2.1-2.5) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.17+nmu1) ... Setting up libxshmfence1:i386 (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.46.0-5) ... Setting up libtiff6:i386 (4.5.0-5) ... Setting up libuchardet0:i386 (0.0.7-1) ... Setting up libxml-commons-external-java (1.4.01-5) ... Setting up libjna-java (5.13.0-2) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:i386 (1.2.8-1+b1) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.09-4) ... Setting up libthai-data (0.1.29-1) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-5) ... Setting up libclass-xsaccessor-perl (1.19-4+b1) ... Setting up libgtk2.0-common (2.24.33-2) ... Setting up libatk1.0-0:i386 (2.46.0-5) ... Setting up liblz4-jni (1.8.0-3) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.72-2) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-12) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.0.8-1) ... Setting up libbsd0:i386 (0.11.7-2) ... Setting up libdrm-common (2.4.114-1) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:i386 (0.188-2.1) ... Setting up readline-common (8.2-1.3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:i386 (2.9.14+dfsg-1.2) ... Setting up liburi-perl (5.17-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:i386 (1.92-2+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-1) ... Setting up libdom4j-java (2.1.3-2) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-5) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.05-2) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:i386 (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-3) ... Setting up libxcb1:i386 (1.15-1) ... Setting up gettext (0.21-12) ... Setting up libjetty9-java (9.4.50-3) ... Setting up libxcb-xfixes0:i386 (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.15-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libtool (2.4.7-5) ... Setting up libxcb-render0:i386 (1.15-1) ... Setting up fontconfig-config (2.14.1-4) ... Setting up libxcb-glx0:i386 (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:i386 (3.1-20221030-2) ... Setting up libreadline8:i386 (8.2-1.3) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:i386 (0.8-10) ... Setting up libcommons-logging-java (1.2-3) ... Setting up libnet-http-perl (6.22-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:i386 (2:3.87.1-1) ... Setting up libxcb-shm0:i386 (1.15-1) ... Setting up libdevel-callchecker-perl:i386 (0.008-2) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:i386 (2.5.13+dfsg-5) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:i386 (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:i386 (0.1.29-1) ... Setting up ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 140 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:i386 (2.12.1+dfsg-5) ... Setting up libxcb-sync1:i386 (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.2-1) ... Setting up libcommons-lang3-java (3.12.0-2) ... Setting up libxcb-dri2-0:i386 (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:i386 (2.4.114-1+b1) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-1) ... Setting up groff-base (1.22.4-10) ... Setting up libxcb-randr0:i386 (1.15-1) ... Setting up libhtml-parser-perl:i386 (3.81-1) ... Setting up libllvm15:i386 (1:15.0.6-4+b1) ... Setting up gpgconf (2.2.40-1.1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:i386 (2:1.8.4-2) ... Setting up libharfbuzz0b:i386 (6.0.0+dfsg-3) ... Setting up libgdk-pixbuf-2.0-0:i386 (2.42.10+dfsg-1+b1) ... Setting up libfontconfig1:i386 (2.14.1-4) ... Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.15-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libxcomposite1:i386 (1:0.4.5-1) ... Setting up libavahi-client3:i386 (0.8-10) ... Setting up libio-socket-ssl-perl (2.081-2) ... Setting up gpg (2.2.40-1.1) ... Setting up gnupg-utils (2.2.40-1.1) ... Setting up libhttp-message-perl (6.44-1) ... Setting up libdrm-amdgpu1:i386 (2.4.114-1+b1) ... Setting up libxcb-dri3-0:i386 (1.15-1) ... Setting up gtk-update-icon-cache (3.24.37-2) ... Setting up libx11-xcb1:i386 (2:1.8.4-2) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.14.1-4) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:i386 (2.4.114-1+b1) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:i386 (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1) ... Setting up libxrender1:i386 (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.22-1) ... Setting up libhttp-cookies-perl (6.10-1) ... Setting up libcommons-io-java (2.11.0-2) ... Setting up libdrm-radeon1:i386 (2.4.114-1+b1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:i386 (3.11.2-6) ... Setting up libparams-classify-perl:i386 (0.015-2+b1) ... Setting up gpgsm (2.2.40-1.1) ... Setting up libpango-1.0-0:i386 (1.50.12+ds-1) ... Setting up libdrm-intel1:i386 (2.4.114-1+b1) ... Setting up libgl1-mesa-dri:i386 (22.3.6-1+deb12u1) ... Setting up libxext6:i386 (2:1.3.4-1+b1) ... Setting up man-db (2.11.2-2) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:i386 (1.16.0-7) ... Setting up libxxf86vm1:i386 (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (43-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:i386 (1:6.0.0-2) ... Setting up libxinerama1:i386 (2:1.1.4-3) ... Setting up libxrandr2:i386 (2:1.5.2-2+b1) ... Setting up gpg-wks-server (2.2.40-1.1) ... Setting up libcups2:i386 (2.4.2-3) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:i386 (1.50.12+ds-1) ... Setting up libpangocairo-1.0-0:i386 (1.50.12+ds-1) ... Setting up libpython3-stdlib:i386 (3.11.2-1+b1) ... Setting up python3.11 (3.11.2-6) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:i386 (22.3.6-1+deb12u1) ... Setting up libxi6:i386 (2:1.8-1+b1) ... Setting up gpg-wks-client (2.2.40-1.1) ... Setting up libglx0:i386 (1.6.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:i386 (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:i386 (1:1.2.1-1) ... Setting up debhelper (13.11.4) ... Setting up python3 (3.11.2-1+b1) ... Setting up libgl1:i386 (1.6.0-1) ... Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:i386 (2.24.33-2) ... Setting up openjdk-17-jre-headless:i386 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up ca-certificates-java (20230103) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068_2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:E-Tugra_Certification_Authority.pem Adding debian:E-Tugra_Global_Root_CA_ECC_v3.pem Adding debian:E-Tugra_Global_Root_CA_RSA_v3.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustCor_ECA-1.pem Adding debian:TrustCor_RootCert_CA-1.pem Adding debian:TrustCor_RootCert_CA-2.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up junit4 (4.13.2-3) ... Setting up liblwp-protocol-https-perl (6.10-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up default-jre-headless (2:1.17-74) ... Setting up libwww-perl (6.68-1) ... Setting up openjdk-17-jre:i386 (17.0.6+10-1) ... Setting up maven-repo-helper (1.11) ... Setting up default-jre (2:1.17-74) ... Setting up antlr (2.7.7+dfsg-12) ... Setting up bnd (5.0.1-3) ... Setting up devscripts (2.23.3) ... Setting up libguava-java (31.1-1) ... Setting up openjdk-17-jdk-headless:i386 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.1-2) ... Setting up ant (1.10.13-1) ... Setting up javahelper (0.78) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up groovy (2.4.21-7) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up openjdk-17-jdk:i386 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up libguice-java (4.2.3-2) ... Setting up ant-optional (1.10.13-1) ... Setting up default-jdk-headless (2:1.17-74) ... Setting up libgradle-core-java (4.4.1-18) ... Setting up libmaven3-core-java (3.8.7-1) ... Setting up default-jdk (2:1.17-74) ... Setting up libgradle-plugins-java (4.4.1-18) ... Setting up gradle (4.4.1-18) ... Setting up libbyte-buddy-java (1.12.21-1) ... Setting up libmockito-java (2.23.0-2) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for libc-bin (2.36-9) ... Processing triggers for ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20230103) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps Reading package lists... Building dependency tree... Reading state information... usrmerge is already the newest version (35). 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. I: Building the package I: user script /srv/workspace/pbuilder/70124/tmp/hooks/A99_set_merged_usr starting Re-configuring usrmerge... removed '/etc/unsupported-skip-usrmerge-conversion' The system has been successfully converted. I: user script /srv/workspace/pbuilder/70124/tmp/hooks/A99_set_merged_usr finished hostname: Name or service not known I: Running cd /build/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture i386 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=15 jar openjdk version "17.0.6" 2023-01-17 OpenJDK Runtime Environment (build 17.0.6+10-Debian-1) OpenJDK Server VM (build 17.0.6+10-Debian-1, mixed mode, sharing) Initialized native services in: /build/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-i386/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 0.757 secs. The client will now receive all logging from the daemon (pid: 78628). The daemon log file: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-78628.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 15 worker leases. Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@8bd73f Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@8bd73f Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@137ecc7 Starting Build Compiling initialization script '/build/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@1fcc131 Compiling initialization script '/build/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@108ce3b Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@137ecc7 Creating new cache for taskHistory, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@1921dc4 Creating new cache for outputFiles, path /build/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1fea808 :compileJava (Thread[Task worker for ':' Thread 3,5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.005 secs. Creating new cache for metadata-2.36/module-metadata, path /build/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@13c3aaa Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:833) Up-to-date check for task ':compileJava' took 2.96 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 10.451 secs. :processResources (Thread[Task worker for ':' Thread 3,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.007 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 0.034 secs. :classes (Thread[Task worker for ':' Thread 3,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 0.0 secs. :debianMavenPom (Thread[Task worker for ':' Thread 3,5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.0 secs. It is not up-to-date because: No history is available. Generating pom file /build/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 0.108 secs. :jar (Thread[Task worker for ':' Thread 3,5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.02 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 0.282 secs. BUILD SUCCESSFUL in 15s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=15 test openjdk version "17.0.6" 2023-01-17 OpenJDK Runtime Environment (build 17.0.6+10-Debian-1) OpenJDK Server VM (build 17.0.6+10-Debian-1, mixed mode, sharing) Initialized native services in: /build/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-i386/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 0.95 secs. The client will now receive all logging from the daemon (pid: 78862). The daemon log file: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-78862.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 15 worker leases. Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1b766ce Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1b766ce Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@885573 Starting Build Creating new cache for metadata-1.1/results, path /build/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@1a6c29a Settings evaluated using settings file '/build/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@859883 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@885573 Creating new cache for taskHistory, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@b647ac Creating new cache for outputFiles, path /build/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@170e412 :compileJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.004 secs. Creating new cache for metadata-2.36/module-metadata, path /build/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@793ad8 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 0.686 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.724 secs. :processResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.007 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.01 secs. :classes (Thread[Task worker for ':' Thread 2,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.0 secs. :compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 2.263 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 7.376 secs. :processTestResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.02 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.053 secs. :testClasses (Thread[Task worker for ':' Thread 2,5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.0 secs. :test (Thread[Task worker for ':' Thread 2,5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 1.053 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-i386/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath17306798054303730323txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_918c981f7385657e0152bedbf50a26829be9b9945220613856975342152 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_851cb80d4f35a6f8bf3f6842ec2989a8dc6cf8873619495949526892089.tmp com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 196ns Addition to hash set (per operation): 628ns Hash set removal (per operation): 470ns a com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_f1b3ca3508c382d53d5686d32c446ae2a94b0be33709873720331210646 timeInCollate: 7.73s timeInCollatorInit: 5.36s timeAwaitingO: 4.13ms timeAwaitingI: 821.93ms timeInFinalSorting1: 0ns timeInFinalSorting2: 34.78ms timeInFinalSorting3: 54.61ms /25S (5|27|32): objs=50000 size=3.39MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_5d013b8246ebc5b3413f82b784f609f2ed63e86112901310219237303236 timeInCollate: 18.13s timeInCollatorInit: 953.38ms timeAwaitingO: 486.34ms timeAwaitingI: 2.96s timeInFinalSorting1: 2.02s timeInFinalSorting2: 1.19s timeInFinalSorting3: 591.53ms /0N (5|27|32): objs=150819 size=8.37MiB /1N (5|27|32): objs=151490 size=8.65MiB /2N (5|27|32): objs=159068 size=9.08MiB /3N (5|27|32): objs=158709 size=9.13MiB /4N (5|27|32): objs=151360 size=8.59MiB /5N (5|27|32): objs=156344 size=8.93MiB /6N (5|27|32): objs=151441 size=8.59MiB /7N (5|27|32): objs=158009 size=8.92MiB /8N (5|27|32): objs=157700 size=8.89MiB /9N (5|27|32): objs=145872 size=7.9MiB /10N (5|27|32): objs=159425 size=9.25MiB /11N (5|27|32): objs=156706 size=8.71MiB /12N (5|27|32): objs=160428 size=9.21MiB /13N (5|27|32): objs=159778 size=9.04MiB /14N (5|27|32): objs=154762 size=8.68MiB /15N (5|27|32): objs=155832 size=8.84MiB /16N (5|27|32): objs=160005 size=9.15MiB /17N (5|27|32): objs=163226 size=9.36MiB /18N (5|27|32): objs=162027 size=9.46MiB /19N (5|27|32): objs=162448 size=9.07MiB /20N (5|27|32): objs=155795 size=8.9MiB /21N (5|27|32): objs=166406 size=9.58MiB /22N (5|27|32): objs=157669 size=9.13MiB /23N (5|27|32): objs=148897 size=8.38MiB /24N (5|27|32): objs=159630 size=9.24MiB /25N (5|27|32): objs=152371 size=8.29MiB /26N (5|27|32): objs=152278 size=8.11MiB /27N (5|27|32): objs=148949 size=8.24MiB /28N (5|27|32): objs=158989 size=8.88MiB /29N (5|27|32): objs=152475 size=8.45MiB /30N (5|27|32): objs=155817 size=8.74MiB /31N (5|27|32): objs=155275 size=8.85MiB /0/0N (2|25|36): objs=39648 size=861.3KiB /0/1N (2|25|36): objs=5184 size=25.53KiB /0/2S (2|25|36): objs=137 size=270B /0/3N (2|25|36): objs=31399 size=506.55KiB /0/4N (2|25|36): objs=38199 size=840.68KiB /0/5N (2|25|36): objs=5614 size=25.56KiB /0/6S (2|25|36): objs=158 size=265B /0/7N (2|25|36): objs=4184 size=18.58KiB /0/8S (2|25|36): objs=172 size=201B /0/9N (2|25|36): objs=740 size=2.87KiB /0/10S (2|25|36): objs=170 size=145B /0/11N (2|25|36): objs=470 size=1.53KiB /0/12S (2|25|36): objs=176 size=221B /0/13N (2|25|36): objs=3060 size=13.04KiB /0/14S (2|25|36): objs=165 size=202B /0/15N (2|25|36): objs=1786 size=7.33KiB /0/16S (2|25|36): objs=160 size=136B /0/17N (2|25|36): objs=625 size=2.21KiB /0/18S (2|25|36): objs=148 size=283B /0/19N (2|25|36): objs=1809 size=7.93KiB /0/20S (2|25|36): objs=166 size=121B /0/21N (2|25|36): objs=3148 size=13.79KiB /0/22S (2|25|36): objs=167 size=347B /0/23N (2|25|36): objs=4605 size=21.06KiB /0/24S (2|25|36): objs=150 size=282B /0/25N (2|25|36): objs=1372 size=5.44KiB /0/26S (2|25|36): objs=155 size=215B /0/27N (2|25|36): objs=1975 size=7.93KiB /0/28S (2|25|36): objs=178 size=285B /0/29N (2|25|36): objs=1344 size=5.79KiB /0/30S (2|25|36): objs=138 size=112B /0/31N (2|25|36): objs=337 size=841B /0/32S (2|25|36): objs=150 size=241B /0/33N (2|25|36): objs=817 size=3.39KiB /0/34S (2|25|36): objs=169 size=333B /0/35N (2|25|36): objs=1944 size=8.13KiB /1/0N (2|25|36): objs=35932 size=737.21KiB /1/1N (2|25|36): objs=35997 size=710.47KiB /1/2N (2|25|36): objs=39212 size=1003.2KiB /1/3N (2|25|36): objs=8863 size=43.78KiB /1/4S (2|25|36): objs=163 size=123B /1/5N (2|25|36): objs=2047 size=8.47KiB /1/6S (2|25|36): objs=169 size=160B /1/7N (2|25|36): objs=2580 size=11KiB /1/8S (2|25|36): objs=138 size=284B /1/9N (2|25|36): objs=3312 size=15.72KiB /1/10S (2|25|36): objs=142 size=288B /1/11S (2|25|36): objs=145 size=144B /1/12S (2|25|36): objs=157 size=301B /1/13N (2|25|36): objs=1492 size=6KiB /1/14S (2|25|36): objs=149 size=166B /1/15N (2|25|36): objs=2248 size=9.32KiB /1/16S (2|25|36): objs=154 size=242B /1/17N (2|25|36): objs=920 size=3.64KiB /1/18S (2|25|36): objs=143 size=279B /1/19N (2|25|36): objs=1238 size=4.95KiB /1/20S (2|25|36): objs=171 size=134B /1/21N (2|25|36): objs=2110 size=8.66KiB /1/22S (2|25|36): objs=167 size=116B /1/23N (2|25|36): objs=2042 size=10.46KiB /1/24S (2|25|36): objs=160 size=169B /1/25S (2|25|36): objs=145 size=286B /1/26S (2|25|36): objs=154 size=313B /1/27N (2|25|36): objs=2711 size=11.53KiB /1/28S (2|25|36): objs=157 size=159B /1/29N (2|25|36): objs=6777 size=33.2KiB /1/30S (2|25|36): objs=165 size=92B /1/32S (2|25|36): objs=150 size=298B /1/33N (2|25|36): objs=464 size=1.53KiB /1/34S (2|25|36): objs=151 size=206B /1/35N (2|25|36): objs=765 size=2.84KiB /2/0N (2|25|36): objs=39083 size=913.03KiB /2/1N (2|25|36): objs=43108 size=1.04MiB /2/2N (2|25|36): objs=35828 size=756.88KiB /2/3N (2|25|36): objs=2577 size=11.95KiB /2/4S (2|25|36): objs=165 size=236B /2/5N (2|25|36): objs=3986 size=18.16KiB /2/6S (2|25|36): objs=147 size=275B /2/7N (2|25|36): objs=4123 size=18.78KiB /2/8S (2|25|36): objs=136 size=296B /2/9N (2|25|36): objs=4134 size=17.59KiB /2/10S (2|25|36): objs=138 size=287B /2/11N (2|25|36): objs=616 size=2.27KiB /2/12S (2|25|36): objs=160 size=119B /2/13N (2|25|36): objs=556 size=2.1KiB /2/14S (2|25|36): objs=149 size=95B /2/15N (2|25|36): objs=747 size=2.67KiB /2/16S (2|25|36): objs=132 size=141B /2/17N (2|25|36): objs=3325 size=16.18KiB /2/18S (2|25|36): objs=172 size=326B /2/19N (2|25|36): objs=1671 size=6.72KiB /2/20S (2|25|36): objs=167 size=235B /2/21N (2|25|36): objs=1524 size=6.26KiB /2/22S (2|25|36): objs=150 size=331B /2/23N (2|25|36): objs=5328 size=23.32KiB /2/24S (2|25|36): objs=148 size=317B /2/25N (2|25|36): objs=3028 size=12.83KiB /2/26S (2|25|36): objs=159 size=328B /2/28S (2|25|36): objs=156 size=170B /2/29N (2|25|36): objs=1424 size=5.75KiB /2/30S (2|25|36): objs=153 size=337B /2/31N (2|25|36): objs=1030 size=4.03KiB /2/32S (2|25|36): objs=183 size=330B /2/33N (2|25|36): objs=3739 size=19.56KiB /2/34S (2|25|36): objs=175 size=113B /2/35N (2|25|36): objs=751 size=2.86KiB /3/0N (2|25|36): objs=38686 size=855.51KiB /3/1N (2|25|36): objs=40461 size=974.05KiB /3/2N (2|25|36): objs=26607 size=365.89KiB /3/3S (2|25|36): objs=151 size=266B /3/4N (2|25|36): objs=8716 size=47.11KiB /3/5N (2|25|36): objs=6722 size=35.37KiB /3/6S (2|25|36): objs=139 size=259B /3/7N (2|25|36): objs=1935 size=8.23KiB /3/8S (2|25|36): objs=162 size=180B /3/9N (2|25|36): objs=775 size=3.05KiB /3/10S (2|25|36): objs=159 size=107B /3/11N (2|25|36): objs=1789 size=7.29KiB /3/12S (2|25|36): objs=148 size=261B /3/13N (2|25|36): objs=1186 size=4.87KiB /3/14S (2|25|36): objs=174 size=312B /3/15N (2|25|36): objs=6486 size=32.73KiB /3/16S (2|25|36): objs=137 size=290B /3/17N (2|25|36): objs=2957 size=12.99KiB /3/18S (2|25|36): objs=182 size=152B /3/19N (2|25|36): objs=3019 size=12.94KiB /3/20S (2|25|36): objs=131 size=151B /3/21N (2|25|36): objs=618 size=2.32KiB /3/22S (2|25|36): objs=166 size=231B /3/23S (2|25|36): objs=148 size=290B /3/24S (2|25|36): objs=133 size=205B /3/25N (2|25|36): objs=1102 size=4.38KiB /3/26S (2|25|36): objs=146 size=281B /3/27N (2|25|36): objs=1839 size=7.67KiB /3/28S (2|25|36): objs=152 size=169B /3/30S (2|25|36): objs=175 size=316B /3/31N (2|25|36): objs=3395 size=15.28KiB /3/32S (2|25|36): objs=157 size=117B /3/33N (2|25|36): objs=3808 size=16.49KiB /3/34S (2|25|36): objs=174 size=92B /3/35N (2|25|36): objs=5974 size=27.73KiB /4/0N (2|25|36): objs=37396 size=819.76KiB /4/1N (2|25|36): objs=39181 size=864.05KiB /4/2N (2|25|36): objs=30671 size=544.76KiB /4/3S (2|25|36): objs=156 size=205B /4/4N (2|25|36): objs=4527 size=19.81KiB /4/5N (2|25|36): objs=12367 size=68.72KiB /4/6S (2|25|36): objs=158 size=177B /4/7N (2|25|36): objs=751 size=2.89KiB /4/8S (2|25|36): objs=155 size=338B /4/9N (2|25|36): objs=1261 size=5.06KiB /4/10S (2|25|36): objs=166 size=205B /4/11N (2|25|36): objs=2075 size=9.04KiB /4/12S (2|25|36): objs=159 size=307B /4/13N (2|25|36): objs=469 size=1.75KiB /4/14S (2|25|36): objs=163 size=182B /4/15N (2|25|36): objs=5543 size=26.48KiB /4/16S (2|25|36): objs=147 size=125B /4/17N (2|25|36): objs=1721 size=6.98KiB /4/18S (2|25|36): objs=160 size=295B /4/19N (2|25|36): objs=2062 size=8.74KiB /4/20S (2|25|36): objs=156 size=124B /4/21S (2|25|36): objs=167 size=105B /4/22S (2|25|36): objs=171 size=140B /4/23N (2|25|36): objs=775 size=3.17KiB /4/24S (2|25|36): objs=153 size=306B /4/25N (2|25|36): objs=2883 size=12.51KiB /4/26S (2|25|36): objs=165 size=272B /4/27N (2|25|36): objs=1943 size=8.76KiB /4/28S (2|25|36): objs=149 size=220B /4/30S (2|25|36): objs=143 size=313B /4/31N (2|25|36): objs=724 size=2.66KiB /4/32S (2|25|36): objs=176 size=176B /4/33N (2|25|36): objs=436 size=1.37KiB /4/34S (2|25|36): objs=133 size=168B /4/35N (2|25|36): objs=3898 size=17.24KiB /5/0N (2|25|36): objs=40746 size=979.83KiB /5/1N (2|25|36): objs=35442 size=728.54KiB /5/2N (2|25|36): objs=45432 size=1.12MiB /5/3S (2|25|36): objs=155 size=307B /5/4S (2|25|36): objs=176 size=192B /5/5S (2|25|36): objs=139 size=301B /5/6S (2|25|36): objs=159 size=277B /5/7N (2|25|36): objs=481 size=1.49KiB /5/8S (2|25|36): objs=153 size=141B /5/9N (2|25|36): objs=1478 size=6.23KiB /5/10S (2|25|36): objs=151 size=311B /5/11S (2|25|36): objs=177 size=173B /5/12S (2|25|36): objs=134 size=299B /5/13N (2|25|36): objs=1362 size=5.88KiB /5/14S (2|25|36): objs=153 size=215B /5/15N (2|25|36): objs=7547 size=36.22KiB /5/16S (2|25|36): objs=138 size=281B /5/17N (2|25|36): objs=1309 size=5.32KiB /5/18S (2|25|36): objs=159 size=198B /5/19N (2|25|36): objs=493 size=1.43KiB /5/20S (2|25|36): objs=150 size=106B /5/21N (2|25|36): objs=775 size=3.07KiB /5/22S (2|25|36): objs=171 size=280B /5/23N (2|25|36): objs=1763 size=7.42KiB /5/24S (2|25|36): objs=163 size=128B /5/25N (2|25|36): objs=2730 size=11.25KiB /5/26S (2|25|36): objs=130 size=228B /5/27N (2|25|36): objs=2717 size=12.6KiB /5/28S (2|25|36): objs=187 size=120B /5/29N (2|25|36): objs=1528 size=6.51KiB /5/30S (2|25|36): objs=171 size=121B /5/31N (2|25|36): objs=1333 size=5.73KiB /5/32S (2|25|36): objs=159 size=112B /5/33N (2|25|36): objs=1663 size=6.93KiB /5/34S (2|25|36): objs=146 size=112B /5/35N (2|25|36): objs=6574 size=30.08KiB /6/0N (2|25|36): objs=34827 size=731.3KiB /6/1N (2|25|36): objs=34413 size=718.68KiB /6/2N (2|25|36): objs=40786 size=867.6KiB /6/3N (2|25|36): objs=1831 size=7.71KiB /6/4S (2|25|36): objs=147 size=231B /6/5N (2|25|36): objs=3520 size=14.86KiB /6/6S (2|25|36): objs=152 size=181B /6/7S (2|25|36): objs=149 size=225B /6/8S (2|25|36): objs=146 size=159B /6/9N (2|25|36): objs=3648 size=18.64KiB /6/10S (2|25|36): objs=159 size=122B /6/11N (2|25|36): objs=1097 size=4.38KiB /6/12S (2|25|36): objs=133 size=305B /6/13N (2|25|36): objs=3594 size=15.85KiB /6/14S (2|25|36): objs=164 size=293B /6/15N (2|25|36): objs=2788 size=11.83KiB /6/16S (2|25|36): objs=142 size=120B /6/17N (2|25|36): objs=291 size=863B /6/18S (2|25|36): objs=163 size=320B /6/19N (2|25|36): objs=1166 size=4.82KiB /6/20S (2|25|36): objs=163 size=324B /6/21S (2|25|36): objs=144 size=222B /6/22S (2|25|36): objs=154 size=236B /6/23N (2|25|36): objs=3167 size=13.43KiB /6/24S (2|25|36): objs=165 size=127B /6/25N (2|25|36): objs=4147 size=18.89KiB /6/26S (2|25|36): objs=148 size=148B /6/28S (2|25|36): objs=154 size=169B /6/29N (2|25|36): objs=610 size=2.42KiB /6/30S (2|25|36): objs=128 size=176B /6/31N (2|25|36): objs=3383 size=14.71KiB /6/32S (2|25|36): objs=165 size=182B /6/33N (2|25|36): objs=2178 size=9.08KiB /6/34S (2|25|36): objs=155 size=124B /6/35N (2|25|36): objs=7264 size=34.22KiB /7/0N (2|25|36): objs=38482 size=894.47KiB /7/1N (2|25|36): objs=24031 size=288.95KiB /7/2S (2|25|36): objs=172 size=339B /7/3N (2|25|36): objs=16051 size=117.47KiB /7/4N (2|25|36): objs=32450 size=587.2KiB /7/5S (2|25|36): objs=155 size=286B /7/6N (2|25|36): objs=6726 size=33.57KiB /7/7N (2|25|36): objs=14319 size=129.15KiB /7/8S (2|25|36): objs=159 size=220B /7/9N (2|25|36): objs=758 size=3.16KiB /7/10S (2|25|36): objs=149 size=230B /7/11S (2|25|36): objs=150 size=211B /7/12S (2|25|36): objs=146 size=249B /7/13N (2|25|36): objs=1927 size=7.99KiB /7/14S (2|25|36): objs=158 size=230B /7/15N (2|25|36): objs=927 size=3.73KiB /7/16S (2|25|36): objs=155 size=253B /7/17N (2|25|36): objs=1139 size=4.3KiB /7/18S (2|25|36): objs=156 size=214B /7/19N (2|25|36): objs=1069 size=4.07KiB /7/20S (2|25|36): objs=160 size=133B /7/22S (2|25|36): objs=135 size=120B /7/23N (2|25|36): objs=634 size=2.21KiB /7/24S (2|25|36): objs=133 size=106B /7/25N (2|25|36): objs=5589 size=26.53KiB /7/26S (2|25|36): objs=156 size=288B /7/27N (2|25|36): objs=7571 size=37KiB /7/28S (2|25|36): objs=149 size=271B /7/29N (2|25|36): objs=2305 size=10.2KiB /7/30S (2|25|36): objs=155 size=304B /7/31S (2|25|36): objs=157 size=247B /7/32S (2|25|36): objs=160 size=112B /7/33N (2|25|36): objs=473 size=1.49KiB /7/34S (2|25|36): objs=153 size=195B /7/35N (2|25|36): objs=800 size=2.78KiB /8/0N (2|25|36): objs=38598 size=818.76KiB /8/1N (2|25|36): objs=38908 size=916.51KiB /8/2N (2|25|36): objs=34105 size=771.51KiB /8/3S (2|25|36): objs=146 size=155B /8/4N (2|25|36): objs=3328 size=13.94KiB /8/5S (2|25|36): objs=156 size=342B /8/6N (2|25|36): objs=457 size=1.5KiB /8/7S (2|25|36): objs=153 size=330B /8/8N (2|25|36): objs=666 size=2.4KiB /8/9S (2|25|36): objs=153 size=274B /8/10N (2|25|36): objs=1372 size=5.61KiB /8/11N (2|25|36): objs=461 size=1.56KiB /8/12S (2|25|36): objs=135 size=203B /8/13N (2|25|36): objs=1308 size=5.24KiB /8/14S (2|25|36): objs=170 size=121B /8/15N (2|25|36): objs=757 size=2.81KiB /8/16S (2|25|36): objs=141 size=314B /8/17N (2|25|36): objs=1412 size=5.57KiB /8/18S (2|25|36): objs=164 size=148B /8/19N (2|25|36): objs=930 size=3.55KiB /8/20S (2|25|36): objs=162 size=167B /8/21N (2|25|36): objs=7574 size=38.36KiB /8/22S (2|25|36): objs=176 size=261B /8/23S (2|25|36): objs=165 size=91B /8/24S (2|25|36): objs=146 size=252B /8/25N (2|25|36): objs=1781 size=7.17KiB /8/26S (2|25|36): objs=152 size=263B /8/27N (2|25|36): objs=2384 size=10.23KiB /8/28S (2|25|36): objs=161 size=112B /8/29N (2|25|36): objs=3953 size=18.4KiB /8/30S (2|25|36): objs=169 size=196B /8/31N (2|25|36): objs=8167 size=42.18KiB /8/32S (2|25|36): objs=162 size=172B /8/33N (2|25|36): objs=7799 size=40.33KiB /8/34S (2|25|36): objs=142 size=161B /8/35N (2|25|36): objs=1087 size=4.41KiB /9/0N (2|25|36): objs=36803 size=725.13KiB /9/1N (2|25|36): objs=37318 size=713.79KiB /9/2N (2|25|36): objs=40103 size=885.65KiB /9/3N (2|25|36): objs=5917 size=27.82KiB /9/4S (2|25|36): objs=169 size=281B /9/5N (2|25|36): objs=12410 size=63.05KiB /9/6S (2|25|36): objs=144 size=311B /9/7N (2|25|36): objs=1216 size=5.08KiB /9/8S (2|25|36): objs=180 size=257B /9/9N (2|25|36): objs=302 size=896B /9/10S (2|25|36): objs=154 size=109B /9/11N (2|25|36): objs=744 size=2.72KiB /9/12S (2|25|36): objs=161 size=299B /9/13N (2|25|36): objs=1165 size=4.68KiB /9/14S (2|25|36): objs=153 size=86B /9/15N (2|25|36): objs=1794 size=7.77KiB /9/16S (2|25|36): objs=161 size=168B /9/18S (2|25|36): objs=147 size=256B /9/19N (2|25|36): objs=311 size=886B /9/20S (2|25|36): objs=157 size=164B /9/21N (2|25|36): objs=312 size=709B /9/22S (2|25|36): objs=148 size=319B /9/23N (2|25|36): objs=482 size=1.54KiB /9/24S (2|25|36): objs=142 size=291B /9/25N (2|25|36): objs=1546 size=6.41KiB /9/26S (2|25|36): objs=163 size=229B /9/27N (2|25|36): objs=1115 size=4.48KiB /9/28S (2|25|36): objs=163 size=243B /9/29N (2|25|36): objs=629 size=2.27KiB /9/30S (2|25|36): objs=140 size=241B /9/31N (2|25|36): objs=489 size=1.57KiB /9/32S (2|25|36): objs=159 size=214B /9/34S (2|25|36): objs=133 size=158B /9/35N (2|25|36): objs=742 size=2.97KiB /10/0N (2|25|36): objs=37903 size=821.17KiB /10/1N (2|25|36): objs=40042 size=986.55KiB /10/2N (2|25|36): objs=40559 size=934.27KiB /10/3N (2|25|36): objs=855 size=3.42KiB /10/4S (2|25|36): objs=150 size=181B /10/5N (2|25|36): objs=3863 size=18.56KiB /10/6S (2|25|36): objs=149 size=289B /10/7N (2|25|36): objs=1315 size=5.28KiB /10/8S (2|25|36): objs=144 size=129B /10/9N (2|25|36): objs=789 size=2.84KiB /10/10S (2|25|36): objs=162 size=118B /10/11N (2|25|36): objs=575 size=2.2KiB /10/12S (2|25|36): objs=154 size=322B /10/13N (2|25|36): objs=450 size=1.52KiB /10/14S (2|25|36): objs=149 size=236B /10/15N (2|25|36): objs=1838 size=7.85KiB /10/16S (2|25|36): objs=162 size=268B /10/17N (2|25|36): objs=1193 size=4.8KiB /10/18S (2|25|36): objs=170 size=248B /10/19N (2|25|36): objs=1718 size=7.29KiB /10/20S (2|25|36): objs=155 size=196B /10/21N (2|25|36): objs=2822 size=13.23KiB /10/22S (2|25|36): objs=142 size=112B /10/23S (2|25|36): objs=165 size=280B /10/24S (2|25|36): objs=157 size=225B /10/25N (2|25|36): objs=7125 size=36.11KiB /10/26S (2|25|36): objs=160 size=162B /10/28S (2|25|36): objs=150 size=256B /10/29N (2|25|36): objs=427 size=1.49KiB /10/30S (2|25|36): objs=175 size=265B /10/31N (2|25|36): objs=11512 size=67.86KiB /10/32S (2|25|36): objs=151 size=302B /10/33N (2|25|36): objs=2853 size=12.27KiB /10/34S (2|25|36): objs=150 size=300B /10/35N (2|25|36): objs=941 size=3.62KiB /11/0N (2|25|36): objs=37826 size=706.67KiB /11/1N (2|25|36): objs=39131 size=799.99KiB /11/2N (2|25|36): objs=45179 size=1.04MiB /11/3N (2|25|36): objs=1233 size=5.04KiB /11/4S (2|25|36): objs=152 size=216B /11/5N (2|25|36): objs=3655 size=18.25KiB /11/6S (2|25|36): objs=141 size=188B /11/7N (2|25|36): objs=2158 size=8.93KiB /11/8S (2|25|36): objs=144 size=278B /11/9N (2|25|36): objs=3842 size=17.75KiB /11/10S (2|25|36): objs=150 size=195B /11/11N (2|25|36): objs=2824 size=12.02KiB /11/12S (2|25|36): objs=144 size=274B /11/13N (2|25|36): objs=606 size=2.2KiB /11/14S (2|25|36): objs=163 size=218B /11/15N (2|25|36): objs=465 size=1.5KiB /11/16S (2|25|36): objs=148 size=213B /11/17N (2|25|36): objs=2360 size=9.9KiB /11/18S (2|25|36): objs=161 size=324B /11/19N (2|25|36): objs=3847 size=18.24KiB /11/20S (2|25|36): objs=137 size=246B /11/22S (2|25|36): objs=155 size=265B /11/23N (2|25|36): objs=3289 size=15.5KiB /11/24S (2|25|36): objs=147 size=208B /11/25N (2|25|36): objs=457 size=1.61KiB /11/26S (2|25|36): objs=151 size=120B /11/27N (2|25|36): objs=4117 size=18.93KiB /11/28S (2|25|36): objs=140 size=104B /11/30S (2|25|36): objs=161 size=335B /11/31N (2|25|36): objs=764 size=2.88KiB /11/32S (2|25|36): objs=144 size=326B /11/33S (2|25|36): objs=148 size=211B /11/34S (2|25|36): objs=152 size=300B /11/35N (2|25|36): objs=2415 size=10.29KiB /12/0N (2|25|36): objs=39473 size=937.51KiB /12/1N (2|25|36): objs=42145 size=983.83KiB /12/2N (2|25|36): objs=34137 size=635.3KiB /12/3S (2|25|36): objs=163 size=266B /12/4N (2|25|36): objs=6048 size=30.35KiB /12/5N (2|25|36): objs=4190 size=17.92KiB /12/6S (2|25|36): objs=149 size=138B /12/7N (2|25|36): objs=945 size=3.45KiB /12/8S (2|25|36): objs=149 size=226B /12/9N (2|25|36): objs=307 size=873B /12/10S (2|25|36): objs=151 size=217B /12/11N (2|25|36): objs=3543 size=15.07KiB /12/12S (2|25|36): objs=156 size=131B /12/13N (2|25|36): objs=319 size=850B /12/14S (2|25|36): objs=166 size=171B /12/15N (2|25|36): objs=303 size=877B /12/16S (2|25|36): objs=152 size=211B /12/17N (2|25|36): objs=3345 size=14.38KiB /12/18S (2|25|36): objs=172 size=226B /12/19N (2|25|36): objs=1191 size=4.92KiB /12/20S (2|25|36): objs=153 size=216B /12/21N (2|25|36): objs=12499 size=67.47KiB /12/22S (2|25|36): objs=140 size=322B /12/24S (2|25|36): objs=140 size=126B /12/25S (2|25|36): objs=146 size=239B /12/26S (2|25|36): objs=161 size=193B /12/27N (2|25|36): objs=2670 size=11.51KiB /12/28S (2|25|36): objs=165 size=324B /12/29N (2|25|36): objs=2338 size=9.56KiB /12/30S (2|25|36): objs=145 size=246B /12/31N (2|25|36): objs=926 size=3.56KiB /12/32S (2|25|36): objs=165 size=330B /12/33N (2|25|36): objs=1041 size=4.28KiB /12/34S (2|25|36): objs=135 size=323B /12/35N (2|25|36): objs=2400 size=10.59KiB /13/0N (2|25|36): objs=38677 size=850.38KiB /13/1N (2|25|36): objs=43957 size=1006.83KiB /13/2N (2|25|36): objs=29324 size=439.29KiB /13/3S (2|25|36): objs=147 size=215B /13/4N (2|25|36): objs=1038 size=4.27KiB /13/5S (2|25|36): objs=153 size=128B /13/6N (2|25|36): objs=448 size=1.43KiB /13/7S (2|25|36): objs=140 size=168B /13/9S (2|25|36): objs=145 size=149B /13/10N (2|25|36): objs=3257 size=13.9KiB /13/11S (2|25|36): objs=173 size=168B /13/12N (2|25|36): objs=1363 size=5.67KiB /13/13S (2|25|36): objs=172 size=257B /13/14N (2|25|36): objs=895 size=3.44KiB /13/15N (2|25|36): objs=1639 size=6.65KiB /13/16S (2|25|36): objs=169 size=260B /13/17N (2|25|36): objs=1109 size=4.51KiB /13/18S (2|25|36): objs=149 size=208B /13/19N (2|25|36): objs=4289 size=19.99KiB /13/20S (2|25|36): objs=154 size=100B /13/21N (2|25|36): objs=320 size=1.06KiB /13/22S (2|25|36): objs=164 size=217B /13/23N (2|25|36): objs=403 size=1.32KiB /13/24S (2|25|36): objs=138 size=277B /13/25N (2|25|36): objs=1404 size=5.72KiB /13/26S (2|25|36): objs=174 size=279B /13/27N (2|25|36): objs=14254 size=95.17KiB /13/28S (2|25|36): objs=159 size=316B /13/29N (2|25|36): objs=5471 size=24.86KiB /13/30S (2|25|36): objs=169 size=120B /13/31N (2|25|36): objs=5866 size=29.74KiB /13/32S (2|25|36): objs=163 size=295B /13/33N (2|25|36): objs=2159 size=9.13KiB /13/34S (2|25|36): objs=162 size=244B /13/35N (2|25|36): objs=1374 size=5.6KiB /14/0N (2|25|36): objs=27233 size=395.6KiB /14/1S (2|25|36): objs=145 size=241B /14/2N (2|25|36): objs=10584 size=57.95KiB /14/3N (2|25|36): objs=37371 size=698.37KiB /14/4N (2|25|36): objs=39880 size=867.06KiB /14/5N (2|25|36): objs=12563 size=84.73KiB /14/6S (2|25|36): objs=147 size=326B /14/7N (2|25|36): objs=5103 size=28.18KiB /14/8S (2|25|36): objs=175 size=107B /14/9N (2|25|36): objs=1403 size=5.79KiB /14/10S (2|25|36): objs=142 size=109B /14/12S (2|25|36): objs=168 size=103B /14/13N (2|25|36): objs=805 size=2.83KiB /14/14S (2|25|36): objs=149 size=256B /14/15S (2|25|36): objs=143 size=315B /14/16S (2|25|36): objs=148 size=135B /14/18S (2|25|36): objs=168 size=122B /14/19N (2|25|36): objs=2569 size=11.06KiB /14/20S (2|25|36): objs=165 size=357B /14/21N (2|25|36): objs=2208 size=9.44KiB /14/22S (2|25|36): objs=151 size=306B /14/23N (2|25|36): objs=2572 size=10.56KiB /14/24S (2|25|36): objs=149 size=275B /14/25N (2|25|36): objs=2078 size=8.84KiB /14/26S (2|25|36): objs=152 size=143B /14/27N (2|25|36): objs=2046 size=8.88KiB /14/28S (2|25|36): objs=134 size=155B /14/29N (2|25|36): objs=904 size=3.44KiB /14/30S (2|25|36): objs=146 size=225B /14/31N (2|25|36): objs=1837 size=7.7KiB /14/32S (2|25|36): objs=149 size=261B /14/33N (2|25|36): objs=2249 size=9.5KiB /14/34S (2|25|36): objs=150 size=254B /14/35N (2|25|36): objs=776 size=3.03KiB /15/0N (2|25|36): objs=38676 size=876.83KiB /15/1N (2|25|36): objs=38429 size=933.33KiB /15/2N (2|25|36): objs=20156 size=240.57KiB /15/3S (2|25|36): objs=132 size=204B /15/4N (2|25|36): objs=7042 size=34.59KiB /15/5S (2|25|36): objs=170 size=261B /15/6N (2|25|36): objs=2152 size=8.69KiB /15/7S (2|25|36): objs=179 size=130B /15/8N (2|25|36): objs=8706 size=48.45KiB /15/9N (2|25|36): objs=6007 size=28.35KiB /15/10S (2|25|36): objs=147 size=192B /15/11N (2|25|36): objs=6260 size=29.63KiB /15/12S (2|25|36): objs=151 size=212B /15/13N (2|25|36): objs=903 size=3.22KiB /15/14S (2|25|36): objs=184 size=313B /15/15N (2|25|36): objs=4831 size=22.89KiB /15/16S (2|25|36): objs=158 size=280B /15/18S (2|25|36): objs=166 size=194B /15/19N (2|25|36): objs=2950 size=13.51KiB /15/20S (2|25|36): objs=133 size=314B /15/21N (2|25|36): objs=1394 size=5.68KiB /15/22S (2|25|36): objs=130 size=227B /15/23N (2|25|36): objs=1214 size=4.95KiB /15/24S (2|25|36): objs=149 size=209B /15/25S (2|25|36): objs=134 size=278B /15/26S (2|25|36): objs=169 size=177B /15/27N (2|25|36): objs=1249 size=4.95KiB /15/28S (2|25|36): objs=169 size=180B /15/29N (2|25|36): objs=7544 size=41.88KiB /15/30S (2|25|36): objs=153 size=278B /15/31N (2|25|36): objs=4406 size=21.73KiB /15/32S (2|25|36): objs=170 size=159B /15/33N (2|25|36): objs=1089 size=4.24KiB /15/34S (2|25|36): objs=161 size=172B /15/35S (2|25|36): objs=169 size=220B /16/0N (2|25|36): objs=39948 size=854.36KiB /16/1N (2|25|36): objs=40769 size=1.04MiB /16/2N (2|25|36): objs=37831 size=855.47KiB /16/3N (2|25|36): objs=7441 size=35.78KiB /16/4S (2|25|36): objs=149 size=329B /16/6S (2|25|36): objs=157 size=291B /16/7N (2|25|36): objs=2336 size=10.42KiB /16/8S (2|25|36): objs=160 size=347B /16/9N (2|25|36): objs=464 size=1.75KiB /16/10S (2|25|36): objs=146 size=181B /16/12S (2|25|36): objs=139 size=174B /16/13N (2|25|36): objs=4746 size=24.18KiB /16/14S (2|25|36): objs=166 size=132B /16/15N (2|25|36): objs=2693 size=11.94KiB /16/16S (2|25|36): objs=161 size=160B /16/17N (2|25|36): objs=3219 size=13.28KiB /16/18S (2|25|36): objs=162 size=294B /16/19N (2|25|36): objs=722 size=2.79KiB /16/20S (2|25|36): objs=140 size=213B /16/21N (2|25|36): objs=855 size=3.47KiB /16/22S (2|25|36): objs=156 size=171B /16/23N (2|25|36): objs=3403 size=14.63KiB /16/24S (2|25|36): objs=169 size=125B /16/25S (2|25|36): objs=157 size=92B /16/26S (2|25|36): objs=139 size=93B /16/27N (2|25|36): objs=1661 size=6.72KiB /16/28S (2|25|36): objs=150 size=244B /16/29N (2|25|36): objs=5007 size=22.52KiB /16/30S (2|25|36): objs=140 size=229B /16/31N (2|25|36): objs=305 size=786B /16/32S (2|25|36): objs=146 size=259B /16/33N (2|25|36): objs=4399 size=20.02KiB /16/34S (2|25|36): objs=154 size=127B /16/35N (2|25|36): objs=1615 size=6.82KiB /17/0N (2|25|36): objs=41102 size=957.76KiB /17/1N (2|25|36): objs=42575 size=900.64KiB /17/2N (2|25|36): objs=38470 size=856.75KiB /17/3S (2|25|36): objs=158 size=322B /17/4N (2|25|36): objs=923 size=3.56KiB /17/5N (2|25|36): objs=1403 size=5.58KiB /17/6S (2|25|36): objs=180 size=337B /17/8S (2|25|36): objs=150 size=134B /17/9N (2|25|36): objs=1456 size=6.03KiB /17/10S (2|25|36): objs=163 size=212B /17/11N (2|25|36): objs=941 size=3.61KiB /17/12S (2|25|36): objs=171 size=167B /17/13N (2|25|36): objs=1839 size=7.58KiB /17/14S (2|25|36): objs=156 size=123B /17/16S (2|25|36): objs=136 size=244B /17/17N (2|25|36): objs=896 size=3.66KiB /17/18S (2|25|36): objs=167 size=339B /17/19N (2|25|36): objs=1314 size=5.4KiB /17/20S (2|25|36): objs=169 size=180B /17/21S (2|25|36): objs=154 size=251B /17/22S (2|25|36): objs=161 size=276B /17/23N (2|25|36): objs=1974 size=8.27KiB /17/24S (2|25|36): objs=155 size=254B /17/25N (2|25|36): objs=4144 size=17.33KiB /17/26S (2|25|36): objs=150 size=140B /17/27N (2|25|36): objs=9238 size=49.47KiB /17/28S (2|25|36): objs=155 size=284B /17/29S (2|25|36): objs=134 size=199B /17/30S (2|25|36): objs=159 size=306B /17/31N (2|25|36): objs=485 size=1.5KiB /17/32S (2|25|36): objs=175 size=246B /17/33N (2|25|36): objs=6806 size=29.56KiB /17/34S (2|25|36): objs=135 size=320B /17/35N (2|25|36): objs=6832 size=31.33KiB /18/0N (2|25|36): objs=37660 size=862.78KiB /18/1N (2|25|36): objs=15165 size=143.34KiB /18/2S (2|25|36): objs=155 size=185B /18/3N (2|25|36): objs=26186 size=371.07KiB /18/4N (2|25|36): objs=40072 size=912.78KiB /18/5N (2|25|36): objs=10790 size=72.3KiB /18/6S (2|25|36): objs=134 size=139B /18/7N (2|25|36): objs=3505 size=15.01KiB /18/8S (2|25|36): objs=173 size=198B /18/9N (2|25|36): objs=3516 size=15.63KiB /18/10S (2|25|36): objs=161 size=121B /18/11N (2|25|36): objs=1987 size=8.61KiB /18/12S (2|25|36): objs=177 size=93B /18/13N (2|25|36): objs=1832 size=7.44KiB /18/14S (2|25|36): objs=158 size=199B /18/15N (2|25|36): objs=1025 size=4.01KiB /18/16S (2|25|36): objs=137 size=225B /18/17N (2|25|36): objs=2659 size=11.12KiB /18/18S (2|25|36): objs=130 size=243B /18/19S (2|25|36): objs=142 size=167B /18/20S (2|25|36): objs=128 size=166B /18/21N (2|25|36): objs=1765 size=7.14KiB /18/22S (2|25|36): objs=131 size=209B /18/23N (2|25|36): objs=1843 size=7.52KiB /18/24S (2|25|36): objs=151 size=144B /18/25N (2|25|36): objs=5693 size=26.88KiB /18/26S (2|25|36): objs=161 size=304B /18/27N (2|25|36): objs=1240 size=4.96KiB /18/28S (2|25|36): objs=146 size=277B /18/29N (2|25|36): objs=284 size=831B /18/30S (2|25|36): objs=161 size=117B /18/31N (2|25|36): objs=1074 size=4.21KiB /18/32S (2|25|36): objs=159 size=165B /18/33N (2|25|36): objs=1675 size=7.05KiB /18/34S (2|25|36): objs=150 size=143B /18/35N (2|25|36): objs=1502 size=6KiB /19/0N (2|25|36): objs=41672 size=1005.01KiB /19/1N (2|25|36): objs=37453 size=677.58KiB /19/2N (2|25|36): objs=34733 size=639.36KiB /19/3S (2|25|36): objs=193 size=149B /19/4N (2|25|36): objs=3955 size=17.55KiB /19/5N (2|25|36): objs=11885 size=72.17KiB /19/6S (2|25|36): objs=138 size=199B /19/7N (2|25|36): objs=618 size=2.4KiB /19/8S (2|25|36): objs=171 size=95B /19/9S (2|25|36): objs=146 size=123B /19/10S (2|25|36): objs=166 size=172B /19/11N (2|25|36): objs=893 size=3.41KiB /19/12S (2|25|36): objs=139 size=107B /19/13N (2|25|36): objs=1322 size=5.55KiB /19/14S (2|25|36): objs=151 size=169B /19/15N (2|25|36): objs=6620 size=34.48KiB /19/16S (2|25|36): objs=157 size=176B /19/17N (2|25|36): objs=4203 size=20.16KiB /19/18S (2|25|36): objs=143 size=140B /19/20S (2|25|36): objs=150 size=295B /19/21N (2|25|36): objs=582 size=2.15KiB /19/22S (2|25|36): objs=150 size=221B /19/24S (2|25|36): objs=168 size=149B /19/25N (2|25|36): objs=1804 size=7.47KiB /19/26S (2|25|36): objs=154 size=338B /19/27N (2|25|36): objs=3307 size=15.52KiB /19/28S (2|25|36): objs=174 size=302B /19/29N (2|25|36): objs=3116 size=13.73KiB /19/30S (2|25|36): objs=131 size=141B /19/31N (2|25|36): objs=761 size=2.83KiB /19/32S (2|25|36): objs=164 size=135B /19/33S (2|25|36): objs=155 size=328B /19/34S (2|25|36): objs=152 size=259B /19/35N (2|25|36): objs=6722 size=30.29KiB /20/0N (2|25|36): objs=39743 size=899.58KiB /20/1N (2|25|36): objs=40103 size=983.31KiB /20/2N (2|25|36): objs=31578 size=555.72KiB /20/3N (2|25|36): objs=3601 size=15.17KiB /20/4S (2|25|36): objs=130 size=143B /20/5N (2|25|36): objs=2332 size=9.75KiB /20/6S (2|25|36): objs=153 size=288B /20/7N (2|25|36): objs=2193 size=9.25KiB /20/8S (2|25|36): objs=165 size=276B /20/9N (2|25|36): objs=3944 size=17.07KiB /20/10S (2|25|36): objs=165 size=116B /20/11N (2|25|36): objs=774 size=2.82KiB /20/12S (2|25|36): objs=143 size=188B /20/13N (2|25|36): objs=614 size=2.19KiB /20/14S (2|25|36): objs=140 size=105B /20/15S (2|25|36): objs=106 size=184B /20/16S (2|25|36): objs=153 size=235B /20/17N (2|25|36): objs=9226 size=56.67KiB /20/18S (2|25|36): objs=136 size=247B /20/19S (2|25|36): objs=150 size=318B /20/20S (2|25|36): objs=143 size=273B /20/21N (2|25|36): objs=1668 size=6.99KiB /20/22S (2|25|36): objs=172 size=232B /20/23N (2|25|36): objs=3960 size=18.5KiB /20/24S (2|25|36): objs=157 size=100B /20/25N (2|25|36): objs=5925 size=28.17KiB /20/26S (2|25|36): objs=141 size=111B /20/28S (2|25|36): objs=150 size=321B /20/29N (2|25|36): objs=1075 size=4.13KiB /20/30S (2|25|36): objs=173 size=287B /20/31N (2|25|36): objs=3460 size=15.36KiB /20/32S (2|25|36): objs=165 size=240B /20/33N (2|25|36): objs=919 size=3.43KiB /20/34S (2|25|36): objs=161 size=154B /20/35N (2|25|36): objs=1977 size=8.17KiB /21/0N (2|25|36): objs=41368 size=980.79KiB /21/1N (2|25|36): objs=41493 size=932.12KiB /21/2N (2|25|36): objs=39520 size=822.8KiB /21/3S (2|25|36): objs=155 size=204B /21/4N (2|25|36): objs=2405 size=10.52KiB /21/5S (2|25|36): objs=158 size=263B /21/6S (2|25|36): objs=160 size=185B /21/7N (2|25|36): objs=5773 size=29.59KiB /21/8S (2|25|36): objs=133 size=163B /21/9N (2|25|36): objs=1517 size=6.32KiB /21/10S (2|25|36): objs=185 size=123B /21/11N (2|25|36): objs=931 size=3.69KiB /21/12S (2|25|36): objs=153 size=306B /21/13N (2|25|36): objs=1225 size=4.97KiB /21/14S (2|25|36): objs=177 size=110B /21/15N (2|25|36): objs=3832 size=16.6KiB /21/16S (2|25|36): objs=155 size=218B /21/17N (2|25|36): objs=5009 size=23.44KiB /21/18S (2|25|36): objs=160 size=293B /21/19N (2|25|36): objs=1284 size=5.45KiB /21/20S (2|25|36): objs=157 size=188B /21/21N (2|25|36): objs=2862 size=12.53KiB /21/22S (2|25|36): objs=138 size=96B /21/23N (2|25|36): objs=457 size=1.62KiB /21/24S (2|25|36): objs=159 size=199B /21/25N (2|25|36): objs=5243 size=25.19KiB /21/26S (2|25|36): objs=158 size=229B /21/27N (2|25|36): objs=1334 size=5.55KiB /21/28S (2|25|36): objs=168 size=242B /21/29N (2|25|36): objs=5189 size=24.64KiB /21/30S (2|25|36): objs=151 size=248B /21/32S (2|25|36): objs=166 size=218B /21/33N (2|25|36): objs=3619 size=15.51KiB /21/34S (2|25|36): objs=147 size=157B /21/35N (2|25|36): objs=665 size=2.43KiB /22/0N (2|25|36): objs=38901 size=923.64KiB /22/1N (2|25|36): objs=41782 size=925.65KiB /22/2N (2|25|36): objs=23064 size=309.58KiB /22/3S (2|25|36): objs=156 size=99B /22/4N (2|25|36): objs=16788 size=128.84KiB /22/5N (2|25|36): objs=3337 size=14.54KiB /22/6S (2|25|36): objs=157 size=331B /22/7N (2|25|36): objs=2133 size=9KiB /22/8S (2|25|36): objs=165 size=301B /22/10S (2|25|36): objs=154 size=307B /22/11N (2|25|36): objs=311 size=936B /22/12S (2|25|36): objs=145 size=251B /22/13N (2|25|36): objs=5891 size=28.38KiB /22/14S (2|25|36): objs=161 size=320B /22/16S (2|25|36): objs=134 size=306B /22/17N (2|25|36): objs=2396 size=10.17KiB /22/18S (2|25|36): objs=175 size=271B /22/19N (2|25|36): objs=436 size=1.4KiB /22/20S (2|25|36): objs=160 size=337B /22/21N (2|25|36): objs=1363 size=5.88KiB /22/22S (2|25|36): objs=150 size=284B /22/23N (2|25|36): objs=5368 size=25.05KiB /22/24S (2|25|36): objs=148 size=276B /22/25N (2|25|36): objs=1279 size=5.75KiB /22/26S (2|25|36): objs=150 size=212B /22/27N (2|25|36): objs=2596 size=10.83KiB /22/28S (2|25|36): objs=164 size=121B /22/29S (2|25|36): objs=129 size=227B /22/30S (2|25|36): objs=160 size=276B /22/31N (2|25|36): objs=953 size=3.62KiB /22/32S (2|25|36): objs=161 size=100B /22/33N (2|25|36): objs=1339 size=5.33KiB /22/34S (2|25|36): objs=142 size=263B /22/35N (2|25|36): objs=7121 size=34.31KiB /23/0N (2|25|36): objs=41284 size=1.02MiB /23/1N (2|25|36): objs=36333 size=719.59KiB /23/2N (2|25|36): objs=33300 size=662.69KiB /23/3S (2|25|36): objs=147 size=195B /23/4N (2|25|36): objs=2816 size=11.88KiB /23/5N (2|25|36): objs=9784 size=49.45KiB /23/6S (2|25|36): objs=133 size=234B /23/7N (2|25|36): objs=3488 size=15.24KiB /23/8S (2|25|36): objs=166 size=323B /23/10S (2|25|36): objs=148 size=275B /23/11N (2|25|36): objs=1969 size=8.52KiB /23/12S (2|25|36): objs=147 size=184B /23/13N (2|25|36): objs=1061 size=4.33KiB /23/14S (2|25|36): objs=162 size=198B /23/15N (2|25|36): objs=4886 size=23.69KiB /23/16S (2|25|36): objs=143 size=267B /23/17S (2|25|36): objs=150 size=202B /23/18S (2|25|36): objs=170 size=192B /23/19N (2|25|36): objs=998 size=3.96KiB /23/20S (2|25|36): objs=127 size=234B /23/21N (2|25|36): objs=467 size=1.46KiB /23/22S (2|25|36): objs=136 size=172B /23/23N (2|25|36): objs=316 size=862B /23/24S (2|25|36): objs=150 size=286B /23/25N (2|25|36): objs=2586 size=10.9KiB /23/26S (2|25|36): objs=149 size=194B /23/27N (2|25|36): objs=282 size=845B /23/28S (2|25|36): objs=134 size=186B /23/29N (2|25|36): objs=1105 size=4.31KiB /23/30S (2|25|36): objs=167 size=302B /23/31N (2|25|36): objs=2059 size=8.58KiB /23/32S (2|25|36): objs=160 size=121B /23/33N (2|25|36): objs=2919 size=12.17KiB /23/34S (2|25|36): objs=141 size=245B /23/35N (2|25|36): objs=714 size=2.62KiB /24/0N (2|25|36): objs=42608 size=1.02MiB /24/1N (2|25|36): objs=41246 size=1019.4KiB /24/2N (2|25|36): objs=38572 size=956.13KiB /24/3N (2|25|36): objs=1851 size=8.05KiB /24/4S (2|25|36): objs=143 size=296B /24/5N (2|25|36): objs=5070 size=22.12KiB /24/6S (2|25|36): objs=130 size=141B /24/8S (2|25|36): objs=140 size=319B /24/9N (2|25|36): objs=2871 size=12.1KiB /24/10S (2|25|36): objs=127 size=94B /24/11S (2|25|36): objs=151 size=299B /24/12S (2|25|36): objs=146 size=143B /24/13N (2|25|36): objs=1219 size=5.05KiB /24/14S (2|25|36): objs=155 size=97B /24/15N (2|25|36): objs=11266 size=57.5KiB /24/16S (2|25|36): objs=170 size=206B /24/18S (2|25|36): objs=142 size=230B /24/19N (2|25|36): objs=6670 size=35.48KiB /24/20S (2|25|36): objs=162 size=152B /24/21S (2|25|36): objs=138 size=169B /24/22S (2|25|36): objs=140 size=153B /24/23N (2|25|36): objs=590 size=2.32KiB /24/24S (2|25|36): objs=148 size=264B /24/25N (2|25|36): objs=1379 size=5.41KiB /24/26S (2|25|36): objs=151 size=168B /24/27N (2|25|36): objs=964 size=3.72KiB /24/28S (2|25|36): objs=178 size=345B /24/29N (2|25|36): objs=929 size=3.53KiB /24/30S (2|25|36): objs=168 size=282B /24/32S (2|25|36): objs=168 size=183B /24/33N (2|25|36): objs=1056 size=3.93KiB /24/34S (2|25|36): objs=162 size=252B /24/35N (2|25|36): objs=620 size=2.2KiB /25/0N (2|25|36): objs=38927 size=726.45KiB /25/1N (2|25|36): objs=39464 size=919.42KiB /25/2N (2|25|36): objs=20269 size=174.97KiB /25/3S (2|25|36): objs=159 size=258B /25/4N (2|25|36): objs=16757 size=158.41KiB /25/5N (2|25|36): objs=12634 size=69.15KiB /25/6S (2|25|36): objs=148 size=205B /25/7S (2|25|36): objs=155 size=109B /25/8S (2|25|36): objs=157 size=110B /25/9N (2|25|36): objs=5042 size=25.58KiB /25/10S (2|25|36): objs=164 size=166B /25/11N (2|25|36): objs=448 size=1.57KiB /25/12S (2|25|36): objs=144 size=142B /25/13N (2|25|36): objs=884 size=3.5KiB /25/14S (2|25|36): objs=158 size=189B /25/15N (2|25|36): objs=757 size=2.86KiB /25/16S (2|25|36): objs=152 size=284B /25/17N (2|25|36): objs=2012 size=8.4KiB /25/18S (2|25|36): objs=133 size=171B /25/19N (2|25|36): objs=2065 size=8.94KiB /25/20S (2|25|36): objs=165 size=336B /25/21N (2|25|36): objs=295 size=922B /25/22S (2|25|36): objs=183 size=187B /25/23N (2|25|36): objs=1533 size=6.24KiB /25/24S (2|25|36): objs=149 size=183B /25/25N (2|25|36): objs=717 size=2.85KiB /25/26S (2|25|36): objs=150 size=109B /25/27N (2|25|36): objs=2171 size=9.15KiB /25/28S (2|25|36): objs=157 size=247B /25/29N (2|25|36): objs=727 size=2.74KiB /25/30S (2|25|36): objs=150 size=100B /25/31N (2|25|36): objs=2397 size=10.32KiB /25/32S (2|25|36): objs=149 size=262B /25/33N (2|25|36): objs=940 size=3.56KiB /25/34S (2|25|36): objs=147 size=331B /25/35N (2|25|36): objs=1712 size=7.16KiB /26/0N (2|25|36): objs=38952 size=790.4KiB /26/1N (2|25|36): objs=38448 size=786.4KiB /26/2N (2|25|36): objs=33406 size=488.96KiB /26/3S (2|25|36): objs=139 size=123B /26/4N (2|25|36): objs=4002 size=17.01KiB /26/5S (2|25|36): objs=156 size=257B /26/6N (2|25|36): objs=782 size=3.09KiB /26/7S (2|25|36): objs=148 size=108B /26/8N (2|25|36): objs=936 size=3.75KiB /26/9N (2|25|36): objs=6168 size=28.75KiB /26/10S (2|25|36): objs=148 size=154B /26/11N (2|25|36): objs=8060 size=36.57KiB /26/12S (2|25|36): objs=153 size=109B /26/13N (2|25|36): objs=1377 size=5.66KiB /26/14S (2|25|36): objs=123 size=288B /26/15N (2|25|36): objs=457 size=1.41KiB /26/16S (2|25|36): objs=164 size=236B /26/17N (2|25|36): objs=2405 size=10.68KiB /26/18S (2|25|36): objs=154 size=190B /26/19N (2|25|36): objs=5294 size=24.42KiB /26/20S (2|25|36): objs=145 size=196B /26/21N (2|25|36): objs=2546 size=11.69KiB /26/22S (2|25|36): objs=165 size=240B /26/23N (2|25|36): objs=309 size=875B /26/24S (2|25|36): objs=162 size=150B /26/25N (2|25|36): objs=1097 size=4.65KiB /26/26S (2|25|36): objs=137 size=129B /26/27N (2|25|36): objs=453 size=1.53KiB /26/28S (2|25|36): objs=156 size=162B /26/29N (2|25|36): objs=1242 size=5.02KiB /26/30S (2|25|36): objs=156 size=178B /26/31N (2|25|36): objs=3458 size=14.71KiB /26/32S (2|25|36): objs=155 size=95B /26/33N (2|25|36): objs=456 size=1.45KiB /26/34S (2|25|36): objs=169 size=252B /27/0N (2|25|36): objs=41232 size=963.5KiB /27/1N (2|25|36): objs=35356 size=565.13KiB /27/2N (2|25|36): objs=37054 size=767.75KiB /27/3N (2|25|36): objs=8319 size=41.61KiB /27/4S (2|25|36): objs=155 size=317B /27/5N (2|25|36): objs=609 size=2.25KiB /27/6S (2|25|36): objs=147 size=101B /27/7N (2|25|36): objs=1372 size=5.57KiB /27/8S (2|25|36): objs=149 size=213B /27/9N (2|25|36): objs=457 size=1.59KiB /27/10S (2|25|36): objs=143 size=271B /27/11N (2|25|36): objs=4512 size=20.64KiB /27/12S (2|25|36): objs=152 size=251B /27/13N (2|25|36): objs=1207 size=4.8KiB /27/14S (2|25|36): objs=144 size=190B /27/15N (2|25|36): objs=472 size=1.42KiB /27/16S (2|25|36): objs=171 size=160B /27/17N (2|25|36): objs=871 size=3.63KiB /27/18S (2|25|36): objs=162 size=240B /27/19N (2|25|36): objs=3069 size=12.79KiB /27/20S (2|25|36): objs=146 size=293B /27/21N (2|25|36): objs=2450 size=10.55KiB /27/22S (2|25|36): objs=144 size=196B /27/23N (2|25|36): objs=1502 size=6.27KiB /27/24S (2|25|36): objs=161 size=229B /27/25N (2|25|36): objs=2151 size=9.16KiB /27/26S (2|25|36): objs=156 size=101B /27/27N (2|25|36): objs=738 size=3.14KiB /27/28S (2|25|36): objs=149 size=177B /27/29N (2|25|36): objs=1701 size=7.16KiB /27/30S (2|25|36): objs=133 size=99B /27/31S (2|25|36): objs=152 size=210B /27/32S (2|25|36): objs=161 size=171B /27/33N (2|25|36): objs=294 size=884B /27/34S (2|25|36): objs=172 size=212B /27/35N (2|25|36): objs=2986 size=12.69KiB /28/0N (2|25|36): objs=38490 size=736.31KiB /28/1N (2|25|36): objs=42218 size=833.42KiB /28/2N (2|25|36): objs=41311 size=912.31KiB /28/3S (2|25|36): objs=155 size=167B /28/5S (2|25|36): objs=134 size=148B /28/7S (2|25|36): objs=178 size=236B /28/8N (2|25|36): objs=607 size=2.29KiB /28/9S (2|25|36): objs=156 size=294B /28/10S (2|25|36): objs=167 size=282B /28/11N (2|25|36): objs=2893 size=13.03KiB /28/12S (2|25|36): objs=148 size=271B /28/13N (2|25|36): objs=876 size=3.57KiB /28/14S (2|25|36): objs=156 size=183B /28/15N (2|25|36): objs=1457 size=5.82KiB /28/16S (2|25|36): objs=162 size=313B /28/17N (2|25|36): objs=314 size=977B /28/18S (2|25|36): objs=135 size=280B /28/19N (2|25|36): objs=5266 size=24.73KiB /28/20S (2|25|36): objs=152 size=180B /28/21N (2|25|36): objs=3618 size=16.13KiB /28/22S (2|25|36): objs=169 size=105B /28/23N (2|25|36): objs=3503 size=15.17KiB /28/24S (2|25|36): objs=159 size=184B /28/25N (2|25|36): objs=304 size=995B /28/26S (2|25|36): objs=142 size=142B /28/27S (2|25|36): objs=152 size=272B /28/28S (2|25|36): objs=145 size=154B /28/29N (2|25|36): objs=2281 size=9.37KiB /28/30S (2|25|36): objs=153 size=184B /28/31N (2|25|36): objs=492 size=1.46KiB /28/32S (2|25|36): objs=174 size=138B /28/33N (2|25|36): objs=3872 size=17.14KiB /28/34S (2|25|36): objs=160 size=295B /28/35N (2|25|36): objs=8690 size=40.7KiB /29/0N (2|25|36): objs=41417 size=939.34KiB /29/1N (2|25|36): objs=32897 size=592.51KiB /29/2N (2|25|36): objs=39871 size=882.44KiB /29/3N (2|25|36): objs=10139 size=49.07KiB /29/4S (2|25|36): objs=166 size=331B /29/5N (2|25|36): objs=5685 size=32.46KiB /29/6S (2|25|36): objs=159 size=322B /29/7S (2|25|36): objs=160 size=302B /29/8S (2|25|36): objs=151 size=157B /29/9N (2|25|36): objs=1218 size=4.84KiB /29/10S (2|25|36): objs=161 size=182B /29/11N (2|25|36): objs=2360 size=10.24KiB /29/12S (2|25|36): objs=160 size=114B /29/13N (2|25|36): objs=1530 size=6.27KiB /29/14S (2|25|36): objs=153 size=145B /29/15N (2|25|36): objs=1835 size=7.87KiB /29/16S (2|25|36): objs=183 size=123B /29/17N (2|25|36): objs=618 size=2.32KiB /29/18S (2|25|36): objs=151 size=172B /29/19N (2|25|36): objs=1513 size=6.48KiB /29/20S (2|25|36): objs=169 size=208B /29/21N (2|25|36): objs=770 size=3.05KiB /29/22S (2|25|36): objs=152 size=112B /29/23N (2|25|36): objs=5917 size=27.52KiB /29/24S (2|25|36): objs=136 size=318B /29/25N (2|25|36): objs=618 size=2.3KiB /29/26S (2|25|36): objs=156 size=275B /29/27N (2|25|36): objs=854 size=3.33KiB /29/28S (2|25|36): objs=143 size=312B /29/29N (2|25|36): objs=432 size=1.68KiB /29/30S (2|25|36): objs=149 size=165B /29/31N (2|25|36): objs=1683 size=6.96KiB /29/32S (2|25|36): objs=139 size=319B /29/34S (2|25|36): objs=164 size=209B /29/35N (2|25|36): objs=466 size=1.6KiB /30/0N (2|25|36): objs=41635 size=1.03MiB /30/1N (2|25|36): objs=40500 size=824.79KiB /30/2N (2|25|36): objs=19796 size=207.23KiB /30/3S (2|25|36): objs=182 size=99B /30/4N (2|25|36): objs=15822 size=95.62KiB /30/5N (2|25|36): objs=3502 size=16.56KiB /30/6S (2|25|36): objs=170 size=277B /30/7N (2|25|36): objs=1550 size=6.24KiB /30/8S (2|25|36): objs=153 size=341B /30/9N (2|25|36): objs=2867 size=13.19KiB /30/10S (2|25|36): objs=162 size=234B /30/11N (2|25|36): objs=2998 size=13.23KiB /30/12S (2|25|36): objs=128 size=273B /30/14S (2|25|36): objs=152 size=327B /30/15N (2|25|36): objs=2906 size=12.2KiB /30/16S (2|25|36): objs=143 size=100B /30/17N (2|25|36): objs=619 size=2.24KiB /30/18S (2|25|36): objs=142 size=148B /30/19S (2|25|36): objs=158 size=295B /30/20S (2|25|36): objs=151 size=107B /30/21S (2|25|36): objs=167 size=293B /30/22S (2|25|36): objs=167 size=167B /30/23N (2|25|36): objs=4196 size=18.12KiB /30/24S (2|25|36): objs=154 size=211B /30/25S (2|25|36): objs=142 size=91B /30/26S (2|25|36): objs=136 size=233B /30/27N (2|25|36): objs=4389 size=20.51KiB /30/28S (2|25|36): objs=158 size=317B /30/29N (2|25|36): objs=611 size=2.06KiB /30/30S (2|25|36): objs=182 size=290B /30/31N (2|25|36): objs=297 size=936B /30/32S (2|25|36): objs=168 size=171B /30/33N (2|25|36): objs=7213 size=37.4KiB /30/34S (2|25|36): objs=153 size=205B /30/35N (2|25|36): objs=3948 size=17.48KiB /31/0N (2|25|36): objs=39827 size=880.83KiB /31/1N (2|25|36): objs=38619 size=904.28KiB /31/2N (2|25|36): objs=38752 size=855.48KiB /31/3N (2|25|36): objs=5122 size=23.83KiB /31/4S (2|25|36): objs=155 size=314B /31/5N (2|25|36): objs=639 size=2.33KiB /31/6S (2|25|36): objs=148 size=200B /31/7S (2|25|36): objs=165 size=154B /31/8S (2|25|36): objs=164 size=324B /31/9N (2|25|36): objs=5705 size=26.75KiB /31/10S (2|25|36): objs=167 size=235B /31/11N (2|25|36): objs=2693 size=11.18KiB /31/12S (2|25|36): objs=140 size=216B /31/13N (2|25|36): objs=4780 size=23.26KiB /31/14S (2|25|36): objs=160 size=84B /31/15N (2|25|36): objs=440 size=1.46KiB /31/16S (2|25|36): objs=161 size=197B /31/17N (2|25|36): objs=1235 size=5.16KiB /31/18S (2|25|36): objs=150 size=134B /31/19N (2|25|36): objs=1092 size=4.25KiB /31/20S (2|25|36): objs=163 size=314B /31/21N (2|25|36): objs=815 size=2.94KiB /31/22S (2|25|36): objs=150 size=186B /31/23N (2|25|36): objs=1207 size=4.82KiB /31/24S (2|25|36): objs=176 size=88B /31/26S (2|25|36): objs=151 size=231B /31/27N (2|25|36): objs=458 size=1.61KiB /31/28S (2|25|36): objs=134 size=99B /31/29N (2|25|36): objs=5511 size=27.52KiB /31/30S (2|25|36): objs=155 size=273B /31/31N (2|25|36): objs=2479 size=10.86KiB /31/32S (2|25|36): objs=147 size=129B /31/34S (2|25|36): objs=143 size=199B /31/35N (2|25|36): objs=3272 size=14.22KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 167.05ms Sorting: 78.2ms 1 217 41481 99524 99996 com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_13d0c41f136d6a722209f0ead7164f0d11150eba13986631359720385102.fasta: 0% Indexing milib_13d0c41f136d6a722209f0ead7164f0d11150eba13986631359720385102.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_13d0c41f136d6a722209f0ead7164f0d11150eba13986631359720385102.fasta: 0% Indexing milib_13d0c41f136d6a722209f0ead7164f0d11150eba13986631359720385102.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_bc0e3ad271f7c21d04df505e31b9b49df7adcea114886556902189750917.tmp: 0% Indexing milib_bc0e3ad271f7c21d04df505e31b9b49df7adcea114886556902189750917.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 45 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 638 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2548 com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99947 elements with 365.96KiB in raw nucleotide entropy serialized into 272.91KiB com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT AAAAGACTCTGTTTTGCAGGGAGGGCGAGTGCTACAGAATGTGTAGTCATAAATTCCAGGTTGTCATCTAGAAGAACCTTTCAGCCAGAACCCGGTGGAACAAGATACCTGAAAGACTGCACTTGGGCATTGAGACCGACTCGCTCATGTAAGAGGTTCAGCCCCAAACTGCTGCCGAAGGTGTCCTGTACTCTGTCCCGGACATTTCCGGACTCGCCCGGGGAAGACGATCAAGTTTCAGGGATTGTACGTGCTGCTATGCCTATGGTCCCACAGGAGTTATACCAATTACACCGGATGGACGCGCGAAGCTGAGCTGAGCTAGCACTCGGGCTGGTCCACGTGATCCCCCACCGGCACCTTGTTCTCCTCGCTTGTGGCCTTCTTGGCCCGACTGTCCTCATAGTACCCGAGACACTCCCCCAACCCGTGGCAAGTAACCACAGAGGTCTAGCCTACGGGTTCAGCGGGAGACCGTCTCAGGTTGTCAGAAACATAAATGAAGCGAAATAGAATGATGTTAAATTTGGTTACGGTGGGAAGACGGGCTAGTGTTCAAGGCCCGACGGCCAAGGGCCTGTTAGTCCCTTCCCTGTTATGTACTCCAAAAGTTTACCCGGCTTTGTAGCATCCCGAAACCATGCTAAACAAACCCCGGGCTGCGTTGAGGGAGGGGCCTAACGTTTGTAATGACGGAGCACACTTAAATCCTAAGAAAGCGCCTATGCCAGACTTCCCTCGACGCTCGGCTGCACCGAGCGGTGCTGGGGCACCGGCTCG AAAAGATTGTTTTGCAGGGGAGGCGAGTGCTAAGAATGTTAGTCATAAAATCCAGGTTGTCATCTAGAAGTAACCTTTCAGCCAGAACCCGGTGGAACAAGATACCTGAGAAGACTCACGTGGGCATGAGTCCGACTCCTTATGAAGAGGTTCAGCCCAAACTGCTGCCGAAGGTGTCCTTGTACTCTTGCCCGGAATCATTTCCGGACTCGCCCGGTGAAGACGCAAGTTTCAGTGATTGTACGTGCTTCCATGCCTATGGTCCCACAGGAGTTATACCATTACACCGGATGGACTGCGCGAAGCTGAGCTGACAACACTGGGCTGGTCCACTGATCCCCCACGGCACCTTGTTCTCCTCGCTTGTGGCCTTCTTGGCCCGATCTGTCCTCATAGACTCGAGACACTCCCCCAACCCGGGCTAGTAACCACAGAGGTCTAGCCACTGGTTCAGCGGGAGACCGTCTCAAGGTTGTCAGGAACATAAAATGAAGCGAAATAGGAATTATGTTAACTTGTACGGTGGGAAGACGGGTAGTGTCAATGCCCGAGGTAGGGCCTGTTAGTCCCTTCCCTGTTATTTACTCCAAAAGTTTACCGGCTTTGTATGCATCCCGAAACATGCTAAAAAATCCCCGCTGCGTTGAAGGAGGGGTTATCTTTGTATGACGTGAGCACACTTAAATCCTAAGAAACGCCTAGCCAGGCTTCTCGACGTCTTGCTGCACCGAGACGGTGCTGGGGCACCGGCTCG AAAGAGTTGTTTGCAGGGGAGGCGAGTGCTAAGAATGTCAGTCATAAAATCCAGGTTGTCATCTAGTAGTAAACCTTTCAGCAGAACCCGGGGAACAGAGATACCTGAGAAGGACTATCGTGGGGCATGACGTCCGACTCCTTATGAATGAGGTTCGCCCAAACTGCTGCCCAAGGTGTCCTTGTACATCTTGCCCGGAATATTTCCGGACTCGCCGTGAAGACGCAAGTTCAGGATTGTACGATGCTTTCCATCCATGTCCCAAGGAGTTATCCGTACACCGGATGGCGCGCAAGCTGAGCTGAGCAACACTGGGCTGTCCACTTATCCACCCACGGCACCTTGTTTCTCCTCAGTTGTGGCCTTCTTGCGACTGTCCTCATAGACTCGAGACATCCCCAGACCCGGGCTAGTAACACAGAGACAGCCGCTGGTCAGCGGGAGACCGTTCAAGGTTGTCAGGAACTAAAATGTAGTAAAAGGAATTATAGATTAACTTGTCGGTGGGAGCGGGAGTGTCAATGCCCGATAGGGCCTGTTAGTCCCTTCCTGTTATTTCTCCAAAAGTTTACCGGCTTTTATGGCATCCCGAACATGCTAAAAATTCCCCGTGTTGAAGGAGGGGTTAATCCTTTGTATGACGTGAGCACACTAAACCTAAGACACGCCTAGCCAGGTTCTCGACGTCTTGCGCACCGAGACCGGTGCTGGGGCACCGGCTCG 0 -AAAGAGT-TG-TTTGCAGGG-GAGGCGAGTGCTA-AGAATGT-CAGTCATAAAATCCAGGTTGTCATCTAGTAGTAAACCTTTCAG-CAGAACCCGG-GGAACAGAGATACCTGAGAAGGACT--ATCGTGGGGCA-TGACGTCCGACTC-CTTATG-AATGAGGTTC-G-CCCAAACTGCTGCCCAAGGTGTCCTTGTACATCT-TGCCCGGAATATTTCCGGACTCG-CC-GTGAAGACG--CAAG-TTCA-GGATTGTACGATGCTTTCCAT-CC-AT-GTCCCA-AGGAGTTAT-CC--GTACACCGGATGG-CGCGC-AAGCTGAGCTGAGC-AACACT-GGGCT-GTCCAC-TTATCCACCCA-CGGCACCTTGTTTCTCCTCAG-TTGTGGCCTTCTT-G--CGACTGTCCTCATAG-ACTCGAGACA-T-CCCCAGACCCG-GGCTAGTAA-CACAGA-GAC-AGCC-GCTGG-TCAGCGGGAGACCGT-TCAAGGTTGTCAGGAAC-TAAAATGTAG-TAAA-AGGAATTATAGATT-AACTT-G-T-CGGTGGG-AG-CGGG--AGTG-TCAATGCCCGA-----TAGGGCCTGTTAGTCCCTT-CCTGTTAT-TTCTCCAAAAGTTTA-CCGGCTTT-TATGGCATCCCG-AA-CATGCTAAA-AATTCCCC--G-T--GTTGAAGGAGGGG-TTAATCCTTTGT-ATGACGTGAGCACAC-TAAA-CCTAAGACA-CGCCTA-GCCAG-GTT--CTCGACG-TCTTGC-GCACCGAGACCGGTGCTGGGGCACCGGCTCG 722 ||||| | || ||||||||| | ||||||||||| ||||||| ||||||||| ||||||||||||||||| || |||||||||| |||||||||| |||||| |||||||||| || |||| | | | ||||| ||| | ||||||| || ||| || ||||||| | |||||||||||||| ||||||||| ||||| ||| | ||||| | ||||||||||||| || | ||||||| |||| |||| |||||||||| ||| | | || || || |||||| ||||||||| || |||||||||||| ||||| |||||||||||||| | |||| ||||| |||||| | |||| |||| |||||||||| |||||||| | ||||||||||||| | ||||||||||||||| || ||||||| | ||||| ||||| ||| ||||| |||||| | | |||| | || ||||||||||||||| || |||||||||| ||| | ||||| || ||| | |||| || | || || || | | ||||||| || |||| |||| |||| |||||| |||||||||||||||||| |||||||| | ||||||||||||| |||||||| || |||||||| || ||||||||| || |||| | | ||||| ||||||| ||| | ||||| |||||| |||||||| |||| ||||||| | |||||| ||||| || ||||||| || || |||||||| ||||||||||||||||||||| 0 AAAAGACTCTGTTTTGCAGGGAG-GGCGAGTGCTACAGAATGTGTAGTCATAAATTCCAGGTTGTCATCTAGAAG--AACCTTTCAGCCAGAACCCGGTGGAACA-AGATACCTGA-AA-GACTGCA-C-TTGGGCATTGA-GACCGACTCGCTCATGTAA-GAGGTTCAGCCCCAAACTGCTGCCGAAGGTGTCC-TGTAC-TCTGT-CCCGG-ACATTTCCGGACTCGCCCGGGGAAGACGATCAAGTTTCAGGGATTGTACG-TGC-TGCTATGCCTATGGTCCCACAGGAGTTATACCAATTACACCGGATGGACGCGCGAAGCTGAGCTGAGCTAGCACTCGGGCTGGTCCACGTGATCC-CCCACCGGCACCTTG-TTCTCCTC-GCTTGTGGCCTTCTTGGCCCGACTGTCCTCATAGTACCCGAGACACTCCCCCA-ACCCGTGGCAAGTAACCACAGAGGTCTAGCCTACGGGTTCAGCGGGAGACCGTCTC-AGGTTGTCAGAAACAT-AAATGAAGCGAAATA-GAATGAT-G-TTAAATTTGGTTACGGTGGGAAGACGGGCTAGTGTTCAAGGCCCGACGGCCAAGGGCCTGTTAGTCCCTTCCCTGTTATGTACTCCAAAAGTTTACCCGGCTTTGTA--GCATCCCGAAACCATGCTAAACAA-ACCCCGGGCTGCGTTGAGGGAGGGGCCTAA-CGTTTGTAATGACG-GAGCACACTTAAATCCTAAGAAAGCGCCTATGCCAGACTTCCCTCGACGCTC-GGCTGCACCGAG--CGGTGCTGGGGCACCGGCTCG 779 [I0:A,D3:A,I11:T,D14:T,I50:A,S52:A->T,D53:T,I118:G,S118:G->C,D119:C,D122:T,S124:G->T,I126:G,I161:C,D162:C,I193:T,I193:G,D194:G,D195:T,I216:C,S218:C->G,D219:G,I229:A,S229:A->T,D230:T,I235:T,D237:T,I240:G,D241:G,D254:T,S255:G->T,I256:G,I286:A,S287:A->T,D289:T,I353:C,D354:C,D364:T,I366:T,I373:C,S373:C->T,D375:T,I389:C,D390:C,I419:C,D420:C,I440:C,D441:C,I447:G,D448:G,I522:A,D523:A,I525:T,D526:T,I530:T,S531:T->A,D532:A,I548:C,S548:C->T,D549:T,I554:T,D555:T,I566:C,I566:G,I566:G,I566:C,S567:G->A,D568:G,D569:C,D570:C,D571:A,I599:G,S599:G->T,S600:T->A,D601:A,I635:A,S637:A->C,D639:C,I656:G,I656:G,S657:G->C,D658:G,D659:C,I661:G,S661:G->C,D662:C,I676:C,D677:C,I681:C,S681:C->G,D682:G,I688:A,D689:A,I703:T,D704:T,I731:A,S731:A->C,D732:C,I735:C,D737:C,I744:C,I744:T,D745:T,S746:C->G,D748:G] 0 -AAAAGACTCTG-TTTTGCAGGGAGGGCGAGTGCTACAGAATGTGTAGTCAT-AAATTCCAGGTTGTCATCTAGAAGAACCTTTCAGCCAGAACCCGGTGGAACAAGATACCTGAAAGACT-GCACTTGG-GCATTGAGACCGACTCGCTCATGTAAGAGGTTCAG-CCCCAAACTGCTGCCGAAGGTGTCCTGTACTC--TGTCCCGGACATTTCCGGACTCG-CCCGGGGAAGACG-ATCAAG-TTTCA-GGGATTGTACGTGCTG-CTATGCCTATGGTCCCACAGGAGTTATACC-AATTACACCGGATGGACGCGCGAAGCTGAGCTGAGCTAGCACTCGGGCTGGTCCACGTGATCCCCCA-CCGGCACCTTGTT-CTCCTCG-CTTGTGGCCTTCTTGG-CCCGACTGTCCTCATAGTACCCGAGACACT-CCCCCAACCCGTGGCAAGTAA-CCACAGA-GGTCTAGCCTACGGGTTCAGCGGGAGACCGTCTCAGGTTGTCAGAAACATAAATGAAGCGAAATAGAATGATGTT-AAA-TTTGG-TTACGGTGGGAAGACGGG-CTAGTG-TTCAAGGCCCGA----CGGCCAAGGGCCTGTTAGTCCCTTCCCTGTTAT-GTACTCCAAAAGTTTACCCGGCTTTGTAGCATCCCG-AAACCATGCTAAACAAACCCC--GGGCT-GCGTTGAGGGAGGGG-CCTAA-CGTTTGT-AATGACGGAGCACAC-TTAAATCCTAAGAAAGCGCCTATGCCAG-ACTT-CCCTCGACG--CTCGGCTGCACCGAGCGGTGCTGGGGCACCGGCTCG 779 ||| ||||||| ||| ||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || | | ||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||| | |||||||||||||||||||| || ||||||||| |||| || || | |||||||||||| |||||||||||||||||||||||||||||| | | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||| | ||||||| | ||||||||||||| | |||||||||||||||||||||||||||| | ||||||||||||||||||| | ||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | | | ||| | ||||||||||||||| |||| | |||||||||| | ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| || | |||||||||||||||| | | ||||||||||||| | ||| ||||| | ||||||||||||| | |||||||||||||||||||||||||| || || |||||| | | ||||||||||||||||||||||||||||||| 0 AAAA-GACTCTGTTTT-GCAGGGAGGGCGAGTGCTACAGAATGTGTAGTCATAAAT-TCCAGGTTGTCATCTAGAAGAACCTTTCAGCCAGAACCCGGTGGAACAAGATACCTGAAAGACTGC-AC-TTGGGCATTGAGACCGACTCGCTCATGTAAGAGGTTCAGCC-CCAAACTGCTGCCGAAGGTGTCCTGTACTCTGT--CCCGGACATTTCCGGACTCGCCCG-GGGAAGACGAT-CAAGTTT-CAGG-GATTGTACGTGC-TGCTATGCCTATGGTCCCACAGGAGTTATACCAATT-ACACCGGATGGACGCGCGAAGCTGAGCTGAGCTAGCACTCGGGCTGGTCCACGTGATCCCCCACC-GGCACCTTG-TTCTCCTCGCTT-GTGGCCTTCTTGGCC-CGACTGTCCTCATAGTACCCGAGACACTCC-CCCAACCCGTGGCAAGTAACC-ACAGAGG-TCTAGCCTACGGGTTCAGCGGGAGACCGTCTCAGGTTGTCAGAAACATAAATGAAGCGAAATAGAATGATGTTAA-ATT-TGGTTA-CGGTGGGAAGACGGGCT-AGTGTT-CAAGGCCCGACGGCCA----AGGGCCTGTTAGTCCCTTCCCTGTTATGTA-CTCCAAAAGTTTACCCGGCTTTGTAGCATCCCGAAACC-ATGCTAAACAAACCCCGGGC--TGC-GTTGAGGGAGGGGCC-TAACG-TTTGTAA-TGACGGAGCACACTT-AAATCCTAAGAAAGCGCCTATGCCAGAC-TTCCC-TCGACGCTC-GG-CTGCACCGAGCGGTGCTGGGGCACCGGCTCG 779 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 210.36us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 155.65us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 126.03us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 76.53us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 125.67us C=2998;I=0;M=1;ScE=0;R=0.0 AlignmentTime = 160.57us C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 129.34us C=2995;I=1;M=1;ScE=0;R=0.0 AlignmentTime = 136.38us com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1626 rTrimmed = 1685 lTrimmed = 2779 rTrimmed = 2812 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4962 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 407.73us Processed queries: 110 Bad percent: 0.0 False positive percent: 0.561612157251404 Scoring error percent: 0.9090909090909091 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1764 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 114 -> T 82 - -32 Q 117 -> T 85 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1308 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 183 -> T 147 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 283 noHits2: 0 noHits3: 0 wrongTopHit: 41 wrongTopHitS: 31 noCorrectHitInList: 23 Timings: DescriptiveStatistics: n: 100000 min: 4767.0 max: 2.23354311E8 mean: 82592.13728000877 std dev: 1439226.1544478203 median: 64897.5 skewness: 111.32572866800612 kurtosis: 13391.349481305935 Clusters basicSize DescriptiveStatistics: n: 99676 min: 1.0 max: 6.0 mean: 2.86918616316867 std dev: 1.0989258425119155 median: 3.0 skewness: 0.29615864700712075 kurtosis: -0.6785434229017251 Top Delta DescriptiveStatistics: n: 99694 min: -30.0 max: 0.0 mean: -0.0011535298011915937 std dev: 0.1461308691881461 median: 0.0 skewness: -149.95687235049414 kurtosis: 25090.75790380757 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 1.34us 1.34us 1.34us com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 6799510 Write time: 92.89ms O. Stats: Wall clock time: 93.22ms Total CPU time: 184.15ms User wait time: 66.54ms Serialization time: 140.64ms (76.38%) Checksum calculation time: 6.24ms (3.39%) Compression time: 33.65ms (18.27%) Total IO delay: 15.42ms Concurrency overhead: 4.45ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 432.3MiB/s Concurrency adjusted uncompressed speed: 341.42MiB/s Actual uncompressed speed: 198.25MiB/s Actual speed: 69.73MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 60.86ms Total CPU time: 106.58ms Serialization time: 46.88ms (43.99%) Checksum calculation time: 6.25ms (5.86%) Compression time: 51.99ms (48.78%) Total IO delay: 9.3ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 720.5MiB/s Concurrency adjusted uncompressed speed: 658.46MiB/s Actual uncompressed speed: 307.28MiB/s Actual speed: 108.08MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 212.59ms Total CPU time: 213.17ms Serialization time: 93.36ms (43.8%) Checksum calculation time: 12.47ms (5.85%) Compression time: 104.64ms (49.09%) Total IO delay: 16.13ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 810.56MiB/s Concurrency adjusted uncompressed speed: 646.91MiB/s Actual uncompressed speed: 173.93MiB/s Actual speed: 61.17MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6791878 Write time: 115.28ms O. Stats: Wall clock time: 115.6ms Total CPU time: 146.96ms User wait time: 95.1ms Serialization time: 103.08ms (70.14%) Checksum calculation time: 6.25ms (4.25%) Compression time: 34.52ms (23.49%) Total IO delay: 32.32ms Concurrency overhead: 6.66ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 202.41MiB/s Concurrency adjusted uncompressed speed: 361.51MiB/s Actual uncompressed speed: 160.32MiB/s Actual speed: 56.32MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 87.3ms Total CPU time: 92.65ms Serialization time: 28.84ms (31.13%) Checksum calculation time: 6.25ms (6.74%) Compression time: 57.44ms (61.99%) Total IO delay: 43.37ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 150.63MiB/s Concurrency adjusted uncompressed speed: 542.26MiB/s Actual uncompressed speed: 211.92MiB/s Actual speed: 74.45MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 173.59ms Total CPU time: 175.18ms Serialization time: 51.36ms (29.32%) Checksum calculation time: 12.58ms (7.18%) Compression time: 110.94ms (63.33%) Total IO delay: 67.56ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 193.35MiB/s Concurrency adjusted uncompressed speed: 614.56MiB/s Actual uncompressed speed: 213.14MiB/s Actual speed: 74.88MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6799510 Write time: 119.14ms O. Stats: Wall clock time: 119.79ms Total CPU time: 92.2ms User wait time: 105.83ms Serialization time: 48.31ms (52.4%) Checksum calculation time: 6.31ms (6.84%) Compression time: 33.81ms (36.67%) Total IO delay: 12.77ms Concurrency overhead: 1.92ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 540.38MiB/s Concurrency adjusted uncompressed speed: 173.93MiB/s Actual uncompressed speed: 154.93MiB/s Actual speed: 54.49MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 50.53ms Total CPU time: 77ms Serialization time: 22.3ms (28.96%) Checksum calculation time: 5.5ms (7.14%) Compression time: 48.52ms (63.01%) Total IO delay: 8.9ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 810.56MiB/s Concurrency adjusted uncompressed speed: 216.9MiB/s Actual uncompressed speed: 368.74MiB/s Actual speed: 129.69MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 105.54ms Total CPU time: 157.12ms Serialization time: 45.07ms (28.68%) Checksum calculation time: 11.38ms (7.25%) Compression time: 98.85ms (62.91%) Total IO delay: 16.87ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 810.56MiB/s Concurrency adjusted uncompressed speed: 213.14MiB/s Actual uncompressed speed: 351.18MiB/s Actual speed: 123.51MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 Write time: 100.67ms O. Stats: Wall clock time: 101.33ms Total CPU time: 79.38ms User wait time: 90.25ms Serialization time: 37.82ms (47.64%) Checksum calculation time: 5.34ms (6.73%) Compression time: 32.91ms (41.46%) Total IO delay: 10.91ms Concurrency overhead: 671.45us Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 647.72MiB/s Concurrency adjusted uncompressed speed: 204.85MiB/s Actual uncompressed speed: 182.54MiB/s Actual speed: 64.13MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 66.43ms Total CPU time: 84.47ms Serialization time: 25.3ms (29.96%) Checksum calculation time: 6.78ms (8.03%) Compression time: 52.2ms (61.8%) Total IO delay: 13.75ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 498.25MiB/s Concurrency adjusted uncompressed speed: 188.13MiB/s Actual uncompressed speed: 279.35MiB/s Actual speed: 98.14MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 148.23ms Total CPU time: 179.56ms Serialization time: 60.72ms (33.82%) Checksum calculation time: 13.04ms (7.26%) Compression time: 105.44ms (58.72%) Total IO delay: 20.41ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 647.72MiB/s Concurrency adjusted uncompressed speed: 185.3MiB/s Actual uncompressed speed: 249.15MiB/s Actual speed: 87.53MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 1.51s O. Stats: Wall clock time: 1.51s Total CPU time: 3.96s User wait time: 1.42s Serialization time: 77.94ms (1.97%) Checksum calculation time: 5.86ms (0.15%) Compression time: 3.87s (97.76%) Total IO delay: 12.5ms Concurrency overhead: 2.79ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 330.31MiB/s Concurrency adjusted uncompressed speed: 18.53MiB/s Actual uncompressed speed: 12.24MiB/s Actual speed: 2.63MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 37.79ms Total CPU time: 71.31ms Serialization time: 20.78ms (29.13%) Checksum calculation time: 5.89ms (8.25%) Compression time: 43.82ms (61.45%) Total IO delay: 5.32ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 792.75MiB/s Concurrency adjusted uncompressed speed: 970.36MiB/s Actual uncompressed speed: 498.29MiB/s Actual speed: 107.13MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 84.58ms Total CPU time: 140.62ms Serialization time: 41.51ms (29.52%) Checksum calculation time: 11.56ms (8.22%) Compression time: 85.89ms (61.08%) Total IO delay: 9.85ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 880.83MiB/s Concurrency adjusted uncompressed speed: 996.59MiB/s Actual uncompressed speed: 438.97MiB/s Actual speed: 94.38MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 3 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 2.28s O. Stats: Wall clock time: 2.28s Total CPU time: 3.8s User wait time: 2.11s Serialization time: 40.02ms (1.05%) Checksum calculation time: 5.78ms (0.15%) Compression time: 3.75s (98.7%) Total IO delay: 8.67ms Concurrency overhead: 1.11ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 488.6MiB/s Concurrency adjusted uncompressed speed: 19.33MiB/s Actual uncompressed speed: 8.08MiB/s Actual speed: 1.71MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 47.1ms Total CPU time: 67.66ms Serialization time: 18.82ms (27.81%) Checksum calculation time: 5.15ms (7.61%) Compression time: 43.55ms (64.37%) Total IO delay: 4.89ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 977.2MiB/s Concurrency adjusted uncompressed speed: 1GiB/s Actual uncompressed speed: 392.27MiB/s Actual speed: 83.17MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 101.7ms Total CPU time: 136.37ms Serialization time: 37.83ms (27.74%) Checksum calculation time: 10.79ms (7.92%) Compression time: 87.47ms (64.14%) Total IO delay: 10.3ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 781.76MiB/s Concurrency adjusted uncompressed speed: 1GiB/s Actual uncompressed speed: 365.09MiB/s Actual speed: 77.4MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 2.89s O. Stats: Wall clock time: 2.89s Total CPU time: 2.76s User wait time: 2.88s Serialization time: 29.95ms (1.08%) Checksum calculation time: 3.59ms (0.13%) Compression time: 2.73s (98.64%) Total IO delay: 116.06ms Concurrency overhead: 2.23ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 34.17MiB/s Concurrency adjusted uncompressed speed: 6.4MiB/s Actual uncompressed speed: 6.37MiB/s Actual speed: 1.37MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 41.7ms Total CPU time: 63.14ms Serialization time: 18.84ms (29.83%) Checksum calculation time: 4.75ms (7.52%) Compression time: 39.04ms (61.82%) Total IO delay: 5.13ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 792.75MiB/s Concurrency adjusted uncompressed speed: 271.13MiB/s Actual uncompressed speed: 449.68MiB/s Actual speed: 96.68MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 87.04ms Total CPU time: 134.36ms Serialization time: 39.45ms (29.36%) Checksum calculation time: 10.44ms (7.77%) Compression time: 83.14ms (61.88%) Total IO delay: 10.21ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 792.75MiB/s Concurrency adjusted uncompressed speed: 256.07MiB/s Actual uncompressed speed: 423.84MiB/s Actual speed: 91.12MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 2.94s O. Stats: Wall clock time: 2.94s Total CPU time: 2.93s User wait time: 2.94s Serialization time: 32.13ms (1.1%) Checksum calculation time: 3.39ms (0.12%) Compression time: 2.89s (98.69%) Total IO delay: 6.78ms Concurrency overhead: 587.02us Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 651.47MiB/s Concurrency adjusted uncompressed speed: 6.28MiB/s Actual uncompressed speed: 6.26MiB/s Actual speed: 1.33MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 52.05ms Total CPU time: 71.22ms Serialization time: 21.78ms (30.59%) Checksum calculation time: 4.86ms (6.83%) Compression time: 44.43ms (62.38%) Total IO delay: 9.23ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 434.31MiB/s Concurrency adjusted uncompressed speed: 230.46MiB/s Actual uncompressed speed: 354.56MiB/s Actual speed: 75.17MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 117.3ms Total CPU time: 149.72ms Serialization time: 42.03ms (28.07%) Checksum calculation time: 14.64ms (9.78%) Compression time: 92.72ms (61.93%) Total IO delay: 25.53ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 312.7MiB/s Concurrency adjusted uncompressed speed: 210.71MiB/s Actual uncompressed speed: 315.16MiB/s Actual speed: 66.82MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 1 / 1 / 1 / 5000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 13000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 17000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 4 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 O. Stats: Wall clock time: 14.41s Total CPU time: 4.41s User wait time: 2.23s Serialization time: 1.25s (28.23%) Checksum calculation time: 668.66ms (15.15%) Compression time: 1.55s (35.03%) Total IO delay: 13.45s Concurrency overhead: 4.8ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 141.84MiB/s Concurrency adjusted uncompressed speed: 852.68MiB/s Actual uncompressed speed: 132.38MiB/s Actual speed: 132.38MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Gradle Test Executor 1 finished executing tests. WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Finished generating test XML results (0.048 secs) into: /build/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.085 secs) into: /build/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 3 mins 5.294 secs. BUILD SUCCESSFUL in 3m 17s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_i386.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_i386.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: user script /srv/workspace/pbuilder/70124/tmp/hooks/B01_cleanup starting I: user script /srv/workspace/pbuilder/70124/tmp/hooks/B01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/70124 and its subdirectories I: Current time: Wed Jun 12 19:55:10 +14 2024 I: pbuilder-time-stamp: 1718171710