I: pbuilder: network access will be disabled during build I: Current time: Thu Dec 30 07:18:58 +14 2021 I: pbuilder-time-stamp: 1640798338 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bullseye-reproducible-base.tgz] I: copying local configuration I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [libedlib_1.2.6-1.dsc] I: copying [./libedlib_1.2.6.orig.tar.gz] I: copying [./libedlib_1.2.6-1.debian.tar.xz] I: Extracting source gpgv: unknown type of key resource 'trustedkeys.kbx' gpgv: keyblock resource '/tmp/dpkg-verify-sig.BHJqbLCF/trustedkeys.kbx': General error gpgv: Signature made Wed Jan 13 06:49:19 2021 +14 gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: failed to verify signature on ./libedlib_1.2.6-1.dsc dpkg-source: info: extracting libedlib in libedlib-1.2.6 dpkg-source: info: unpacking libedlib_1.2.6.orig.tar.gz dpkg-source: info: unpacking libedlib_1.2.6-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying soversion.patch dpkg-source: info: applying do_not_build_hello_example.patch dpkg-source: info: applying cython3.patch dpkg-source: info: applying enable_shared_and_static.patch I: using fakeroot in build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/3301160/tmp/hooks/D01_modify_environment starting debug: Running on ionos1-amd64. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash Removing 'diversion of /bin/sh to /bin/sh.distrib by dash' Adding 'diversion of /bin/sh to /bin/sh.distrib by bash' Removing 'diversion of /usr/share/man/man1/sh.1.gz to /usr/share/man/man1/sh.distrib.1.gz by dash' Adding 'diversion of /usr/share/man/man1/sh.1.gz to /usr/share/man/man1/sh.distrib.1.gz by bash' I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/3301160/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/3301160/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:hostcomplete:interactive_comments:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="1" [2]="4" [3]="1" [4]="release" [5]="x86_64-pc-linux-gnu") BASH_VERSION='5.1.4(1)-release' BUILDDIR=/build BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=amd64 DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all,-fixfilepath parallel=15' DIRSTACK=() DISTRIBUTION= EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=x86_64 HOST_ARCH=amd64 IFS=' ' INVOCATION_ID=3ffa8f9ee05440e688b8d73e0d109f06 LANG=C LANGUAGE=et_EE:et LC_ALL=C MACHTYPE=x86_64-pc-linux-gnu MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnu PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=3301160 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/tmp.3Ue6xkjTh9/pbuilderrc_M6b9 --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bullseye-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/tmp.3Ue6xkjTh9/b2 --logfile b2/build.log libedlib_1.2.6-1.dsc' SUDO_GID=110 SUDO_UID=105 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' http_proxy=http://78.137.99.97:3128 I: uname -a Linux i-capture-the-hostname 5.10.0-10-amd64 #1 SMP Debian 5.10.84-1 (2021-12-08) x86_64 GNU/Linux I: ls -l /bin total 5476 -rwxr-xr-x 1 root root 1234376 Aug 5 10:25 bash -rwxr-xr-x 3 root root 38984 Jul 21 2020 bunzip2 -rwxr-xr-x 3 root root 38984 Jul 21 2020 bzcat lrwxrwxrwx 1 root root 6 Jul 21 2020 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Jul 21 2020 bzdiff lrwxrwxrwx 1 root root 6 Jul 21 2020 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4877 Sep 5 2019 bzexe lrwxrwxrwx 1 root root 6 Jul 21 2020 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Jul 21 2020 bzgrep -rwxr-xr-x 3 root root 38984 Jul 21 2020 bzip2 -rwxr-xr-x 1 root root 18424 Jul 21 2020 bzip2recover lrwxrwxrwx 1 root root 6 Jul 21 2020 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Jul 21 2020 bzmore -rwxr-xr-x 1 root root 43936 Sep 24 2020 cat -rwxr-xr-x 1 root root 72672 Sep 24 2020 chgrp -rwxr-xr-x 1 root root 64448 Sep 24 2020 chmod -rwxr-xr-x 1 root root 72672 Sep 24 2020 chown -rwxr-xr-x 1 root root 151168 Sep 24 2020 cp -rwxr-xr-x 1 root root 125560 Dec 11 2020 dash -rwxr-xr-x 1 root root 113664 Sep 24 2020 date -rwxr-xr-x 1 root root 80968 Sep 24 2020 dd -rwxr-xr-x 1 root root 93936 Sep 24 2020 df -rwxr-xr-x 1 root root 147176 Sep 24 2020 dir -rwxr-xr-x 1 root root 84440 Jul 29 09:09 dmesg lrwxrwxrwx 1 root root 8 Nov 8 2019 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Nov 8 2019 domainname -> hostname -rwxr-xr-x 1 root root 39712 Sep 24 2020 echo -rwxr-xr-x 1 root root 28 Nov 10 2020 egrep -rwxr-xr-x 1 root root 39680 Sep 24 2020 false -rwxr-xr-x 1 root root 28 Nov 10 2020 fgrep -rwxr-xr-x 1 root root 69032 Jul 29 09:09 findmnt -rwsr-xr-x 1 root root 34896 Feb 27 2021 fusermount -rwxr-xr-x 1 root root 203072 Nov 10 2020 grep -rwxr-xr-x 2 root root 2346 Mar 3 2021 gunzip -rwxr-xr-x 1 root root 6376 Mar 3 2021 gzexe -rwxr-xr-x 1 root root 98048 Mar 3 2021 gzip -rwxr-xr-x 1 root root 22600 Nov 8 2019 hostname -rwxr-xr-x 1 root root 72840 Sep 24 2020 ln -rwxr-xr-x 1 root root 56952 Feb 8 2020 login -rwxr-xr-x 1 root root 147176 Sep 24 2020 ls -rwxr-xr-x 1 root root 149736 Jul 29 09:09 lsblk -rwxr-xr-x 1 root root 85184 Sep 24 2020 mkdir -rwxr-xr-x 1 root root 76896 Sep 24 2020 mknod -rwxr-xr-x 1 root root 48064 Sep 24 2020 mktemp -rwxr-xr-x 1 root root 59632 Jul 29 09:09 more -rwsr-xr-x 1 root root 55528 Jul 29 09:09 mount -rwxr-xr-x 1 root root 18664 Jul 29 09:09 mountpoint -rwxr-xr-x 1 root root 147080 Sep 24 2020 mv lrwxrwxrwx 1 root root 8 Nov 8 2019 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 19 2021 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 43872 Sep 24 2020 pwd lrwxrwxrwx 1 root root 4 Aug 5 10:25 rbash -> bash -rwxr-xr-x 1 root root 52032 Sep 24 2020 readlink -rwxr-xr-x 1 root root 72704 Sep 24 2020 rm -rwxr-xr-x 1 root root 52032 Sep 24 2020 rmdir -rwxr-xr-x 1 root root 27472 Sep 28 2020 run-parts -rwxr-xr-x 1 root root 122224 Dec 23 2018 sed lrwxrwxrwx 1 root root 4 Dec 30 07:19 sh -> bash lrwxrwxrwx 1 root root 4 Dec 21 23:25 sh.distrib -> dash -rwxr-xr-x 1 root root 43808 Sep 24 2020 sleep -rwxr-xr-x 1 root root 84928 Sep 24 2020 stty -rwsr-xr-x 1 root root 71912 Jul 29 09:09 su -rwxr-xr-x 1 root root 39744 Sep 24 2020 sync -rwxr-xr-x 1 root root 531928 Feb 17 2021 tar -rwxr-xr-x 1 root root 14456 Sep 28 2020 tempfile -rwxr-xr-x 1 root root 101408 Sep 24 2020 touch -rwxr-xr-x 1 root root 39680 Sep 24 2020 true -rwxr-xr-x 1 root root 14328 Feb 27 2021 ulockmgr_server -rwsr-xr-x 1 root root 35040 Jul 29 09:09 umount -rwxr-xr-x 1 root root 39744 Sep 24 2020 uname -rwxr-xr-x 2 root root 2346 Mar 3 2021 uncompress -rwxr-xr-x 1 root root 147176 Sep 24 2020 vdir -rwxr-xr-x 1 root root 63744 Jul 29 09:09 wdctl lrwxrwxrwx 1 root root 8 Nov 8 2019 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Mar 3 2021 zcat -rwxr-xr-x 1 root root 1678 Mar 3 2021 zcmp -rwxr-xr-x 1 root root 5880 Mar 3 2021 zdiff -rwxr-xr-x 1 root root 29 Mar 3 2021 zegrep -rwxr-xr-x 1 root root 29 Mar 3 2021 zfgrep -rwxr-xr-x 1 root root 2081 Mar 3 2021 zforce -rwxr-xr-x 1 root root 7585 Mar 3 2021 zgrep -rwxr-xr-x 1 root root 2206 Mar 3 2021 zless -rwxr-xr-x 1 root root 1842 Mar 3 2021 zmore -rwxr-xr-x 1 root root 4553 Mar 3 2021 znew I: user script /srv/workspace/pbuilder/3301160/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: amd64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19655 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 12); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on cmake; however: Package cmake is not installed. pbuilder-satisfydepends-dummy depends on dh-python; however: Package dh-python is not installed. pbuilder-satisfydepends-dummy depends on d-shlibs; however: Package d-shlibs is not installed. pbuilder-satisfydepends-dummy depends on rename; however: Package rename is not installed. pbuilder-satisfydepends-dummy depends on cython3; however: Package cython3 is not installed. pbuilder-satisfydepends-dummy depends on python3-all-dev; however: Package python3-all-dev is not installed. pbuilder-satisfydepends-dummy depends on python3-setuptools; however: Package python3-setuptools is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: autoconf{a} automake{a} autopoint{a} autotools-dev{a} bsdextrautils{a} cmake{a} cmake-data{a} cython3{a} d-shlibs{a} debhelper{a} dh-autoreconf{a} dh-python{a} dh-strip-nondeterminism{a} dwz{a} file{a} gettext{a} gettext-base{a} groff-base{a} intltool-debian{a} libarchive-zip-perl{a} libarchive13{a} libbrotli1{a} libcurl4{a} libdebhelper-perl{a} libelf1{a} libexpat1{a} libexpat1-dev{a} libfile-stripnondeterminism-perl{a} libicu67{a} libjs-jquery{a} libjs-sphinxdoc{a} libjs-underscore{a} libjsoncpp24{a} libldap-2.4-2{a} libmagic-mgc{a} libmagic1{a} libmpdec3{a} libncurses6{a} libnghttp2-14{a} libpipeline1{a} libprocps8{a} libpsl5{a} libpython3-all-dev{a} libpython3-dev{a} libpython3-stdlib{a} libpython3.9{a} libpython3.9-dev{a} libpython3.9-minimal{a} libpython3.9-stdlib{a} libreadline8{a} librhash0{a} librtmp1{a} libsasl2-2{a} libsasl2-modules-db{a} libsigsegv2{a} libssh2-1{a} libsub-override-perl{a} libtool{a} libuchardet0{a} libuv1{a} libxml2{a} m4{a} man-db{a} media-types{a} po-debconf{a} procps{a} python3{a} python3-all{a} python3-all-dev{a} python3-dev{a} python3-distutils{a} python3-lib2to3{a} python3-minimal{a} python3-pkg-resources{a} python3-setuptools{a} python3.9{a} python3.9-dev{a} python3.9-minimal{a} readline-common{a} rename{a} sensible-utils{a} zlib1g-dev{a} The following packages are RECOMMENDED but will NOT be installed: ca-certificates curl javascript-common libarchive-cpio-perl libgpm2 libio-stringy-perl libldap-common libltdl-dev libmail-sendmail-perl libpod-parser-perl libsasl2-modules lynx psmisc publicsuffix wget 0 packages upgraded, 82 newly installed, 0 to remove and 0 not upgraded. Need to get 43.2 MB of archives. After unpacking 168 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bullseye/main amd64 bsdextrautils amd64 2.36.1-8 [145 kB] Get: 2 http://deb.debian.org/debian bullseye/main amd64 libuchardet0 amd64 0.0.7-1 [67.8 kB] Get: 3 http://deb.debian.org/debian bullseye/main amd64 groff-base amd64 1.22.4-6 [936 kB] Get: 4 http://deb.debian.org/debian bullseye/main amd64 libpipeline1 amd64 1.5.3-1 [34.3 kB] Get: 5 http://deb.debian.org/debian bullseye/main amd64 man-db amd64 2.9.4-2 [1354 kB] Get: 6 http://deb.debian.org/debian bullseye/main amd64 libpython3.9-minimal amd64 3.9.2-1 [801 kB] Get: 7 http://deb.debian.org/debian bullseye/main amd64 libexpat1 amd64 2.2.10-2 [96.9 kB] Get: 8 http://deb.debian.org/debian bullseye/main amd64 python3.9-minimal amd64 3.9.2-1 [1955 kB] Get: 9 http://deb.debian.org/debian bullseye/main amd64 python3-minimal amd64 3.9.2-3 [38.2 kB] Get: 10 http://deb.debian.org/debian bullseye/main amd64 media-types all 4.0.0 [30.3 kB] Get: 11 http://deb.debian.org/debian bullseye/main amd64 libmpdec3 amd64 2.5.1-1 [87.7 kB] Get: 12 http://deb.debian.org/debian bullseye/main amd64 readline-common all 8.1-1 [73.7 kB] Get: 13 http://deb.debian.org/debian bullseye/main amd64 libreadline8 amd64 8.1-1 [169 kB] Get: 14 http://deb.debian.org/debian bullseye/main amd64 libpython3.9-stdlib amd64 3.9.2-1 [1684 kB] Get: 15 http://deb.debian.org/debian bullseye/main amd64 python3.9 amd64 3.9.2-1 [466 kB] Get: 16 http://deb.debian.org/debian bullseye/main amd64 libpython3-stdlib amd64 3.9.2-3 [21.4 kB] Get: 17 http://deb.debian.org/debian bullseye/main amd64 python3 amd64 3.9.2-3 [37.9 kB] Get: 18 http://deb.debian.org/debian bullseye/main amd64 libncurses6 amd64 6.2+20201114-2 [102 kB] Get: 19 http://deb.debian.org/debian bullseye/main amd64 libprocps8 amd64 2:3.3.17-5 [63.9 kB] Get: 20 http://deb.debian.org/debian bullseye/main amd64 procps amd64 2:3.3.17-5 [502 kB] Get: 21 http://deb.debian.org/debian bullseye/main amd64 sensible-utils all 0.0.14 [14.8 kB] Get: 22 http://deb.debian.org/debian bullseye/main amd64 libmagic-mgc amd64 1:5.39-3 [273 kB] Get: 23 http://deb.debian.org/debian bullseye/main amd64 libmagic1 amd64 1:5.39-3 [126 kB] Get: 24 http://deb.debian.org/debian bullseye/main amd64 file amd64 1:5.39-3 [69.1 kB] Get: 25 http://deb.debian.org/debian bullseye/main amd64 gettext-base amd64 0.21-4 [175 kB] Get: 26 http://deb.debian.org/debian bullseye/main amd64 libsigsegv2 amd64 2.13-1 [34.8 kB] Get: 27 http://deb.debian.org/debian bullseye/main amd64 m4 amd64 1.4.18-5 [204 kB] Get: 28 http://deb.debian.org/debian bullseye/main amd64 autoconf all 2.69-14 [313 kB] Get: 29 http://deb.debian.org/debian bullseye/main amd64 autotools-dev all 20180224.1+nmu1 [77.1 kB] Get: 30 http://deb.debian.org/debian bullseye/main amd64 automake all 1:1.16.3-2 [814 kB] Get: 31 http://deb.debian.org/debian bullseye/main amd64 autopoint all 0.21-4 [510 kB] Get: 32 http://deb.debian.org/debian bullseye/main amd64 cmake-data all 3.18.4-2+deb11u1 [1725 kB] Get: 33 http://deb.debian.org/debian bullseye/main amd64 libicu67 amd64 67.1-7 [8622 kB] Get: 34 http://deb.debian.org/debian bullseye/main amd64 libxml2 amd64 2.9.10+dfsg-6.7 [693 kB] Get: 35 http://deb.debian.org/debian bullseye/main amd64 libarchive13 amd64 3.4.3-2+b1 [343 kB] Get: 36 http://deb.debian.org/debian bullseye/main amd64 libbrotli1 amd64 1.0.9-2+b2 [279 kB] Get: 37 http://deb.debian.org/debian bullseye/main amd64 libsasl2-modules-db amd64 2.1.27+dfsg-2.1 [69.1 kB] Get: 38 http://deb.debian.org/debian bullseye/main amd64 libsasl2-2 amd64 2.1.27+dfsg-2.1 [106 kB] Get: 39 http://deb.debian.org/debian bullseye/main amd64 libldap-2.4-2 amd64 2.4.57+dfsg-3 [232 kB] Get: 40 http://deb.debian.org/debian bullseye/main amd64 libnghttp2-14 amd64 1.43.0-1 [77.1 kB] Get: 41 http://deb.debian.org/debian bullseye/main amd64 libpsl5 amd64 0.21.0-1.2 [57.3 kB] Get: 42 http://deb.debian.org/debian bullseye/main amd64 librtmp1 amd64 2.4+20151223.gitfa8646d.1-2+b2 [60.8 kB] Get: 43 http://deb.debian.org/debian bullseye/main amd64 libssh2-1 amd64 1.9.0-2 [156 kB] Get: 44 http://deb.debian.org/debian bullseye/main amd64 libcurl4 amd64 7.74.0-1.3+deb11u1 [341 kB] Get: 45 http://deb.debian.org/debian bullseye/main amd64 libjsoncpp24 amd64 1.9.4-4 [78.9 kB] Get: 46 http://deb.debian.org/debian bullseye/main amd64 librhash0 amd64 1.4.1-2 [129 kB] Get: 47 http://deb.debian.org/debian bullseye/main amd64 libuv1 amd64 1.40.0-2 [132 kB] Get: 48 http://deb.debian.org/debian bullseye/main amd64 cmake amd64 3.18.4-2+deb11u1 [5593 kB] Get: 49 http://deb.debian.org/debian bullseye/main amd64 cython3 amd64 0.29.21-3+b1 [1312 kB] Get: 50 http://deb.debian.org/debian bullseye/main amd64 d-shlibs all 0.98 [17.9 kB] Get: 51 http://deb.debian.org/debian bullseye/main amd64 libdebhelper-perl all 13.3.4 [189 kB] Get: 52 http://deb.debian.org/debian bullseye/main amd64 libtool all 2.4.6-15 [513 kB] Get: 53 http://deb.debian.org/debian bullseye/main amd64 dh-autoreconf all 20 [17.1 kB] Get: 54 http://deb.debian.org/debian bullseye/main amd64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 55 http://deb.debian.org/debian bullseye/main amd64 libsub-override-perl all 0.09-2 [10.2 kB] Get: 56 http://deb.debian.org/debian bullseye/main amd64 libfile-stripnondeterminism-perl all 1.12.0-1 [26.3 kB] Get: 57 http://deb.debian.org/debian bullseye/main amd64 dh-strip-nondeterminism all 1.12.0-1 [15.4 kB] Get: 58 http://deb.debian.org/debian bullseye/main amd64 libelf1 amd64 0.183-1 [165 kB] Get: 59 http://deb.debian.org/debian bullseye/main amd64 dwz amd64 0.13+20210201-1 [175 kB] Get: 60 http://deb.debian.org/debian bullseye/main amd64 gettext amd64 0.21-4 [1311 kB] Get: 61 http://deb.debian.org/debian bullseye/main amd64 intltool-debian all 0.35.0+20060710.5 [26.8 kB] Get: 62 http://deb.debian.org/debian bullseye/main amd64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 63 http://deb.debian.org/debian bullseye/main amd64 debhelper all 13.3.4 [1049 kB] Get: 64 http://deb.debian.org/debian bullseye/main amd64 python3-lib2to3 all 3.9.2-1 [77.8 kB] Get: 65 http://deb.debian.org/debian bullseye/main amd64 python3-distutils all 3.9.2-1 [143 kB] Get: 66 http://deb.debian.org/debian bullseye/main amd64 dh-python all 4.20201102+nmu1 [99.4 kB] Get: 67 http://deb.debian.org/debian bullseye/main amd64 libexpat1-dev amd64 2.2.10-2 [140 kB] Get: 68 http://deb.debian.org/debian bullseye/main amd64 libjs-jquery all 3.5.1+dfsg+~3.5.5-7 [315 kB] Get: 69 http://deb.debian.org/debian bullseye/main amd64 libjs-underscore all 1.9.1~dfsg-3 [100 kB] Get: 70 http://deb.debian.org/debian bullseye/main amd64 libjs-sphinxdoc all 3.4.3-2 [127 kB] Get: 71 http://deb.debian.org/debian bullseye/main amd64 libpython3.9 amd64 3.9.2-1 [1691 kB] Get: 72 http://deb.debian.org/debian bullseye/main amd64 libpython3.9-dev amd64 3.9.2-1 [4028 kB] Get: 73 http://deb.debian.org/debian bullseye/main amd64 libpython3-dev amd64 3.9.2-3 [21.7 kB] Get: 74 http://deb.debian.org/debian bullseye/main amd64 libpython3-all-dev amd64 3.9.2-3 [1068 B] Get: 75 http://deb.debian.org/debian bullseye/main amd64 python3-all amd64 3.9.2-3 [1056 B] Get: 76 http://deb.debian.org/debian bullseye/main amd64 zlib1g-dev amd64 1:1.2.11.dfsg-2 [190 kB] Get: 77 http://deb.debian.org/debian bullseye/main amd64 python3.9-dev amd64 3.9.2-1 [515 kB] Get: 78 http://deb.debian.org/debian bullseye/main amd64 python3-dev amd64 3.9.2-3 [24.8 kB] Get: 79 http://deb.debian.org/debian bullseye/main amd64 python3-all-dev amd64 3.9.2-3 [1064 B] Get: 80 http://deb.debian.org/debian bullseye/main amd64 python3-pkg-resources all 52.0.0-4 [190 kB] Get: 81 http://deb.debian.org/debian bullseye/main amd64 python3-setuptools all 52.0.0-4 [366 kB] Get: 82 http://deb.debian.org/debian bullseye/main amd64 rename all 1.13-1 [18.0 kB] Fetched 43.2 MB in 1s (63.5 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package bsdextrautils. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19655 files and directories currently installed.) Preparing to unpack .../0-bsdextrautils_2.36.1-8_amd64.deb ... Unpacking bsdextrautils (2.36.1-8) ... Selecting previously unselected package libuchardet0:amd64. Preparing to unpack .../1-libuchardet0_0.0.7-1_amd64.deb ... Unpacking libuchardet0:amd64 (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../2-groff-base_1.22.4-6_amd64.deb ... Unpacking groff-base (1.22.4-6) ... Selecting previously unselected package libpipeline1:amd64. Preparing to unpack .../3-libpipeline1_1.5.3-1_amd64.deb ... Unpacking libpipeline1:amd64 (1.5.3-1) ... Selecting previously unselected package man-db. Preparing to unpack .../4-man-db_2.9.4-2_amd64.deb ... Unpacking man-db (2.9.4-2) ... Selecting previously unselected package libpython3.9-minimal:amd64. Preparing to unpack .../5-libpython3.9-minimal_3.9.2-1_amd64.deb ... Unpacking libpython3.9-minimal:amd64 (3.9.2-1) ... Selecting previously unselected package libexpat1:amd64. Preparing to unpack .../6-libexpat1_2.2.10-2_amd64.deb ... Unpacking libexpat1:amd64 (2.2.10-2) ... Selecting previously unselected package python3.9-minimal. Preparing to unpack .../7-python3.9-minimal_3.9.2-1_amd64.deb ... Unpacking python3.9-minimal (3.9.2-1) ... Setting up libpython3.9-minimal:amd64 (3.9.2-1) ... Setting up libexpat1:amd64 (2.2.10-2) ... Setting up python3.9-minimal (3.9.2-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20522 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.9.2-3_amd64.deb ... Unpacking python3-minimal (3.9.2-3) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_4.0.0_all.deb ... Unpacking media-types (4.0.0) ... Selecting previously unselected package libmpdec3:amd64. Preparing to unpack .../2-libmpdec3_2.5.1-1_amd64.deb ... Unpacking libmpdec3:amd64 (2.5.1-1) ... Selecting previously unselected package readline-common. Preparing to unpack .../3-readline-common_8.1-1_all.deb ... Unpacking readline-common (8.1-1) ... Selecting previously unselected package libreadline8:amd64. Preparing to unpack .../4-libreadline8_8.1-1_amd64.deb ... Unpacking libreadline8:amd64 (8.1-1) ... Selecting previously unselected package libpython3.9-stdlib:amd64. Preparing to unpack .../5-libpython3.9-stdlib_3.9.2-1_amd64.deb ... Unpacking libpython3.9-stdlib:amd64 (3.9.2-1) ... Selecting previously unselected package python3.9. Preparing to unpack .../6-python3.9_3.9.2-1_amd64.deb ... Unpacking python3.9 (3.9.2-1) ... Selecting previously unselected package libpython3-stdlib:amd64. Preparing to unpack .../7-libpython3-stdlib_3.9.2-3_amd64.deb ... Unpacking libpython3-stdlib:amd64 (3.9.2-3) ... Setting up python3-minimal (3.9.2-3) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20943 files and directories currently installed.) Preparing to unpack .../00-python3_3.9.2-3_amd64.deb ... Unpacking python3 (3.9.2-3) ... Selecting previously unselected package libncurses6:amd64. Preparing to unpack .../01-libncurses6_6.2+20201114-2_amd64.deb ... Unpacking libncurses6:amd64 (6.2+20201114-2) ... Selecting previously unselected package libprocps8:amd64. Preparing to unpack .../02-libprocps8_2%3a3.3.17-5_amd64.deb ... Unpacking libprocps8:amd64 (2:3.3.17-5) ... Selecting previously unselected package procps. Preparing to unpack .../03-procps_2%3a3.3.17-5_amd64.deb ... Unpacking procps (2:3.3.17-5) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../04-sensible-utils_0.0.14_all.deb ... Unpacking sensible-utils (0.0.14) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../05-libmagic-mgc_1%3a5.39-3_amd64.deb ... Unpacking libmagic-mgc (1:5.39-3) ... Selecting previously unselected package libmagic1:amd64. Preparing to unpack .../06-libmagic1_1%3a5.39-3_amd64.deb ... Unpacking libmagic1:amd64 (1:5.39-3) ... Selecting previously unselected package file. Preparing to unpack .../07-file_1%3a5.39-3_amd64.deb ... Unpacking file (1:5.39-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../08-gettext-base_0.21-4_amd64.deb ... Unpacking gettext-base (0.21-4) ... Selecting previously unselected package libsigsegv2:amd64. Preparing to unpack .../09-libsigsegv2_2.13-1_amd64.deb ... Unpacking libsigsegv2:amd64 (2.13-1) ... Selecting previously unselected package m4. Preparing to unpack .../10-m4_1.4.18-5_amd64.deb ... Unpacking m4 (1.4.18-5) ... Selecting previously unselected package autoconf. Preparing to unpack .../11-autoconf_2.69-14_all.deb ... Unpacking autoconf (2.69-14) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../12-autotools-dev_20180224.1+nmu1_all.deb ... Unpacking autotools-dev (20180224.1+nmu1) ... Selecting previously unselected package automake. Preparing to unpack .../13-automake_1%3a1.16.3-2_all.deb ... Unpacking automake (1:1.16.3-2) ... Selecting previously unselected package autopoint. Preparing to unpack .../14-autopoint_0.21-4_all.deb ... Unpacking autopoint (0.21-4) ... Selecting previously unselected package cmake-data. Preparing to unpack .../15-cmake-data_3.18.4-2+deb11u1_all.deb ... Unpacking cmake-data (3.18.4-2+deb11u1) ... Selecting previously unselected package libicu67:amd64. Preparing to unpack .../16-libicu67_67.1-7_amd64.deb ... Unpacking libicu67:amd64 (67.1-7) ... Selecting previously unselected package libxml2:amd64. Preparing to unpack .../17-libxml2_2.9.10+dfsg-6.7_amd64.deb ... Unpacking libxml2:amd64 (2.9.10+dfsg-6.7) ... Selecting previously unselected package libarchive13:amd64. Preparing to unpack .../18-libarchive13_3.4.3-2+b1_amd64.deb ... Unpacking libarchive13:amd64 (3.4.3-2+b1) ... Selecting previously unselected package libbrotli1:amd64. Preparing to unpack .../19-libbrotli1_1.0.9-2+b2_amd64.deb ... Unpacking libbrotli1:amd64 (1.0.9-2+b2) ... Selecting previously unselected package libsasl2-modules-db:amd64. Preparing to unpack .../20-libsasl2-modules-db_2.1.27+dfsg-2.1_amd64.deb ... Unpacking libsasl2-modules-db:amd64 (2.1.27+dfsg-2.1) ... Selecting previously unselected package libsasl2-2:amd64. Preparing to unpack .../21-libsasl2-2_2.1.27+dfsg-2.1_amd64.deb ... Unpacking libsasl2-2:amd64 (2.1.27+dfsg-2.1) ... Selecting previously unselected package libldap-2.4-2:amd64. Preparing to unpack .../22-libldap-2.4-2_2.4.57+dfsg-3_amd64.deb ... Unpacking libldap-2.4-2:amd64 (2.4.57+dfsg-3) ... Selecting previously unselected package libnghttp2-14:amd64. Preparing to unpack .../23-libnghttp2-14_1.43.0-1_amd64.deb ... Unpacking libnghttp2-14:amd64 (1.43.0-1) ... Selecting previously unselected package libpsl5:amd64. Preparing to unpack .../24-libpsl5_0.21.0-1.2_amd64.deb ... Unpacking libpsl5:amd64 (0.21.0-1.2) ... Selecting previously unselected package librtmp1:amd64. Preparing to unpack .../25-librtmp1_2.4+20151223.gitfa8646d.1-2+b2_amd64.deb ... Unpacking librtmp1:amd64 (2.4+20151223.gitfa8646d.1-2+b2) ... Selecting previously unselected package libssh2-1:amd64. Preparing to unpack .../26-libssh2-1_1.9.0-2_amd64.deb ... Unpacking libssh2-1:amd64 (1.9.0-2) ... Selecting previously unselected package libcurl4:amd64. Preparing to unpack .../27-libcurl4_7.74.0-1.3+deb11u1_amd64.deb ... Unpacking libcurl4:amd64 (7.74.0-1.3+deb11u1) ... Selecting previously unselected package libjsoncpp24:amd64. Preparing to unpack .../28-libjsoncpp24_1.9.4-4_amd64.deb ... Unpacking libjsoncpp24:amd64 (1.9.4-4) ... Selecting previously unselected package librhash0:amd64. Preparing to unpack .../29-librhash0_1.4.1-2_amd64.deb ... Unpacking librhash0:amd64 (1.4.1-2) ... Selecting previously unselected package libuv1:amd64. Preparing to unpack .../30-libuv1_1.40.0-2_amd64.deb ... Unpacking libuv1:amd64 (1.40.0-2) ... Selecting previously unselected package cmake. Preparing to unpack .../31-cmake_3.18.4-2+deb11u1_amd64.deb ... Unpacking cmake (3.18.4-2+deb11u1) ... Selecting previously unselected package cython3. Preparing to unpack .../32-cython3_0.29.21-3+b1_amd64.deb ... Unpacking cython3 (0.29.21-3+b1) ... Selecting previously unselected package d-shlibs. Preparing to unpack .../33-d-shlibs_0.98_all.deb ... Unpacking d-shlibs (0.98) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../34-libdebhelper-perl_13.3.4_all.deb ... Unpacking libdebhelper-perl (13.3.4) ... Selecting previously unselected package libtool. Preparing to unpack .../35-libtool_2.4.6-15_all.deb ... Unpacking libtool (2.4.6-15) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../36-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../37-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../38-libsub-override-perl_0.09-2_all.deb ... Unpacking libsub-override-perl (0.09-2) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../39-libfile-stripnondeterminism-perl_1.12.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.12.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../40-dh-strip-nondeterminism_1.12.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.12.0-1) ... Selecting previously unselected package libelf1:amd64. Preparing to unpack .../41-libelf1_0.183-1_amd64.deb ... Unpacking libelf1:amd64 (0.183-1) ... Selecting previously unselected package dwz. Preparing to unpack .../42-dwz_0.13+20210201-1_amd64.deb ... Unpacking dwz (0.13+20210201-1) ... Selecting previously unselected package gettext. Preparing to unpack .../43-gettext_0.21-4_amd64.deb ... Unpacking gettext (0.21-4) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../44-intltool-debian_0.35.0+20060710.5_all.deb ... Unpacking intltool-debian (0.35.0+20060710.5) ... Selecting previously unselected package po-debconf. Preparing to unpack .../45-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../46-debhelper_13.3.4_all.deb ... Unpacking debhelper (13.3.4) ... Selecting previously unselected package python3-lib2to3. Preparing to unpack .../47-python3-lib2to3_3.9.2-1_all.deb ... Unpacking python3-lib2to3 (3.9.2-1) ... Selecting previously unselected package python3-distutils. Preparing to unpack .../48-python3-distutils_3.9.2-1_all.deb ... Unpacking python3-distutils (3.9.2-1) ... Selecting previously unselected package dh-python. Preparing to unpack .../49-dh-python_4.20201102+nmu1_all.deb ... Unpacking dh-python (4.20201102+nmu1) ... Selecting previously unselected package libexpat1-dev:amd64. Preparing to unpack .../50-libexpat1-dev_2.2.10-2_amd64.deb ... Unpacking libexpat1-dev:amd64 (2.2.10-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../51-libjs-jquery_3.5.1+dfsg+~3.5.5-7_all.deb ... Unpacking libjs-jquery (3.5.1+dfsg+~3.5.5-7) ... Selecting previously unselected package libjs-underscore. Preparing to unpack .../52-libjs-underscore_1.9.1~dfsg-3_all.deb ... Unpacking libjs-underscore (1.9.1~dfsg-3) ... Selecting previously unselected package libjs-sphinxdoc. Preparing to unpack .../53-libjs-sphinxdoc_3.4.3-2_all.deb ... Unpacking libjs-sphinxdoc (3.4.3-2) ... Selecting previously unselected package libpython3.9:amd64. Preparing to unpack .../54-libpython3.9_3.9.2-1_amd64.deb ... Unpacking libpython3.9:amd64 (3.9.2-1) ... Selecting previously unselected package libpython3.9-dev:amd64. Preparing to unpack .../55-libpython3.9-dev_3.9.2-1_amd64.deb ... Unpacking libpython3.9-dev:amd64 (3.9.2-1) ... Selecting previously unselected package libpython3-dev:amd64. Preparing to unpack .../56-libpython3-dev_3.9.2-3_amd64.deb ... Unpacking libpython3-dev:amd64 (3.9.2-3) ... Selecting previously unselected package libpython3-all-dev:amd64. Preparing to unpack .../57-libpython3-all-dev_3.9.2-3_amd64.deb ... Unpacking libpython3-all-dev:amd64 (3.9.2-3) ... Selecting previously unselected package python3-all. Preparing to unpack .../58-python3-all_3.9.2-3_amd64.deb ... Unpacking python3-all (3.9.2-3) ... Selecting previously unselected package zlib1g-dev:amd64. Preparing to unpack .../59-zlib1g-dev_1%3a1.2.11.dfsg-2_amd64.deb ... Unpacking zlib1g-dev:amd64 (1:1.2.11.dfsg-2) ... Selecting previously unselected package python3.9-dev. Preparing to unpack .../60-python3.9-dev_3.9.2-1_amd64.deb ... Unpacking python3.9-dev (3.9.2-1) ... Selecting previously unselected package python3-dev. Preparing to unpack .../61-python3-dev_3.9.2-3_amd64.deb ... Unpacking python3-dev (3.9.2-3) ... Selecting previously unselected package python3-all-dev. Preparing to unpack .../62-python3-all-dev_3.9.2-3_amd64.deb ... Unpacking python3-all-dev (3.9.2-3) ... Selecting previously unselected package python3-pkg-resources. Preparing to unpack .../63-python3-pkg-resources_52.0.0-4_all.deb ... Unpacking python3-pkg-resources (52.0.0-4) ... Selecting previously unselected package python3-setuptools. Preparing to unpack .../64-python3-setuptools_52.0.0-4_all.deb ... Unpacking python3-setuptools (52.0.0-4) ... Selecting previously unselected package rename. Preparing to unpack .../65-rename_1.13-1_all.deb ... Unpacking rename (1.13-1) ... Setting up media-types (4.0.0) ... Setting up libpipeline1:amd64 (1.5.3-1) ... Setting up libpsl5:amd64 (0.21.0-1.2) ... Setting up bsdextrautils (2.36.1-8) ... update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode Setting up libicu67:amd64 (67.1-7) ... Setting up libmagic-mgc (1:5.39-3) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libdebhelper-perl (13.3.4) ... Setting up libbrotli1:amd64 (1.0.9-2+b2) ... Setting up libnghttp2-14:amd64 (1.43.0-1) ... Setting up libmagic1:amd64 (1:5.39-3) ... Setting up gettext-base (0.21-4) ... Setting up rename (1.13-1) ... update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode Setting up file (1:5.39-3) ... Setting up libsasl2-modules-db:amd64 (2.1.27+dfsg-2.1) ... Setting up autotools-dev (20180224.1+nmu1) ... Setting up libuv1:amd64 (1.40.0-2) ... Setting up libexpat1-dev:amd64 (2.2.10-2) ... Setting up librtmp1:amd64 (2.4+20151223.gitfa8646d.1-2+b2) ... Setting up libncurses6:amd64 (6.2+20201114-2) ... Setting up libsigsegv2:amd64 (2.13-1) ... Setting up autopoint (0.21-4) ... Setting up d-shlibs (0.98) ... Setting up libsasl2-2:amd64 (2.1.27+dfsg-2.1) ... Setting up libjsoncpp24:amd64 (1.9.4-4) ... Setting up zlib1g-dev:amd64 (1:1.2.11.dfsg-2) ... Setting up sensible-utils (0.0.14) ... Setting up librhash0:amd64 (1.4.1-2) ... Setting up libuchardet0:amd64 (0.0.7-1) ... Setting up libmpdec3:amd64 (2.5.1-1) ... Setting up libsub-override-perl (0.09-2) ... Setting up libssh2-1:amd64 (1.9.0-2) ... Setting up cmake-data (3.18.4-2+deb11u1) ... Setting up libjs-jquery (3.5.1+dfsg+~3.5.5-7) ... Setting up libelf1:amd64 (0.183-1) ... Setting up readline-common (8.1-1) ... Setting up libxml2:amd64 (2.9.10+dfsg-6.7) ... Setting up libprocps8:amd64 (2:3.3.17-5) ... Setting up libjs-underscore (1.9.1~dfsg-3) ... Setting up libfile-stripnondeterminism-perl (1.12.0-1) ... Setting up gettext (0.21-4) ... Setting up libtool (2.4.6-15) ... Setting up libarchive13:amd64 (3.4.3-2+b1) ... Setting up libreadline8:amd64 (8.1-1) ... Setting up libldap-2.4-2:amd64 (2.4.57+dfsg-3) ... Setting up m4 (1.4.18-5) ... Setting up intltool-debian (0.35.0+20060710.5) ... Setting up libjs-sphinxdoc (3.4.3-2) ... Setting up autoconf (2.69-14) ... Setting up dh-strip-nondeterminism (1.12.0-1) ... Setting up dwz (0.13+20210201-1) ... Setting up groff-base (1.22.4-6) ... Setting up procps (2:3.3.17-5) ... Setting up libcurl4:amd64 (7.74.0-1.3+deb11u1) ... Setting up libpython3.9-stdlib:amd64 (3.9.2-1) ... Setting up libpython3-stdlib:amd64 (3.9.2-3) ... Setting up automake (1:1.16.3-2) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up po-debconf (1.0.21+nmu1) ... Setting up man-db (2.9.4-2) ... Not building database; man-db/auto-update is not 'true'. Setting up dh-autoreconf (20) ... Setting up libpython3.9:amd64 (3.9.2-1) ... Setting up cmake (3.18.4-2+deb11u1) ... Setting up python3.9 (3.9.2-1) ... Setting up libpython3.9-dev:amd64 (3.9.2-1) ... Setting up debhelper (13.3.4) ... Setting up python3 (3.9.2-3) ... Setting up cython3 (0.29.21-3+b1) ... Setting up python3.9-dev (3.9.2-1) ... Setting up python3-lib2to3 (3.9.2-1) ... Setting up python3-pkg-resources (52.0.0-4) ... Setting up python3-distutils (3.9.2-1) ... Setting up dh-python (4.20201102+nmu1) ... Setting up libpython3-dev:amd64 (3.9.2-3) ... Setting up python3-setuptools (52.0.0-4) ... Setting up python3-all (3.9.2-3) ... Setting up libpython3-all-dev:amd64 (3.9.2-3) ... Setting up python3-dev (3.9.2-3) ... Setting up python3-all-dev (3.9.2-3) ... Processing triggers for libc-bin (2.31-13+deb11u2) ... Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps Reading package lists... Building dependency tree... Reading state information... fakeroot is already the newest version (1.25.3-1.1). 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. I: Building the package hostname: Name or service not known I: Running cd /build/libedlib-1.2.6/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../libedlib_1.2.6-1_source.changes dpkg-buildpackage: info: source package libedlib dpkg-buildpackage: info: source version 1.2.6-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Andreas Tille dpkg-source --before-build . dpkg-buildpackage: info: host architecture amd64 fakeroot debian/rules clean dh clean --with python3 dh_clean debian/rules build make: 'build' is up to date. fakeroot debian/rules binary dh binary --with python3 dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/libedlib-1.2.6' dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release cd obj-x86_64-linux-gnu && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/x86_64-linux-gnu -DCMAKE_BUILD_TYPE=Release .. -- The C compiler identification is GNU 10.2.1 -- The CXX compiler identification is GNU 10.2.1 -- Detecting C compiler ABI info -- Detecting C compiler ABI info - done -- Check for working C compiler: /usr/bin/cc - skipped -- Detecting C compile features -- Detecting C compile features - done -- Detecting CXX compiler ABI info -- Detecting CXX compiler ABI info - done -- Check for working CXX compiler: /usr/bin/c++ - skipped -- Detecting CXX compile features -- Detecting CXX compile features - done Setting warning flags -- Performing Test WOLD_STYLE_CAST -- Performing Test WOLD_STYLE_CAST - Success -- Performing Test WSHADOW -- Performing Test WSHADOW - Success -- Configuring done -- Generating done CMake Warning: Manually-specified variables were not used by the project: CMAKE_EXPORT_NO_PACKAGE_REGISTRY CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY -- Build files have been written to: /build/libedlib-1.2.6/obj-x86_64-linux-gnu make[1]: Leaving directory '/build/libedlib-1.2.6' debian/rules override_dh_auto_build make[1]: Entering directory '/build/libedlib-1.2.6' dh_auto_build --buildsystem=cmake cd obj-x86_64-linux-gnu && make -j15 "INSTALL=install --strip-program=true" VERBOSE=1 make[2]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' /usr/bin/cmake -S/build/libedlib-1.2.6 -B/build/libedlib-1.2.6/obj-x86_64-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles /build/libedlib-1.2.6/obj-x86_64-linux-gnu//CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib_static.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib.dir/DependInfo.cmake --color= Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib_static.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib_static.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib_static.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib.dir/depend.internal". Scanning dependencies of target edlib_static Scanning dependencies of target edlib make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 12%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.6/edlib/src/edlib.cpp [ 25%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o /usr/bin/c++ -Dedlib_EXPORTS -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -std=c++11 -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.6/edlib/src/edlib.cpp [ 37%] Linking CXX shared library lib/libedlib.so /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1 [ 50%] Linking CXX static library lib/libedlib_static.a /usr/bin/c++ -fPIC -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.0 -o lib/libedlib.so.1.2.5 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o /usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1 /usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/ranlib lib/libedlib_static.a make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 50%] Built target edlib_static make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color= Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib-aligner.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib-aligner.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib-aligner.dir/depend.internal". Scanning dependencies of target edlib-aligner make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 62%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /build/libedlib-1.2.6/apps/aligner/aligner.cpp /usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.5 lib/libedlib.so.0 lib/libedlib.so make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 62%] Built target edlib make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/runTests.dir/DependInfo.cmake --color= Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/runTests.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/runTests.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/runTests.dir/depend.internal". Scanning dependencies of target runTests make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 75%] Building CXX object CMakeFiles/runTests.dir/test/runTests.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/runTests.dir/test/runTests.cpp.o -c /build/libedlib-1.2.6/test/runTests.cpp [ 87%] Linking CXX executable bin/edlib-aligner /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -o bin/edlib-aligner lib/libedlib_static.a make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 87%] Built target edlib-aligner [100%] Linking CXX executable bin/runTests /usr/bin/cmake -E cmake_link_script CMakeFiles/runTests.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/runTests.dir/test/runTests.cpp.o -o bin/runTests -Wl,-rpath,/build/libedlib-1.2.6/obj-x86_64-linux-gnu/lib lib/libedlib.so.1.2.5 make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [100%] Built target runTests make[3]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles 0 make[2]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' # /usr/bin/make --directory=bindings/python /usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp make[2]: Entering directory '/build/libedlib-1.2.6/bindings/python' cp -R ../../edlib . cython3 --cplus edlib.pyx -o edlib.bycython.cpp /usr/lib/python3/dist-packages/Cython/Compiler/Main.py:369: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /build/libedlib-1.2.6/bindings/python/edlib.pyx tree = Parsing.p_module(s, pxd, full_module_name) make[2]: Leaving directory '/build/libedlib-1.2.6/bindings/python' dh_auto_build --buildsystem=pybuild -- --dir bindings/python I: pybuild base:232: /usr/bin/python3 setup.py build running build running build_ext building 'edlib' extension creating build creating build/temp.linux-x86_64-3.9 creating build/temp.linux-x86_64-3.9/edlib creating build/temp.linux-x86_64-3.9/edlib/src x86_64-linux-gnu-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -ffile-prefix-map=/build/python3.9-RNBry6/python3.9-3.9.2=. -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib.bycython.cpp -o build/temp.linux-x86_64-3.9/edlib.bycython.o -O3 -std=c++11 x86_64-linux-gnu-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -ffile-prefix-map=/build/python3.9-RNBry6/python3.9-3.9.2=. -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib/src/edlib.cpp -o build/temp.linux-x86_64-3.9/edlib/src/edlib.o -O3 -std=c++11 x86_64-linux-gnu-g++ -pthread -shared -Wl,-O1 -Wl,-Bsymbolic-functions -Wl,-z,relro -g -fwrapv -O2 -Wl,-z,relro -Wl,-z,now -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-x86_64-3.9/edlib.bycython.o build/temp.linux-x86_64-3.9/edlib/src/edlib.o -o /build/libedlib-1.2.6/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-x86_64-linux-gnu.so make[1]: Leaving directory '/build/libedlib-1.2.6' debian/rules override_dh_auto_test make[1]: Entering directory '/build/libedlib-1.2.6' `find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta Using NW alignment mode. Reading queries... Read 1 queries, 110 residues total. Reading target fasta file... Read target, 109 residues. Comparing queries to target... Query #0 (110 residues): score = 17 T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) ||||||| | |||||||||| ||||||||||||||||||||||||||| Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) | |||||||||||| || |||||||||| ||||||||| |||||| | Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) T: AESIKSKKKKKE-STTB (93 - 108) ||||||||||| ||| Q: -ESIKSKKKKKENSTT- (94 - 109) Cpu time of searching: 0.000095 `find . -name runTests` Testing HW with alignment... HW: 100/100 random tests passed! Time Edlib: 0.061478 Time Simple: 0.286227 Times faster: 4.66 Testing HW... HW: 100/100 random tests passed! Time Edlib: 0.048776 Time Simple: 0.300123 Times faster: 6.15 Testing NW with alignment... NW: 100/100 random tests passed! Time Edlib: 0.114976 Time Simple: 0.316368 Times faster: 2.75 Testing NW... NW: 100/100 random tests passed! Time Edlib: 0.027286 Time Simple: 0.276080 Times faster: 10.12 Testing SHW with alignment... SHW: 100/100 random tests passed! Time Edlib: 0.008837 Time Simple: 0.304482 Times faster: 34.46 Testing SHW... SHW: 100/100 random tests passed! Time Edlib: 0.005364 Time Simple: 0.294474 Times faster: 54.90 Specific tests: Test #0: HW:  OK  NW:  OK  SHW:  OK  Test #1: HW:  OK  NW:  OK  SHW:  OK  Test #2: HW:  OK  NW:  OK  SHW:  OK  Test #3: HW:  OK  NW:  OK  SHW:  OK  Test #4: HW:  OK  NW:  OK  SHW:  OK  Test #5: HW:  OK  NW:  OK  SHW:  OK  Test #6: HW:  OK  NW:  OK  SHW:  OK  Test #7: HW:  OK  NW:  OK  SHW:  OK  Test #8: HW:  OK  NW:  OK  SHW:  OK  Test #9: HW:  OK  NW:  OK  SHW:  OK  Test #10: HW:  OK  NW:  OK  SHW:  OK  Test #11: OK Test #12: OK Test #13: OK Test #14: OK Test #15: OK Test #16: Cigar extended: OK Cigar standard: OK Test #17: Degenerate nucleotides (HW): OK Test #18: Empty query or target: NW:  OK  NW:  OK  SHW:  OK  SHW:  OK  HW:  OK  HW:  OK  All specific tests passed! make[1]: Leaving directory '/build/libedlib-1.2.6' create-stamp debian/debhelper-build-stamp dh_testroot dh_prep debian/rules override_dh_auto_install make[1]: Entering directory '/build/libedlib-1.2.6' dh_auto_install --buildsystem=cmake cd obj-x86_64-linux-gnu && make -j15 install DESTDIR=/build/libedlib-1.2.6/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true" make[2]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' /usr/bin/cmake -S/build/libedlib-1.2.6 -B/build/libedlib-1.2.6/obj-x86_64-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles /build/libedlib-1.2.6/obj-x86_64-linux-gnu//CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib_static.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib.dir/DependInfo.cmake --color= make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/edlib_static.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/edlib.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 25%] Built target edlib_static make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color= [ 50%] Built target edlib make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.6/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles/runTests.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/edlib-aligner.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [ 75%] Built target edlib-aligner make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/runTests.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' [100%] Built target runTests make[3]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-x86_64-linux-gnu/CMakeFiles 0 make -f CMakeFiles/Makefile2 preinstall make[3]: Entering directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' make[3]: Nothing to be done for 'preinstall'. make[3]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' Install the project... /usr/bin/cmake -P cmake_install.cmake -- Install configuration: "Release" -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/x86_64-linux-gnu/libedlib.so.1.2.5 -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/x86_64-linux-gnu/libedlib.so.0 -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/x86_64-linux-gnu/libedlib.so -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/x86_64-linux-gnu/libedlib_static.a -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/include/edlib.h -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/x86_64-linux-gnu/pkgconfig/edlib-1.pc make[2]: Leaving directory '/build/libedlib-1.2.6/obj-x86_64-linux-gnu' dh_auto_install --buildsystem=pybuild -- --dir bindings/python I: pybuild base:232: /usr/bin/python3 setup.py install --root /build/libedlib-1.2.6/debian/python3-edlib running install running build running build_ext running install_lib creating /build/libedlib-1.2.6/debian/python3-edlib creating /build/libedlib-1.2.6/debian/python3-edlib/usr creating /build/libedlib-1.2.6/debian/python3-edlib/usr/lib creating /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9 creating /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9/dist-packages copying /build/libedlib-1.2.6/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-x86_64-linux-gnu.so -> /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9/dist-packages running install_egg_info running egg_info creating edlib.egg-info writing edlib.egg-info/PKG-INFO writing dependency_links to edlib.egg-info/dependency_links.txt writing top-level names to edlib.egg-info/top_level.txt writing manifest file 'edlib.egg-info/SOURCES.txt' reading manifest file 'edlib.egg-info/SOURCES.txt' reading manifest template 'MANIFEST.in' writing manifest file 'edlib.egg-info/SOURCES.txt' Copying edlib.egg-info to /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9/dist-packages/edlib-1.3.6.egg-info Skipping SOURCES.txt running install_scripts make[1]: Leaving directory '/build/libedlib-1.2.6' debian/rules override_dh_install make[1]: Entering directory '/build/libedlib-1.2.6' dh_install file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a` d-shlibmove --commit \ --multiarch \ --devunversioned \ --exclude-la \ --movedev debian/tmp/usr/include/* usr/include \ --movedev debian/tmp/usr/lib/*/pkgconfig usr/lib/x86_64-linux-gnu \ debian/tmp/usr/lib/*/*.so Library package automatic movement utility set -e install -d -m 755 debian/libedlib-dev/usr/lib/x86_64-linux-gnu install -d -m 755 debian/libedlib0/usr/lib/x86_64-linux-gnu mv debian/tmp/usr/lib/x86_64-linux-gnu/libedlib.a debian/libedlib-dev/usr/lib/x86_64-linux-gnu mv debian/tmp/usr/lib/x86_64-linux-gnu/libedlib.so debian/libedlib-dev/usr/lib/x86_64-linux-gnu mv /build/libedlib-1.2.6/debian/tmp/usr/lib/x86_64-linux-gnu/libedlib.so.0 debian/libedlib0/usr/lib/x86_64-linux-gnu mv /build/libedlib-1.2.6/debian/tmp/usr/lib/x86_64-linux-gnu/libedlib.so.1.2.5 debian/libedlib0/usr/lib/x86_64-linux-gnu PKGDEV=libedlib-dev PKGSHL=libedlib0 install -d -m 755 debian/libedlib-dev/usr/include mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include install -d -m 755 debian/libedlib-dev/usr/lib/x86_64-linux-gnu mv debian/tmp/usr/lib/x86_64-linux-gnu/pkgconfig debian/libedlib-dev/usr/lib/x86_64-linux-gnu make[1]: Leaving directory '/build/libedlib-1.2.6' dh_installdocs dh_installchangelogs dh_installexamples dh_installman dh_python3 dh_perl dh_link dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_dwz dh_strip dh_makeshlibs dh_shlibdeps dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/python3-edlib/usr/lib/python3/dist-packages/edlib.cpython-39-x86_64-linux-gnu.so was not linked against libpthread.so.0 (it uses none of the library's symbols) dh_installdeb dh_gencontrol dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined dh_md5sums dh_builddeb dpkg-deb: building package 'libedlib0' in '../libedlib0_1.2.6-1_amd64.deb'. dpkg-deb: building package 'libedlib0-dbgsym' in '../libedlib0-dbgsym_1.2.6-1_amd64.deb'. dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.6-1_amd64.deb'. dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.6-1_amd64.deb'. dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.6-1_amd64.deb'. dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.6-1_amd64.deb'. dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.6-1_amd64.deb'. dpkg-genbuildinfo --build=binary dpkg-genchanges --build=binary >../libedlib_1.2.6-1_amd64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: user script /srv/workspace/pbuilder/3301160/tmp/hooks/B01_cleanup starting I: user script /srv/workspace/pbuilder/3301160/tmp/hooks/B01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/3301160 and its subdirectories I: Current time: Thu Dec 30 07:20:08 +14 2021 I: pbuilder-time-stamp: 1640798408