I: pbuilder: network access will be disabled during build I: Current time: Sat Jan 7 20:02:21 -12 2023 I: pbuilder-time-stamp: 1673164941 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/buster-reproducible-base.tgz] I: copying local configuration I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [libedlib_1.2.4-1.dsc] I: copying [./libedlib_1.2.4.orig.tar.gz] I: copying [./libedlib_1.2.4-1.debian.tar.xz] I: Extracting source gpgv: unknown type of key resource 'trustedkeys.kbx' gpgv: keyblock resource '/root/.gnupg/trustedkeys.kbx': General error gpgv: Signature made Mon Jan 28 06:12:49 2019 -12 gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: failed to verify signature on ./libedlib_1.2.4-1.dsc dpkg-source: info: extracting libedlib in libedlib-1.2.4 dpkg-source: info: unpacking libedlib_1.2.4.orig.tar.gz dpkg-source: info: unpacking libedlib_1.2.4-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying soversion.patch dpkg-source: info: applying do_not_build_hello_example.patch dpkg-source: info: applying cython3.patch I: using fakeroot in build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/3334172/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='amd64' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=16' DISTRIBUTION='' HOME='/root' HOST_ARCH='amd64' IFS=' ' INVOCATION_ID='62621ae243bf4198986039b77332ec06' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='3334172' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/tmp.1TWr0yiMu7/pbuilderrc_OVwD --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/buster-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/tmp.1TWr0yiMu7/b1 --logfile b1/build.log libedlib_1.2.4-1.dsc' SUDO_GID='111' SUDO_UID='106' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://85.184.249.68:3128' I: uname -a Linux ionos15-amd64 5.14.0-0.bpo.2-amd64 #1 SMP Debian 5.14.9-2~bpo11+1 (2021-10-10) x86_64 GNU/Linux I: ls -l /bin total 5116 -rwxr-xr-x 1 root root 1168776 Apr 17 2019 bash -rwxr-xr-x 3 root root 38984 Jul 10 2019 bunzip2 -rwxr-xr-x 3 root root 38984 Jul 10 2019 bzcat lrwxrwxrwx 1 root root 6 Jul 10 2019 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2227 Jul 10 2019 bzdiff lrwxrwxrwx 1 root root 6 Jul 10 2019 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4877 Jun 24 2019 bzexe lrwxrwxrwx 1 root root 6 Jul 10 2019 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3641 Jul 10 2019 bzgrep -rwxr-xr-x 3 root root 38984 Jul 10 2019 bzip2 -rwxr-xr-x 1 root root 14328 Jul 10 2019 bzip2recover lrwxrwxrwx 1 root root 6 Jul 10 2019 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Jul 10 2019 bzmore -rwxr-xr-x 1 root root 43744 Feb 28 2019 cat -rwxr-xr-x 1 root root 64320 Feb 28 2019 chgrp -rwxr-xr-x 1 root root 64288 Feb 28 2019 chmod -rwxr-xr-x 1 root root 72512 Feb 28 2019 chown -rwxr-xr-x 1 root root 146880 Feb 28 2019 cp -rwxr-xr-x 1 root root 121464 Jan 17 2019 dash -rwxr-xr-x 1 root root 109408 Feb 28 2019 date -rwxr-xr-x 1 root root 76712 Feb 28 2019 dd -rwxr-xr-x 1 root root 93744 Feb 28 2019 df -rwxr-xr-x 1 root root 138856 Feb 28 2019 dir -rwxr-xr-x 1 root root 84288 Jan 9 2019 dmesg lrwxrwxrwx 1 root root 8 Sep 26 2018 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Sep 26 2018 domainname -> hostname -rwxr-xr-x 1 root root 39520 Feb 28 2019 echo -rwxr-xr-x 1 root root 28 Jan 7 2019 egrep -rwxr-xr-x 1 root root 35424 Feb 28 2019 false -rwxr-xr-x 1 root root 28 Jan 7 2019 fgrep -rwxr-xr-x 1 root root 68880 Jan 9 2019 findmnt -rwsr-xr-x 1 root root 34896 Apr 22 2020 fusermount -rwxr-xr-x 1 root root 198976 Jan 7 2019 grep -rwxr-xr-x 2 root root 2345 Jan 5 2019 gunzip -rwxr-xr-x 1 root root 6375 Jan 5 2019 gzexe -rwxr-xr-x 1 root root 98048 Jan 5 2019 gzip -rwxr-xr-x 1 root root 26696 Sep 26 2018 hostname -rwxr-xr-x 1 root root 68552 Feb 28 2019 ln -rwxr-xr-x 1 root root 56760 Jul 26 2018 login -rwxr-xr-x 1 root root 138856 Feb 28 2019 ls -rwxr-xr-x 1 root root 108624 Jan 9 2019 lsblk -rwxr-xr-x 1 root root 89088 Feb 28 2019 mkdir -rwxr-xr-x 1 root root 68544 Feb 28 2019 mknod -rwxr-xr-x 1 root root 43808 Feb 28 2019 mktemp -rwxr-xr-x 1 root root 43008 Jan 9 2019 more -rwsr-xr-x 1 root root 51280 Jan 9 2019 mount -rwxr-xr-x 1 root root 14408 Jan 9 2019 mountpoint -rwxr-xr-x 1 root root 138728 Feb 28 2019 mv lrwxrwxrwx 1 root root 8 Sep 26 2018 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Feb 14 2019 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 39616 Feb 28 2019 pwd lrwxrwxrwx 1 root root 4 Apr 17 2019 rbash -> bash -rwxr-xr-x 1 root root 47776 Feb 28 2019 readlink -rwxr-xr-x 1 root root 68416 Feb 28 2019 rm -rwxr-xr-x 1 root root 47776 Feb 28 2019 rmdir -rwxr-xr-x 1 root root 23312 Jan 21 2019 run-parts -rwxr-xr-x 1 root root 122224 Dec 22 2018 sed lrwxrwxrwx 1 root root 4 Dec 10 16:20 sh -> dash -rwxr-xr-x 1 root root 39552 Feb 28 2019 sleep -rwxr-xr-x 1 root root 80672 Feb 28 2019 stty -rwsr-xr-x 1 root root 63568 Jan 9 2019 su -rwxr-xr-x 1 root root 35488 Feb 28 2019 sync -rwxr-xr-x 1 root root 445560 Apr 23 2019 tar -rwxr-xr-x 1 root root 14440 Jan 21 2019 tempfile -rwxr-xr-x 1 root root 97152 Feb 28 2019 touch -rwxr-xr-x 1 root root 35424 Feb 28 2019 true -rwxr-xr-x 1 root root 14328 Apr 22 2020 ulockmgr_server -rwsr-xr-x 1 root root 34888 Jan 9 2019 umount -rwxr-xr-x 1 root root 39584 Feb 28 2019 uname -rwxr-xr-x 2 root root 2345 Jan 5 2019 uncompress -rwxr-xr-x 1 root root 138856 Feb 28 2019 vdir -rwxr-xr-x 1 root root 34896 Jan 9 2019 wdctl -rwxr-xr-x 1 root root 946 Jan 21 2019 which lrwxrwxrwx 1 root root 8 Sep 26 2018 ypdomainname -> hostname -rwxr-xr-x 1 root root 1983 Jan 5 2019 zcat -rwxr-xr-x 1 root root 1677 Jan 5 2019 zcmp -rwxr-xr-x 1 root root 5879 Jan 5 2019 zdiff -rwxr-xr-x 1 root root 29 Jan 5 2019 zegrep -rwxr-xr-x 1 root root 29 Jan 5 2019 zfgrep -rwxr-xr-x 1 root root 2080 Jan 5 2019 zforce -rwxr-xr-x 1 root root 7584 Jan 5 2019 zgrep -rwxr-xr-x 1 root root 2205 Jan 5 2019 zless -rwxr-xr-x 1 root root 1841 Jan 5 2019 zmore -rwxr-xr-x 1 root root 4552 Jan 5 2019 znew I: user script /srv/workspace/pbuilder/3334172/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: amd64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper (>= 12~), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19195 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper (>= 12~); however: Package debhelper is not installed. pbuilder-satisfydepends-dummy depends on cmake; however: Package cmake is not installed. pbuilder-satisfydepends-dummy depends on dh-python; however: Package dh-python is not installed. pbuilder-satisfydepends-dummy depends on d-shlibs; however: Package d-shlibs is not installed. pbuilder-satisfydepends-dummy depends on rename; however: Package rename is not installed. pbuilder-satisfydepends-dummy depends on cython3; however: Package cython3 is not installed. pbuilder-satisfydepends-dummy depends on python3-all-dev; however: Package python3-all-dev is not installed. pbuilder-satisfydepends-dummy depends on python3-setuptools; however: Package python3-setuptools is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: autoconf{a} automake{a} autopoint{a} autotools-dev{a} bsdmainutils{a} cmake{a} cmake-data{a} cython3{a} d-shlibs{a} debhelper{a} dh-autoreconf{a} dh-python{a} dh-strip-nondeterminism{a} dwz{a} file{a} gettext{a} gettext-base{a} groff-base{a} intltool-debian{a} libarchive-zip-perl{a} libarchive13{a} libbsd0{a} libcroco3{a} libcurl4{a} libelf1{a} libexpat1{a} libexpat1-dev{a} libfile-stripnondeterminism-perl{a} libglib2.0-0{a} libgssapi-krb5-2{a} libicu63{a} libjsoncpp1{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libldap-2.4-2{a} libldap-common{a} libmagic-mgc{a} libmagic1{a} libmpdec2{a} libncurses6{a} libnghttp2-14{a} libpipeline1{a} libprocps7{a} libpsl5{a} libpython3-all-dev{a} libpython3-dev{a} libpython3-stdlib{a} libpython3.7{a} libpython3.7-dev{a} libpython3.7-minimal{a} libpython3.7-stdlib{a} libreadline7{a} librhash0{a} librtmp1{a} libsasl2-2{a} libsasl2-modules-db{a} libsigsegv2{a} libssh2-1{a} libssl1.1{a} libtool{a} libuchardet0{a} libuv1{a} libxml2{a} lsb-base{a} m4{a} man-db{a} mime-support{a} po-debconf{a} procps{a} python3{a} python3-all{a} python3-all-dev{a} python3-dev{a} python3-distutils{a} python3-lib2to3{a} python3-minimal{a} python3-pkg-resources{a} python3-setuptools{a} python3.7{a} python3.7-dev{a} python3.7-minimal{a} readline-common{a} rename{a} sensible-utils{a} The following packages are RECOMMENDED but will NOT be installed: ca-certificates curl krb5-locales libarchive-cpio-perl libglib2.0-data libgpm2 libltdl-dev libmail-sendmail-perl libsasl2-modules lynx psmisc publicsuffix shared-mime-info wget xdg-user-dirs 0 packages upgraded, 86 newly installed, 0 to remove and 0 not upgraded. Need to get 86.1 MB of archives. After unpacking 231 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian buster/main amd64 libbsd0 amd64 0.9.1-2+deb10u1 [99.5 kB] Get: 2 http://deb.debian.org/debian buster/main amd64 bsdmainutils amd64 11.1.2+b1 [191 kB] Get: 3 http://deb.debian.org/debian buster/main amd64 libuchardet0 amd64 0.0.6-3 [64.9 kB] Get: 4 http://deb.debian.org/debian buster/main amd64 groff-base amd64 1.22.4-3+deb10u1 [916 kB] Get: 5 http://deb.debian.org/debian buster/main amd64 libpipeline1 amd64 1.5.1-2 [31.2 kB] Get: 6 http://deb.debian.org/debian buster/main amd64 man-db amd64 2.8.5-2 [1274 kB] Get: 7 http://deb.debian.org/debian buster/main amd64 libssl1.1 amd64 1.1.1d-0+deb10u7 [1539 kB] Get: 8 http://deb.debian.org/debian buster/main amd64 libpython3.7-minimal amd64 3.7.3-2+deb10u3 [589 kB] Get: 9 http://deb.debian.org/debian buster/main amd64 libexpat1 amd64 2.2.6-2+deb10u1 [106 kB] Get: 10 http://deb.debian.org/debian buster/main amd64 python3.7-minimal amd64 3.7.3-2+deb10u3 [1737 kB] Get: 11 http://deb.debian.org/debian buster/main amd64 python3-minimal amd64 3.7.3-1 [36.6 kB] Get: 12 http://deb.debian.org/debian buster/main amd64 mime-support all 3.62 [37.2 kB] Get: 13 http://deb.debian.org/debian buster/main amd64 libmpdec2 amd64 2.4.2-2 [87.2 kB] Get: 14 http://deb.debian.org/debian buster/main amd64 readline-common all 7.0-5 [70.6 kB] Get: 15 http://deb.debian.org/debian buster/main amd64 libreadline7 amd64 7.0-5 [151 kB] Get: 16 http://deb.debian.org/debian buster/main amd64 libpython3.7-stdlib amd64 3.7.3-2+deb10u3 [1734 kB] Get: 17 http://deb.debian.org/debian buster/main amd64 python3.7 amd64 3.7.3-2+deb10u3 [330 kB] Get: 18 http://deb.debian.org/debian buster/main amd64 libpython3-stdlib amd64 3.7.3-1 [20.0 kB] Get: 19 http://deb.debian.org/debian buster/main amd64 python3 amd64 3.7.3-1 [61.5 kB] Get: 20 http://deb.debian.org/debian buster/main amd64 libncurses6 amd64 6.1+20181013-2+deb10u2 [102 kB] Get: 21 http://deb.debian.org/debian buster/main amd64 libprocps7 amd64 2:3.3.15-2 [61.7 kB] Get: 22 http://deb.debian.org/debian buster/main amd64 lsb-base all 10.2019051400 [28.4 kB] Get: 23 http://deb.debian.org/debian buster/main amd64 procps amd64 2:3.3.15-2 [259 kB] Get: 24 http://deb.debian.org/debian buster/main amd64 sensible-utils all 0.0.12 [15.8 kB] Get: 25 http://deb.debian.org/debian buster/main amd64 libmagic-mgc amd64 1:5.35-4+deb10u2 [242 kB] Get: 26 http://deb.debian.org/debian buster/main amd64 libmagic1 amd64 1:5.35-4+deb10u2 [118 kB] Get: 27 http://deb.debian.org/debian buster/main amd64 file amd64 1:5.35-4+deb10u2 [66.4 kB] Get: 28 http://deb.debian.org/debian buster/main amd64 gettext-base amd64 0.19.8.1-9 [123 kB] Get: 29 http://deb.debian.org/debian buster/main amd64 libsigsegv2 amd64 2.12-2 [32.8 kB] Get: 30 http://deb.debian.org/debian buster/main amd64 m4 amd64 1.4.18-2 [203 kB] Get: 31 http://deb.debian.org/debian buster/main amd64 autoconf all 2.69-11 [341 kB] Get: 32 http://deb.debian.org/debian buster/main amd64 autotools-dev all 20180224.1 [77.0 kB] Get: 33 http://deb.debian.org/debian buster/main amd64 automake all 1:1.16.1-4 [771 kB] Get: 34 http://deb.debian.org/debian buster/main amd64 autopoint all 0.19.8.1-9 [434 kB] Get: 35 http://deb.debian.org/debian buster/main amd64 cmake-data all 3.13.4-1 [1476 kB] Get: 36 http://deb.debian.org/debian buster/main amd64 libicu63 amd64 63.1-6+deb10u1 [8300 kB] Get: 37 http://deb.debian.org/debian buster/main amd64 libxml2 amd64 2.9.4+dfsg1-7+deb10u2 [689 kB] Get: 38 http://deb.debian.org/debian buster/main amd64 libarchive13 amd64 3.3.3-4+deb10u1 [313 kB] Get: 39 http://deb.debian.org/debian buster/main amd64 libkeyutils1 amd64 1.6-6 [15.0 kB] Get: 40 http://deb.debian.org/debian buster/main amd64 libkrb5support0 amd64 1.17-3+deb10u3 [65.8 kB] Get: 41 http://deb.debian.org/debian buster/main amd64 libk5crypto3 amd64 1.17-3+deb10u3 [122 kB] Get: 42 http://deb.debian.org/debian buster/main amd64 libkrb5-3 amd64 1.17-3+deb10u3 [370 kB] Get: 43 http://deb.debian.org/debian buster/main amd64 libgssapi-krb5-2 amd64 1.17-3+deb10u3 [158 kB] Get: 44 http://deb.debian.org/debian buster/main amd64 libsasl2-modules-db amd64 2.1.27+dfsg-1+deb10u1 [69.1 kB] Get: 45 http://deb.debian.org/debian buster/main amd64 libsasl2-2 amd64 2.1.27+dfsg-1+deb10u1 [106 kB] Get: 46 http://deb.debian.org/debian buster/main amd64 libldap-common all 2.4.47+dfsg-3+deb10u6 [90.0 kB] Get: 47 http://deb.debian.org/debian buster/main amd64 libldap-2.4-2 amd64 2.4.47+dfsg-3+deb10u6 [224 kB] Get: 48 http://deb.debian.org/debian buster/main amd64 libnghttp2-14 amd64 1.36.0-2+deb10u1 [85.0 kB] Get: 49 http://deb.debian.org/debian buster/main amd64 libpsl5 amd64 0.20.2-2 [53.7 kB] Get: 50 http://deb.debian.org/debian buster/main amd64 librtmp1 amd64 2.4+20151223.gitfa8646d.1-2 [60.5 kB] Get: 51 http://deb.debian.org/debian buster/main amd64 libssh2-1 amd64 1.8.0-2.1 [140 kB] Get: 52 http://deb.debian.org/debian buster/main amd64 libcurl4 amd64 7.64.0-4+deb10u2 [332 kB] Get: 53 http://deb.debian.org/debian buster/main amd64 libjsoncpp1 amd64 1.7.4-3 [75.6 kB] Get: 54 http://deb.debian.org/debian buster/main amd64 librhash0 amd64 1.3.8-1 [122 kB] Get: 55 http://deb.debian.org/debian buster/main amd64 libuv1 amd64 1.24.1-1+deb10u1 [110 kB] Get: 56 http://deb.debian.org/debian buster/main amd64 cmake amd64 3.13.4-1 [3480 kB] Get: 57 http://deb.debian.org/debian buster/main amd64 cython3 amd64 0.29.2-2 [1392 kB] Get: 58 http://deb.debian.org/debian buster/main amd64 d-shlibs all 0.84 [17.2 kB] Get: 59 http://deb.debian.org/debian buster/main amd64 libtool all 2.4.6-9 [547 kB] Get: 60 http://deb.debian.org/debian buster/main amd64 dh-autoreconf all 19 [16.9 kB] Get: 61 http://deb.debian.org/debian buster/main amd64 libarchive-zip-perl all 1.64-1 [96.8 kB] Get: 62 http://deb.debian.org/debian buster/main amd64 libfile-stripnondeterminism-perl all 1.1.2-1 [19.8 kB] Get: 63 http://deb.debian.org/debian buster/main amd64 dh-strip-nondeterminism all 1.1.2-1 [13.0 kB] Get: 64 http://deb.debian.org/debian buster/main amd64 libelf1 amd64 0.176-1.1 [161 kB] Get: 65 http://deb.debian.org/debian buster/main amd64 dwz amd64 0.12-3 [78.0 kB] Get: 66 http://deb.debian.org/debian buster/main amd64 libglib2.0-0 amd64 2.58.3-2+deb10u3 [1259 kB] Get: 67 http://deb.debian.org/debian buster/main amd64 libcroco3 amd64 0.6.12-3 [145 kB] Get: 68 http://deb.debian.org/debian buster/main amd64 gettext amd64 0.19.8.1-9 [1303 kB] Get: 69 http://deb.debian.org/debian buster/main amd64 intltool-debian all 0.35.0+20060710.5 [26.8 kB] Get: 70 http://deb.debian.org/debian buster/main amd64 po-debconf all 1.0.21 [248 kB] Get: 71 http://deb.debian.org/debian buster/main amd64 debhelper all 12.1.1 [1016 kB] Get: 72 http://deb.debian.org/debian buster/main amd64 python3-lib2to3 all 3.7.3-1 [76.7 kB] Get: 73 http://deb.debian.org/debian buster/main amd64 python3-distutils all 3.7.3-1 [142 kB] Get: 74 http://deb.debian.org/debian buster/main amd64 dh-python all 3.20190308 [99.3 kB] Get: 75 http://deb.debian.org/debian buster/main amd64 libexpat1-dev amd64 2.2.6-2+deb10u1 [153 kB] Get: 76 http://deb.debian.org/debian buster/main amd64 libpython3.7 amd64 3.7.3-2+deb10u3 [1498 kB] Get: 77 http://deb.debian.org/debian buster/main amd64 libpython3.7-dev amd64 3.7.3-2+deb10u3 [48.4 MB] Get: 78 http://deb.debian.org/debian buster/main amd64 libpython3-dev amd64 3.7.3-1 [20.1 kB] Get: 79 http://deb.debian.org/debian buster/main amd64 libpython3-all-dev amd64 3.7.3-1 [1068 B] Get: 80 http://deb.debian.org/debian buster/main amd64 python3-all amd64 3.7.3-1 [1068 B] Get: 81 http://deb.debian.org/debian buster/main amd64 python3.7-dev amd64 3.7.3-2+deb10u3 [510 kB] Get: 82 http://deb.debian.org/debian buster/main amd64 python3-dev amd64 3.7.3-1 [1264 B] Get: 83 http://deb.debian.org/debian buster/main amd64 python3-all-dev amd64 3.7.3-1 [1064 B] Get: 84 http://deb.debian.org/debian buster/main amd64 python3-pkg-resources all 40.8.0-1 [153 kB] Get: 85 http://deb.debian.org/debian buster/main amd64 python3-setuptools all 40.8.0-1 [306 kB] Get: 86 http://deb.debian.org/debian buster/main amd64 rename all 1.10-1 [17.2 kB] Fetched 86.1 MB in 1s (70.7 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libbsd0:amd64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19195 files and directories currently installed.) Preparing to unpack .../0-libbsd0_0.9.1-2+deb10u1_amd64.deb ... Unpacking libbsd0:amd64 (0.9.1-2+deb10u1) ... Selecting previously unselected package bsdmainutils. Preparing to unpack .../1-bsdmainutils_11.1.2+b1_amd64.deb ... Unpacking bsdmainutils (11.1.2+b1) ... Selecting previously unselected package libuchardet0:amd64. Preparing to unpack .../2-libuchardet0_0.0.6-3_amd64.deb ... Unpacking libuchardet0:amd64 (0.0.6-3) ... Selecting previously unselected package groff-base. Preparing to unpack .../3-groff-base_1.22.4-3+deb10u1_amd64.deb ... Unpacking groff-base (1.22.4-3+deb10u1) ... Selecting previously unselected package libpipeline1:amd64. Preparing to unpack .../4-libpipeline1_1.5.1-2_amd64.deb ... Unpacking libpipeline1:amd64 (1.5.1-2) ... Selecting previously unselected package man-db. Preparing to unpack .../5-man-db_2.8.5-2_amd64.deb ... Unpacking man-db (2.8.5-2) ... Selecting previously unselected package libssl1.1:amd64. Preparing to unpack .../6-libssl1.1_1.1.1d-0+deb10u7_amd64.deb ... Unpacking libssl1.1:amd64 (1.1.1d-0+deb10u7) ... Selecting previously unselected package libpython3.7-minimal:amd64. Preparing to unpack .../7-libpython3.7-minimal_3.7.3-2+deb10u3_amd64.deb ... Unpacking libpython3.7-minimal:amd64 (3.7.3-2+deb10u3) ... Selecting previously unselected package libexpat1:amd64. Preparing to unpack .../8-libexpat1_2.2.6-2+deb10u1_amd64.deb ... Unpacking libexpat1:amd64 (2.2.6-2+deb10u1) ... Selecting previously unselected package python3.7-minimal. Preparing to unpack .../9-python3.7-minimal_3.7.3-2+deb10u3_amd64.deb ... Unpacking python3.7-minimal (3.7.3-2+deb10u3) ... Setting up libssl1.1:amd64 (1.1.1d-0+deb10u7) ... Setting up libpython3.7-minimal:amd64 (3.7.3-2+deb10u3) ... Setting up libexpat1:amd64 (2.2.6-2+deb10u1) ... Setting up python3.7-minimal (3.7.3-2+deb10u3) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20090 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.7.3-1_amd64.deb ... Unpacking python3-minimal (3.7.3-1) ... Selecting previously unselected package mime-support. Preparing to unpack .../1-mime-support_3.62_all.deb ... Unpacking mime-support (3.62) ... Selecting previously unselected package libmpdec2:amd64. Preparing to unpack .../2-libmpdec2_2.4.2-2_amd64.deb ... Unpacking libmpdec2:amd64 (2.4.2-2) ... Selecting previously unselected package readline-common. Preparing to unpack .../3-readline-common_7.0-5_all.deb ... Unpacking readline-common (7.0-5) ... Selecting previously unselected package libreadline7:amd64. Preparing to unpack .../4-libreadline7_7.0-5_amd64.deb ... Unpacking libreadline7:amd64 (7.0-5) ... Selecting previously unselected package libpython3.7-stdlib:amd64. Preparing to unpack .../5-libpython3.7-stdlib_3.7.3-2+deb10u3_amd64.deb ... Unpacking libpython3.7-stdlib:amd64 (3.7.3-2+deb10u3) ... Selecting previously unselected package python3.7. Preparing to unpack .../6-python3.7_3.7.3-2+deb10u3_amd64.deb ... Unpacking python3.7 (3.7.3-2+deb10u3) ... Selecting previously unselected package libpython3-stdlib:amd64. Preparing to unpack .../7-libpython3-stdlib_3.7.3-1_amd64.deb ... Unpacking libpython3-stdlib:amd64 (3.7.3-1) ... Setting up python3-minimal (3.7.3-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20551 files and directories currently installed.) Preparing to unpack .../00-python3_3.7.3-1_amd64.deb ... Unpacking python3 (3.7.3-1) ... Selecting previously unselected package libncurses6:amd64. Preparing to unpack .../01-libncurses6_6.1+20181013-2+deb10u2_amd64.deb ... Unpacking libncurses6:amd64 (6.1+20181013-2+deb10u2) ... Selecting previously unselected package libprocps7:amd64. Preparing to unpack .../02-libprocps7_2%3a3.3.15-2_amd64.deb ... Unpacking libprocps7:amd64 (2:3.3.15-2) ... Selecting previously unselected package lsb-base. Preparing to unpack .../03-lsb-base_10.2019051400_all.deb ... Unpacking lsb-base (10.2019051400) ... Selecting previously unselected package procps. Preparing to unpack .../04-procps_2%3a3.3.15-2_amd64.deb ... Unpacking procps (2:3.3.15-2) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../05-sensible-utils_0.0.12_all.deb ... Unpacking sensible-utils (0.0.12) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../06-libmagic-mgc_1%3a5.35-4+deb10u2_amd64.deb ... Unpacking libmagic-mgc (1:5.35-4+deb10u2) ... Selecting previously unselected package libmagic1:amd64. Preparing to unpack .../07-libmagic1_1%3a5.35-4+deb10u2_amd64.deb ... Unpacking libmagic1:amd64 (1:5.35-4+deb10u2) ... Selecting previously unselected package file. Preparing to unpack .../08-file_1%3a5.35-4+deb10u2_amd64.deb ... Unpacking file (1:5.35-4+deb10u2) ... Selecting previously unselected package gettext-base. Preparing to unpack .../09-gettext-base_0.19.8.1-9_amd64.deb ... Unpacking gettext-base (0.19.8.1-9) ... Selecting previously unselected package libsigsegv2:amd64. Preparing to unpack .../10-libsigsegv2_2.12-2_amd64.deb ... Unpacking libsigsegv2:amd64 (2.12-2) ... Selecting previously unselected package m4. Preparing to unpack .../11-m4_1.4.18-2_amd64.deb ... Unpacking m4 (1.4.18-2) ... Selecting previously unselected package autoconf. Preparing to unpack .../12-autoconf_2.69-11_all.deb ... Unpacking autoconf (2.69-11) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../13-autotools-dev_20180224.1_all.deb ... Unpacking autotools-dev (20180224.1) ... Selecting previously unselected package automake. Preparing to unpack .../14-automake_1%3a1.16.1-4_all.deb ... Unpacking automake (1:1.16.1-4) ... Selecting previously unselected package autopoint. Preparing to unpack .../15-autopoint_0.19.8.1-9_all.deb ... Unpacking autopoint (0.19.8.1-9) ... Selecting previously unselected package cmake-data. Preparing to unpack .../16-cmake-data_3.13.4-1_all.deb ... Unpacking cmake-data (3.13.4-1) ... Selecting previously unselected package libicu63:amd64. Preparing to unpack .../17-libicu63_63.1-6+deb10u1_amd64.deb ... Unpacking libicu63:amd64 (63.1-6+deb10u1) ... Selecting previously unselected package libxml2:amd64. Preparing to unpack .../18-libxml2_2.9.4+dfsg1-7+deb10u2_amd64.deb ... Unpacking libxml2:amd64 (2.9.4+dfsg1-7+deb10u2) ... Selecting previously unselected package libarchive13:amd64. Preparing to unpack .../19-libarchive13_3.3.3-4+deb10u1_amd64.deb ... Unpacking libarchive13:amd64 (3.3.3-4+deb10u1) ... Selecting previously unselected package libkeyutils1:amd64. Preparing to unpack .../20-libkeyutils1_1.6-6_amd64.deb ... Unpacking libkeyutils1:amd64 (1.6-6) ... Selecting previously unselected package libkrb5support0:amd64. Preparing to unpack .../21-libkrb5support0_1.17-3+deb10u3_amd64.deb ... Unpacking libkrb5support0:amd64 (1.17-3+deb10u3) ... Selecting previously unselected package libk5crypto3:amd64. Preparing to unpack .../22-libk5crypto3_1.17-3+deb10u3_amd64.deb ... Unpacking libk5crypto3:amd64 (1.17-3+deb10u3) ... Selecting previously unselected package libkrb5-3:amd64. Preparing to unpack .../23-libkrb5-3_1.17-3+deb10u3_amd64.deb ... Unpacking libkrb5-3:amd64 (1.17-3+deb10u3) ... Selecting previously unselected package libgssapi-krb5-2:amd64. Preparing to unpack .../24-libgssapi-krb5-2_1.17-3+deb10u3_amd64.deb ... Unpacking libgssapi-krb5-2:amd64 (1.17-3+deb10u3) ... Selecting previously unselected package libsasl2-modules-db:amd64. Preparing to unpack .../25-libsasl2-modules-db_2.1.27+dfsg-1+deb10u1_amd64.deb ... Unpacking libsasl2-modules-db:amd64 (2.1.27+dfsg-1+deb10u1) ... Selecting previously unselected package libsasl2-2:amd64. Preparing to unpack .../26-libsasl2-2_2.1.27+dfsg-1+deb10u1_amd64.deb ... Unpacking libsasl2-2:amd64 (2.1.27+dfsg-1+deb10u1) ... Selecting previously unselected package libldap-common. Preparing to unpack .../27-libldap-common_2.4.47+dfsg-3+deb10u6_all.deb ... Unpacking libldap-common (2.4.47+dfsg-3+deb10u6) ... Selecting previously unselected package libldap-2.4-2:amd64. Preparing to unpack .../28-libldap-2.4-2_2.4.47+dfsg-3+deb10u6_amd64.deb ... Unpacking libldap-2.4-2:amd64 (2.4.47+dfsg-3+deb10u6) ... Selecting previously unselected package libnghttp2-14:amd64. Preparing to unpack .../29-libnghttp2-14_1.36.0-2+deb10u1_amd64.deb ... Unpacking libnghttp2-14:amd64 (1.36.0-2+deb10u1) ... Selecting previously unselected package libpsl5:amd64. Preparing to unpack .../30-libpsl5_0.20.2-2_amd64.deb ... Unpacking libpsl5:amd64 (0.20.2-2) ... Selecting previously unselected package librtmp1:amd64. Preparing to unpack .../31-librtmp1_2.4+20151223.gitfa8646d.1-2_amd64.deb ... Unpacking librtmp1:amd64 (2.4+20151223.gitfa8646d.1-2) ... Selecting previously unselected package libssh2-1:amd64. Preparing to unpack .../32-libssh2-1_1.8.0-2.1_amd64.deb ... Unpacking libssh2-1:amd64 (1.8.0-2.1) ... Selecting previously unselected package libcurl4:amd64. Preparing to unpack .../33-libcurl4_7.64.0-4+deb10u2_amd64.deb ... Unpacking libcurl4:amd64 (7.64.0-4+deb10u2) ... Selecting previously unselected package libjsoncpp1:amd64. Preparing to unpack .../34-libjsoncpp1_1.7.4-3_amd64.deb ... Unpacking libjsoncpp1:amd64 (1.7.4-3) ... Selecting previously unselected package librhash0:amd64. Preparing to unpack .../35-librhash0_1.3.8-1_amd64.deb ... Unpacking librhash0:amd64 (1.3.8-1) ... Selecting previously unselected package libuv1:amd64. Preparing to unpack .../36-libuv1_1.24.1-1+deb10u1_amd64.deb ... Unpacking libuv1:amd64 (1.24.1-1+deb10u1) ... Selecting previously unselected package cmake. Preparing to unpack .../37-cmake_3.13.4-1_amd64.deb ... Unpacking cmake (3.13.4-1) ... Selecting previously unselected package cython3. Preparing to unpack .../38-cython3_0.29.2-2_amd64.deb ... Unpacking cython3 (0.29.2-2) ... Selecting previously unselected package d-shlibs. Preparing to unpack .../39-d-shlibs_0.84_all.deb ... Unpacking d-shlibs (0.84) ... Selecting previously unselected package libtool. Preparing to unpack .../40-libtool_2.4.6-9_all.deb ... Unpacking libtool (2.4.6-9) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../41-dh-autoreconf_19_all.deb ... Unpacking dh-autoreconf (19) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../42-libarchive-zip-perl_1.64-1_all.deb ... Unpacking libarchive-zip-perl (1.64-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../43-libfile-stripnondeterminism-perl_1.1.2-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.1.2-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../44-dh-strip-nondeterminism_1.1.2-1_all.deb ... Unpacking dh-strip-nondeterminism (1.1.2-1) ... Selecting previously unselected package libelf1:amd64. Preparing to unpack .../45-libelf1_0.176-1.1_amd64.deb ... Unpacking libelf1:amd64 (0.176-1.1) ... Selecting previously unselected package dwz. Preparing to unpack .../46-dwz_0.12-3_amd64.deb ... Unpacking dwz (0.12-3) ... Selecting previously unselected package libglib2.0-0:amd64. Preparing to unpack .../47-libglib2.0-0_2.58.3-2+deb10u3_amd64.deb ... Unpacking libglib2.0-0:amd64 (2.58.3-2+deb10u3) ... Selecting previously unselected package libcroco3:amd64. Preparing to unpack .../48-libcroco3_0.6.12-3_amd64.deb ... Unpacking libcroco3:amd64 (0.6.12-3) ... Selecting previously unselected package gettext. Preparing to unpack .../49-gettext_0.19.8.1-9_amd64.deb ... Unpacking gettext (0.19.8.1-9) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../50-intltool-debian_0.35.0+20060710.5_all.deb ... Unpacking intltool-debian (0.35.0+20060710.5) ... Selecting previously unselected package po-debconf. Preparing to unpack .../51-po-debconf_1.0.21_all.deb ... Unpacking po-debconf (1.0.21) ... Selecting previously unselected package debhelper. Preparing to unpack .../52-debhelper_12.1.1_all.deb ... Unpacking debhelper (12.1.1) ... Selecting previously unselected package python3-lib2to3. Preparing to unpack .../53-python3-lib2to3_3.7.3-1_all.deb ... Unpacking python3-lib2to3 (3.7.3-1) ... Selecting previously unselected package python3-distutils. Preparing to unpack .../54-python3-distutils_3.7.3-1_all.deb ... Unpacking python3-distutils (3.7.3-1) ... Selecting previously unselected package dh-python. Preparing to unpack .../55-dh-python_3.20190308_all.deb ... Unpacking dh-python (3.20190308) ... Selecting previously unselected package libexpat1-dev:amd64. Preparing to unpack .../56-libexpat1-dev_2.2.6-2+deb10u1_amd64.deb ... Unpacking libexpat1-dev:amd64 (2.2.6-2+deb10u1) ... Selecting previously unselected package libpython3.7:amd64. Preparing to unpack .../57-libpython3.7_3.7.3-2+deb10u3_amd64.deb ... Unpacking libpython3.7:amd64 (3.7.3-2+deb10u3) ... Selecting previously unselected package libpython3.7-dev:amd64. Preparing to unpack .../58-libpython3.7-dev_3.7.3-2+deb10u3_amd64.deb ... Unpacking libpython3.7-dev:amd64 (3.7.3-2+deb10u3) ... Selecting previously unselected package libpython3-dev:amd64. Preparing to unpack .../59-libpython3-dev_3.7.3-1_amd64.deb ... Unpacking libpython3-dev:amd64 (3.7.3-1) ... Selecting previously unselected package libpython3-all-dev:amd64. Preparing to unpack .../60-libpython3-all-dev_3.7.3-1_amd64.deb ... Unpacking libpython3-all-dev:amd64 (3.7.3-1) ... Selecting previously unselected package python3-all. Preparing to unpack .../61-python3-all_3.7.3-1_amd64.deb ... Unpacking python3-all (3.7.3-1) ... Selecting previously unselected package python3.7-dev. Preparing to unpack .../62-python3.7-dev_3.7.3-2+deb10u3_amd64.deb ... Unpacking python3.7-dev (3.7.3-2+deb10u3) ... Selecting previously unselected package python3-dev. Preparing to unpack .../63-python3-dev_3.7.3-1_amd64.deb ... Unpacking python3-dev (3.7.3-1) ... Selecting previously unselected package python3-all-dev. Preparing to unpack .../64-python3-all-dev_3.7.3-1_amd64.deb ... Unpacking python3-all-dev (3.7.3-1) ... Selecting previously unselected package python3-pkg-resources. Preparing to unpack .../65-python3-pkg-resources_40.8.0-1_all.deb ... Unpacking python3-pkg-resources (40.8.0-1) ... Selecting previously unselected package python3-setuptools. Preparing to unpack .../66-python3-setuptools_40.8.0-1_all.deb ... Unpacking python3-setuptools (40.8.0-1) ... Selecting previously unselected package rename. Preparing to unpack .../67-rename_1.10-1_all.deb ... Unpacking rename (1.10-1) ... Setting up libpipeline1:amd64 (1.5.1-2) ... Setting up lsb-base (10.2019051400) ... Setting up libkeyutils1:amd64 (1.6-6) ... Setting up libpsl5:amd64 (0.20.2-2) ... Setting up mime-support (3.62) ... Setting up libmagic-mgc (1:5.35-4+deb10u2) ... Setting up libarchive-zip-perl (1.64-1) ... Setting up libglib2.0-0:amd64 (2.58.3-2+deb10u3) ... No schema files found: doing nothing. Setting up libprocps7:amd64 (2:3.3.15-2) ... Setting up libnghttp2-14:amd64 (1.36.0-2+deb10u1) ... Setting up libmagic1:amd64 (1:5.35-4+deb10u2) ... Setting up gettext-base (0.19.8.1-9) ... Setting up rename (1.10-1) ... update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode Setting up file (1:5.35-4+deb10u2) ... Setting up libldap-common (2.4.47+dfsg-3+deb10u6) ... Setting up libicu63:amd64 (63.1-6+deb10u1) ... Setting up libkrb5support0:amd64 (1.17-3+deb10u3) ... Setting up libsasl2-modules-db:amd64 (2.1.27+dfsg-1+deb10u1) ... Setting up autotools-dev (20180224.1) ... Setting up libuv1:amd64 (1.24.1-1+deb10u1) ... Setting up libexpat1-dev:amd64 (2.2.6-2+deb10u1) ... Setting up librtmp1:amd64 (2.4+20151223.gitfa8646d.1-2) ... Setting up libncurses6:amd64 (6.1+20181013-2+deb10u2) ... Setting up libsigsegv2:amd64 (2.12-2) ... Setting up autopoint (0.19.8.1-9) ... Setting up d-shlibs (0.84) ... Setting up libk5crypto3:amd64 (1.17-3+deb10u3) ... Setting up libsasl2-2:amd64 (2.1.27+dfsg-1+deb10u1) ... Setting up sensible-utils (0.0.12) ... Setting up librhash0:amd64 (1.3.8-1) ... Setting up libuchardet0:amd64 (0.0.6-3) ... Setting up procps (2:3.3.15-2) ... update-alternatives: using /usr/bin/w.procps to provide /usr/bin/w (w) in auto mode Setting up libssh2-1:amd64 (1.8.0-2.1) ... Setting up cmake-data (3.13.4-1) ... Setting up libkrb5-3:amd64 (1.17-3+deb10u3) ... Setting up libmpdec2:amd64 (2.4.2-2) ... Setting up libbsd0:amd64 (0.9.1-2+deb10u1) ... Setting up libelf1:amd64 (0.176-1.1) ... Setting up readline-common (7.0-5) ... Setting up libxml2:amd64 (2.9.4+dfsg1-7+deb10u2) ... Setting up libjsoncpp1:amd64 (1.7.4-3) ... Setting up libreadline7:amd64 (7.0-5) ... Setting up libfile-stripnondeterminism-perl (1.1.2-1) ... Setting up libpython3.7-stdlib:amd64 (3.7.3-2+deb10u3) ... Setting up libpython3.7:amd64 (3.7.3-2+deb10u3) ... Setting up libtool (2.4.6-9) ... Setting up libarchive13:amd64 (3.3.3-4+deb10u1) ... Setting up libpython3.7-dev:amd64 (3.7.3-2+deb10u3) ... Setting up libldap-2.4-2:amd64 (2.4.47+dfsg-3+deb10u6) ... Setting up m4 (1.4.18-2) ... Setting up bsdmainutils (11.1.2+b1) ... update-alternatives: using /usr/bin/bsd-write to provide /usr/bin/write (write) in auto mode update-alternatives: using /usr/bin/bsd-from to provide /usr/bin/from (from) in auto mode Setting up libgssapi-krb5-2:amd64 (1.17-3+deb10u3) ... Setting up libcroco3:amd64 (0.6.12-3) ... Setting up autoconf (2.69-11) ... Setting up dwz (0.12-3) ... Setting up groff-base (1.22.4-3+deb10u1) ... Setting up libcurl4:amd64 (7.64.0-4+deb10u2) ... Setting up libpython3-stdlib:amd64 (3.7.3-1) ... Setting up automake (1:1.16.1-4) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up python3.7 (3.7.3-2+deb10u3) ... Setting up gettext (0.19.8.1-9) ... Setting up libpython3-dev:amd64 (3.7.3-1) ... Setting up python3 (3.7.3-1) ... Setting up man-db (2.8.5-2) ... Not building database; man-db/auto-update is not 'true'. Setting up python3.7-dev (3.7.3-2+deb10u3) ... Setting up intltool-debian (0.35.0+20060710.5) ... Setting up libpython3-all-dev:amd64 (3.7.3-1) ... Setting up cython3 (0.29.2-2) ... Setting up cmake (3.13.4-1) ... Setting up python3-lib2to3 (3.7.3-1) ... Setting up python3-pkg-resources (40.8.0-1) ... Setting up python3-distutils (3.7.3-1) ... Setting up dh-python (3.20190308) ... Setting up python3-setuptools (40.8.0-1) ... Setting up po-debconf (1.0.21) ... Setting up python3-all (3.7.3-1) ... Setting up python3-dev (3.7.3-1) ... Setting up python3-all-dev (3.7.3-1) ... Setting up debhelper (12.1.1) ... Setting up dh-autoreconf (19) ... Setting up dh-strip-nondeterminism (1.1.2-1) ... Processing triggers for libc-bin (2.28-10) ... Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps Reading package lists... Building dependency tree... Reading state information... fakeroot is already the newest version (1.23-1). 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. I: Building the package I: Running cd /build/libedlib-1.2.4/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../libedlib_1.2.4-1_source.changes dpkg-buildpackage: info: source package libedlib dpkg-buildpackage: info: source version 1.2.4-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Andreas Tille dpkg-source --before-build . dpkg-buildpackage: info: host architecture amd64 fakeroot debian/rules clean dh clean --with python3 dh_clean debian/rules build make: 'build' is up to date. fakeroot debian/rules binary dh binary --with python3 dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/libedlib-1.2.4' dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release cd obj-x86_64-linux-gnu && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/x86_64-linux-gnu -DCMAKE_BUILD_TYPE=Release .. -- The CXX compiler identification is GNU 8.3.0 -- Check for working CXX compiler: /usr/bin/c++ -- Check for working CXX compiler: /usr/bin/c++ -- works -- Detecting CXX compiler ABI info -- Detecting CXX compiler ABI info - done -- Detecting CXX compile features -- Detecting CXX compile features - done Setting warning flags -- Configuring done -- Generating done CMake Warning: Manually-specified variables were not used by the project: CMAKE_EXPORT_NO_PACKAGE_REGISTRY CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY CMAKE_INSTALL_LIBDIR CMAKE_INSTALL_LOCALSTATEDIR CMAKE_INSTALL_RUNSTATEDIR CMAKE_INSTALL_SYSCONFDIR -- Build files have been written to: /build/libedlib-1.2.4/obj-x86_64-linux-gnu make[1]: Leaving directory '/build/libedlib-1.2.4' debian/rules override_dh_auto_build make[1]: Entering directory '/build/libedlib-1.2.4' dh_auto_build --buildsystem=cmake cd obj-x86_64-linux-gnu && make -j16 "INSTALL=install --strip-program=true" make[2]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' /usr/bin/cmake -S/build/libedlib-1.2.4 -B/build/libedlib-1.2.4/obj-x86_64-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/edlib_static.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/edlib.dir/DependInfo.cmake --color= Scanning dependencies of target edlib_static Scanning dependencies of target edlib make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [ 12%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o [ 25%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/c++ -Dedlib_EXPORTS -I/build/libedlib-1.2.4/edlib/include -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -std=c++11 -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.4/edlib/src/edlib.cpp /usr/bin/c++ -I/build/libedlib-1.2.4/edlib/include -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.4/edlib/src/edlib.cpp [ 37%] Linking CXX shared library lib/libedlib.so /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1 [ 50%] Linking CXX static library lib/libedlib_static.a /usr/bin/c++ -fPIC -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.0 -o lib/libedlib.so.1.2.3 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o /usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1 /usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/ranlib lib/libedlib_static.a make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [ 50%] Built target edlib_static make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/runTests.dir/DependInfo.cmake --color= Scanning dependencies of target edlib-aligner Scanning dependencies of target runTests make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [ 62%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o [ 75%] Building CXX object CMakeFiles/runTests.dir/test/runTests.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.4/edlib/include -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /build/libedlib-1.2.4/apps/aligner/aligner.cpp /usr/bin/c++ -I/build/libedlib-1.2.4/edlib/include -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/runTests.dir/test/runTests.cpp.o -c /build/libedlib-1.2.4/test/runTests.cpp /usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.3 lib/libedlib.so.0 lib/libedlib.so make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [ 75%] Built target edlib /build/libedlib-1.2.4/apps/aligner/aligner.cpp: In function 'void printAlignment(const char*, const char*, const unsigned char*, int, int, EdlibAlignMode)': /build/libedlib-1.2.4/apps/aligner/aligner.cpp:346:13: warning: 'startTIdx' may be used uninitialized in this function [-Wmaybe-uninitialized] int startTIdx; ^~~~~~~~~ [ 87%] Linking CXX executable bin/edlib-aligner /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -o bin/edlib-aligner lib/libedlib_static.a [100%] Linking CXX executable bin/runTests /usr/bin/cmake -E cmake_link_script CMakeFiles/runTests.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/runTests.dir/test/runTests.cpp.o -o bin/runTests lib/libedlib_static.a make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [100%] Built target edlib-aligner make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [100%] Built target runTests make[3]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles 0 make[2]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' # /usr/bin/make --directory=bindings/python /usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp make[2]: Entering directory '/build/libedlib-1.2.4/bindings/python' cp -R ../../edlib . cython3 --cplus edlib.pyx -o edlib.bycython.cpp /usr/lib/python3/dist-packages/Cython/Compiler/Main.py:367: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /build/libedlib-1.2.4/bindings/python/edlib.pyx tree = Parsing.p_module(s, pxd, full_module_name) make[2]: Leaving directory '/build/libedlib-1.2.4/bindings/python' dh_auto_build --buildsystem=pybuild -- --dir bindings/python I: pybuild base:217: /usr/bin/python3 setup.py build running build running build_ext building 'edlib' extension creating build creating build/temp.linux-amd64-3.7 creating build/temp.linux-amd64-3.7/edlib creating build/temp.linux-amd64-3.7/edlib/src x86_64-linux-gnu-gcc -pthread -DNDEBUG -g -fwrapv -O2 -Wall -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.7m -c edlib.bycython.cpp -o build/temp.linux-amd64-3.7/edlib.bycython.o -O3 -std=c++11 x86_64-linux-gnu-gcc -pthread -DNDEBUG -g -fwrapv -O2 -Wall -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.7m -c edlib/src/edlib.cpp -o build/temp.linux-amd64-3.7/edlib/src/edlib.o -O3 -std=c++11 x86_64-linux-gnu-g++ -pthread -shared -Wl,-O1 -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,relro -Wl,-z,now -g -O2 -ffile-prefix-map=/build/libedlib-1.2.4=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-amd64-3.7/edlib.bycython.o build/temp.linux-amd64-3.7/edlib/src/edlib.o -o /build/libedlib-1.2.4/.pybuild/cpython3_3.7_edlib/build/edlib.cpython-37m-x86_64-linux-gnu.so /usr/lib/python3/dist-packages/setuptools/dist.py:475: UserWarning: Normalizing '1.2.3-1' to '1.2.3.post1' normalized_version, make[1]: Leaving directory '/build/libedlib-1.2.4' debian/rules override_dh_auto_test make[1]: Entering directory '/build/libedlib-1.2.4' `find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta Using NW alignment mode. Reading queries... Read 1 queries, 110 residues total. Reading target fasta file... Read target, 109 residues. Comparing queries to target... Query #0 (110 residues): score = 17 T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) ||||||| | |||||||||| ||||||||||||||||||||||||||| Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) | |||||||||||| || |||||||||| ||||||||| |||||| | Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) T: AESIKSKKKKKE-STTB (93 - 108) ||||||||||| ||| Q: -ESIKSKKKKKENSTT- (94 - 109) Cpu time of searching: 0.000085 `find . -name runTests` Testing HW with alignment... HW: 100/100 random tests passed! Time Edlib: 0.053523 Time Simple: 0.278424 Times faster: 5.20 Testing HW... HW: 100/100 random tests passed! Time Edlib: 0.044522 Time Simple: 0.293541 Times faster: 6.59 Testing NW with alignment... NW: 100/100 random tests passed! Time Edlib: 0.099454 Time Simple: 0.304084 Times faster: 3.06 Testing NW... NW: 100/100 random tests passed! Time Edlib: 0.021668 Time Simple: 0.249253 Times faster: 11.50 Testing SHW with alignment... SHW: 100/100 random tests passed! Time Edlib: 0.006523 Time Simple: 0.274413 Times faster: 42.07 Testing SHW... SHW: 100/100 random tests passed! Time Edlib: 0.004083 Time Simple: 0.264174 Times faster: 64.70 Specific tests: Test #0: HW:  OK  NW:  OK  SHW:  OK  Test #1: HW:  OK  NW:  OK  SHW:  OK  Test #2: HW:  OK  NW:  OK  SHW:  OK  Test #3: HW:  OK  NW:  OK  SHW:  OK  Test #4: HW:  OK  NW:  OK  SHW:  OK  Test #5: HW:  OK  NW:  OK  SHW:  OK  Test #6: HW:  OK  NW:  OK  SHW:  OK  Test #7: HW:  OK  NW:  OK  SHW:  OK  Test #8: HW:  OK  NW:  OK  SHW:  OK  Test #9: HW:  OK  NW:  OK  SHW:  OK  Test #10: HW:  OK  NW:  OK  SHW:  OK  Test #11: OK Test #12: OK Test #13: OK Test #14: OK Test #15: OK Test #16: Cigar extended: OK Cigar standard: OK Test #17: Degenerate nucleotides (HW): OK All specific tests passed! make[1]: Leaving directory '/build/libedlib-1.2.4' create-stamp debian/debhelper-build-stamp dh_testroot dh_prep debian/rules override_dh_auto_install make[1]: Entering directory '/build/libedlib-1.2.4' dh_auto_install --buildsystem=cmake cd obj-x86_64-linux-gnu && make -j16 install DESTDIR=/build/libedlib-1.2.4/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true" make[2]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' /usr/bin/cmake -S/build/libedlib-1.2.4 -B/build/libedlib-1.2.4/obj-x86_64-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/edlib_static.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/edlib.dir/DependInfo.cmake --color= make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/edlib.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/edlib_static.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [ 25%] Built target edlib [ 50%] Built target edlib_static make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/runTests.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' cd /build/libedlib-1.2.4/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.4 /build/libedlib-1.2.4 /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color= make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/edlib-aligner.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[4]: Nothing to be done for 'CMakeFiles/runTests.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' [ 75%] Built target edlib-aligner [100%] Built target runTests make[3]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.4/obj-x86_64-linux-gnu/CMakeFiles 0 make -f CMakeFiles/Makefile2 preinstall make[3]: Entering directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' make[3]: Nothing to be done for 'preinstall'. make[3]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' Install the project... /usr/bin/cmake -P cmake_install.cmake -- Install configuration: "Release" -- Installing: /build/libedlib-1.2.4/debian/tmp/usr/lib/libedlib.so.1.2.3 -- Installing: /build/libedlib-1.2.4/debian/tmp/usr/lib/libedlib.so.0 -- Installing: /build/libedlib-1.2.4/debian/tmp/usr/lib/libedlib.so -- Installing: /build/libedlib-1.2.4/debian/tmp/usr/lib/libedlib_static.a -- Installing: /build/libedlib-1.2.4/debian/tmp/usr/include/edlib.h make[2]: Leaving directory '/build/libedlib-1.2.4/obj-x86_64-linux-gnu' dh_auto_install --buildsystem=pybuild -- --dir bindings/python I: pybuild base:217: /usr/bin/python3 setup.py install --root /build/libedlib-1.2.4/debian/python3-edlib running install running build running build_ext running install_lib creating /build/libedlib-1.2.4/debian/python3-edlib creating /build/libedlib-1.2.4/debian/python3-edlib/usr creating /build/libedlib-1.2.4/debian/python3-edlib/usr/lib creating /build/libedlib-1.2.4/debian/python3-edlib/usr/lib/python3.7 creating /build/libedlib-1.2.4/debian/python3-edlib/usr/lib/python3.7/dist-packages copying /build/libedlib-1.2.4/.pybuild/cpython3_3.7_edlib/build/edlib.cpython-37m-x86_64-linux-gnu.so -> /build/libedlib-1.2.4/debian/python3-edlib/usr/lib/python3.7/dist-packages running install_egg_info running egg_info creating edlib.egg-info writing edlib.egg-info/PKG-INFO writing dependency_links to edlib.egg-info/dependency_links.txt writing top-level names to edlib.egg-info/top_level.txt writing manifest file 'edlib.egg-info/SOURCES.txt' reading manifest file 'edlib.egg-info/SOURCES.txt' reading manifest template 'MANIFEST.in' writing manifest file 'edlib.egg-info/SOURCES.txt' Copying edlib.egg-info to /build/libedlib-1.2.4/debian/python3-edlib/usr/lib/python3.7/dist-packages/edlib-1.2.3.post1.egg-info Skipping SOURCES.txt running install_scripts /usr/lib/python3/dist-packages/setuptools/dist.py:475: UserWarning: Normalizing '1.2.3-1' to '1.2.3.post1' normalized_version, make[1]: Leaving directory '/build/libedlib-1.2.4' debian/rules override_dh_install make[1]: Entering directory '/build/libedlib-1.2.4' dh_install file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a` d-shlibmove --commit \ --multiarch \ --devunversioned \ --exclude-la \ --movedev debian/tmp/usr/include/* usr/include \ debian/tmp/usr/lib/*.so Library package automatic movement utility set -e install -d -m 755 debian/libedlib-dev/usr/lib/x86_64-linux-gnu install -d -m 755 debian/libedlib0/usr/lib/x86_64-linux-gnu mv debian/tmp/usr/lib/libedlib.a debian/libedlib-dev/usr/lib/x86_64-linux-gnu mv debian/tmp/usr/lib/libedlib.so debian/libedlib-dev/usr/lib/x86_64-linux-gnu mv /build/libedlib-1.2.4/debian/tmp/usr/lib/libedlib.so.0 debian/libedlib0/usr/lib/x86_64-linux-gnu mv /build/libedlib-1.2.4/debian/tmp/usr/lib/libedlib.so.1.2.3 debian/libedlib0/usr/lib/x86_64-linux-gnu PKGDEV=libedlib-dev PKGSHL=libedlib0 install -d -m 755 debian/libedlib-dev/usr/include mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include make[1]: Leaving directory '/build/libedlib-1.2.4' dh_installdocs dh_installchangelogs dh_installexamples dh_installman dh_python3 dh_perl dh_link dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_dwz dh_strip dh_makeshlibs dh_shlibdeps dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/python3-edlib/usr/lib/python3/dist-packages/edlib.cpython-37m-x86_64-linux-gnu.so was not linked against libpthread.so.0 (it uses none of the library's symbols) dh_installdeb dh_gencontrol dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined dh_md5sums dh_builddeb dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.4-1_amd64.deb'. dpkg-deb: building package 'libedlib0' in '../libedlib0_1.2.4-1_amd64.deb'. dpkg-deb: building package 'libedlib0-dbgsym' in '../libedlib0-dbgsym_1.2.4-1_amd64.deb'. dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.4-1_amd64.deb'. dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.4-1_amd64.deb'. dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.4-1_amd64.deb'. dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.4-1_amd64.deb'. dpkg-genbuildinfo --build=binary dpkg-genchanges --build=binary >../libedlib_1.2.4-1_amd64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/3334172 and its subdirectories I: Current time: Sat Jan 7 20:03:10 -12 2023 I: pbuilder-time-stamp: 1673164990