I: pbuilder: network access will be disabled during build I: Current time: Sat Jan 25 01:45:37 -12 2025 I: pbuilder-time-stamp: 1737812737 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/trixie-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: unsupported subcommand dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/16883/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build/reproducible-path' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='armhf' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=3 ' DISTRIBUTION='trixie' HOME='/root' HOST_ARCH='armhf' IFS=' ' INVOCATION_ID='77074e5164d14e689c8492392cc8a300' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='16883' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.w96VUehF/pbuilderrc_cPbU --distribution trixie --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/trixie-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.w96VUehF/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='113' SUDO_UID='107' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://10.0.0.15:3142/' I: uname -a Linux ff4a 6.1.0-30-armmp-lpae #1 SMP Debian 6.1.124-1 (2025-01-12) armv7l GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Nov 22 14:40 /bin -> usr/bin I: user script /srv/workspace/pbuilder/16883/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: armhf Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19569 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dbus{a} dbus-bin{a} dbus-daemon{a} dbus-session-bus-common{a} dbus-system-bus-common{a} dbus-user-session{a} dconf-gsettings-backend{a} dconf-service{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gpg{a} gpg-agent{a} gpgconf{a} gpgsm{a} gpgv{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libapparmor1{a} libarchive-zip-perl{a} libasm-java{a} libasound2-data{a} libasound2t64{a} libassuan9{a} libatinject-jsr330-api-java{a} libatk-bridge2.0-0t64{a} libatk1.0-0t64{a} libatspi2.0-0t64{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo-gobject2{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcloudproviders0{a} libcolord2{a} libcom-err2{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2t64{a} libdatrie1{a} libdbus-1-3{a} libdconf1{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1t64{a} libencode-locale-perl{a} libepoxy0{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libffi8{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgbm1{a} libgcrypt20{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0t64{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgnutls30t64{a} libgoogle-gson-java{a} libgpg-error0{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgssapi-krb5-2{a} libgtk-3-0t64{a} libgtk-3-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libidn2-0{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjunixsocket-java{a} libjunixsocket-jni{a} libjzlib-java{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap2{a} liblerc4{a} liblightcouch-java{a} libllvm19{a} liblog4j2-java{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1t64{a} libmaven-parent-java{a} libmaven-resolver-1.6-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmongodb-java{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0t64{a} libnsl2{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libp11-kit0{a} libpam-systemd{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16t64{a} libpolyglot-maven-java{a} libproc2-0{a} libpython3-stdlib{a} libpython3.12-minimal{a} libpython3.12-stdlib{a} libqdox-java{a} libreadline8t64{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-quote-perl{a} libsystemd-shared{a} libtasn1-6{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtirpc-common{a} libtirpc3t64{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} libunistring5{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwayland-client0{a} libwayland-cursor0{a} libwayland-egl1{a} libwayland-server0{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxkbcommon0{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} mesa-libgallium{a} netbase{a} openjdk-21-jdk{a} openjdk-21-jdk-headless{a} openjdk-21-jre{a} openjdk-21-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} procps{a} python3{a} python3-minimal{a} python3.12{a} python3.12-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} sopv-gpgv{a} systemd{a} systemd-sysv{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} xkb-data{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf at-spi2-core chrony curl debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra gnupg-utils gpg-wks-client javascript-common krb5-locales libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpg-error-l10n libgtk-3-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libkmod2 libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libnss-systemd libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian linux-sysctl-defaults lynx mesa-vulkan-drivers ntpsec openntpd pristine-tar psmisc python3-apt python3-argcomplete python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace systemd-cryptsetup systemd-timesyncd wget xdg-user-dirs 0 packages upgraded, 389 newly installed, 0 to remove and 0 not upgraded. Need to get 320 MB of archives. After unpacking 822 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian trixie/main armhf libapparmor1 armhf 3.1.7-1+b3 [38.0 kB] Get: 2 http://deb.debian.org/debian trixie/main armhf libsystemd-shared armhf 257.2-1 [1959 kB] Get: 3 http://deb.debian.org/debian trixie/main armhf systemd armhf 257.2-1 [3510 kB] Get: 4 http://deb.debian.org/debian trixie/main armhf systemd-sysv armhf 257.2-1 [60.3 kB] Get: 5 http://deb.debian.org/debian trixie/main armhf libdbus-1-3 armhf 1.16.0-1 [154 kB] Get: 6 http://deb.debian.org/debian trixie/main armhf dbus-bin armhf 1.16.0-1 [77.2 kB] Get: 7 http://deb.debian.org/debian trixie/main armhf dbus-session-bus-common all 1.16.0-1 [51.1 kB] Get: 8 http://deb.debian.org/debian trixie/main armhf libexpat1 armhf 2.6.4-1 [83.5 kB] Get: 9 http://deb.debian.org/debian trixie/main armhf dbus-daemon armhf 1.16.0-1 [144 kB] Get: 10 http://deb.debian.org/debian trixie/main armhf dbus-system-bus-common all 1.16.0-1 [52.2 kB] Get: 11 http://deb.debian.org/debian trixie/main armhf dbus armhf 1.16.0-1 [67.9 kB] Get: 12 http://deb.debian.org/debian trixie/main armhf libpipeline1 armhf 1.5.8-1 [35.0 kB] Get: 13 http://deb.debian.org/debian trixie/main armhf binfmt-support armhf 2.2.2-7 [55.3 kB] Get: 14 http://deb.debian.org/debian trixie/main armhf libpython3.12-minimal armhf 3.12.8-5 [803 kB] Get: 15 http://deb.debian.org/debian trixie/main armhf python3.12-minimal armhf 3.12.8-5 [1812 kB] Get: 16 http://deb.debian.org/debian trixie/main armhf python3-minimal armhf 3.12.8-1 [26.9 kB] Get: 17 http://deb.debian.org/debian trixie/main armhf media-types all 10.1.0 [26.9 kB] Get: 18 http://deb.debian.org/debian trixie/main armhf netbase all 6.4 [12.8 kB] Get: 19 http://deb.debian.org/debian trixie/main armhf tzdata all 2024b-6 [257 kB] Get: 20 http://deb.debian.org/debian trixie/main armhf libffi8 armhf 3.4.6-1 [20.0 kB] Get: 21 http://deb.debian.org/debian trixie/main armhf libkrb5support0 armhf 1.21.3-3 [30.0 kB] Get: 22 http://deb.debian.org/debian trixie/main armhf libcom-err2 armhf 1.47.2-1 [23.3 kB] Get: 23 http://deb.debian.org/debian trixie/main armhf libk5crypto3 armhf 1.21.3-3 [75.8 kB] Get: 24 http://deb.debian.org/debian trixie/main armhf libkeyutils1 armhf 1.6.3-4 [8096 B] Get: 25 http://deb.debian.org/debian trixie/main armhf libkrb5-3 armhf 1.21.3-3 [283 kB] Get: 26 http://deb.debian.org/debian trixie/main armhf libgssapi-krb5-2 armhf 1.21.3-3 [114 kB] Get: 27 http://deb.debian.org/debian trixie/main armhf libtirpc-common all 1.3.4+ds-1.3 [10.9 kB] Get: 28 http://deb.debian.org/debian trixie/main armhf libtirpc3t64 armhf 1.3.4+ds-1.3+b1 [71.3 kB] Get: 29 http://deb.debian.org/debian trixie/main armhf libnsl2 armhf 1.3.0-3+b3 [35.0 kB] Get: 30 http://deb.debian.org/debian trixie/main armhf readline-common all 8.2-6 [69.4 kB] Get: 31 http://deb.debian.org/debian trixie/main armhf libreadline8t64 armhf 8.2-6 [146 kB] Get: 32 http://deb.debian.org/debian trixie/main armhf libpython3.12-stdlib armhf 3.12.8-5 [1832 kB] Get: 33 http://deb.debian.org/debian trixie/main armhf python3.12 armhf 3.12.8-5 [677 kB] Get: 34 http://deb.debian.org/debian trixie/main armhf libpython3-stdlib armhf 3.12.8-1 [9792 B] Get: 35 http://deb.debian.org/debian trixie/main armhf python3 armhf 3.12.8-1 [27.9 kB] Get: 36 http://deb.debian.org/debian trixie/main armhf libproc2-0 armhf 2:4.0.4-6 [56.0 kB] Get: 37 http://deb.debian.org/debian trixie/main armhf procps armhf 2:4.0.4-6 [864 kB] Get: 38 http://deb.debian.org/debian trixie/main armhf sensible-utils all 0.0.24 [24.8 kB] Get: 39 http://deb.debian.org/debian trixie/main armhf openssl armhf 3.4.0-2 [1388 kB] Get: 40 http://deb.debian.org/debian trixie/main armhf ca-certificates all 20241223 [164 kB] Get: 41 http://deb.debian.org/debian trixie/main armhf libmagic-mgc armhf 1:5.45-3+b1 [314 kB] Get: 42 http://deb.debian.org/debian trixie/main armhf libmagic1t64 armhf 1:5.45-3+b1 [98.5 kB] Get: 43 http://deb.debian.org/debian trixie/main armhf file armhf 1:5.45-3+b1 [42.3 kB] Get: 44 http://deb.debian.org/debian trixie/main armhf gettext-base armhf 0.22.5-4 [196 kB] Get: 45 http://deb.debian.org/debian trixie/main armhf libuchardet0 armhf 0.0.8-1+b2 [65.6 kB] Get: 46 http://deb.debian.org/debian trixie/main armhf groff-base armhf 1.23.0-7 [1095 kB] Get: 47 http://deb.debian.org/debian trixie/main armhf libpam-systemd armhf 257.2-1 [267 kB] Get: 48 http://deb.debian.org/debian trixie/main armhf bsdextrautils armhf 2.40.4-1 [84.6 kB] Get: 49 http://deb.debian.org/debian trixie/main armhf man-db armhf 2.13.0-1 [1382 kB] Get: 50 http://deb.debian.org/debian trixie/main armhf libgdk-pixbuf2.0-common all 2.42.12+dfsg-2 [311 kB] Get: 51 http://deb.debian.org/debian trixie/main armhf libglib2.0-0t64 armhf 2.82.4-2 [1328 kB] Get: 52 http://deb.debian.org/debian trixie/main armhf libicu72 armhf 72.1-6 [9086 kB] Get: 53 http://deb.debian.org/debian trixie/main armhf libxml2 armhf 2.12.7+dfsg+really2.9.14-0.2+b1 [605 kB] Get: 54 http://deb.debian.org/debian trixie/main armhf shared-mime-info armhf 2.4-5+b2 [754 kB] Get: 55 http://deb.debian.org/debian trixie/main armhf libjpeg62-turbo armhf 1:2.1.5-3+b1 [145 kB] Get: 56 http://deb.debian.org/debian trixie/main armhf libpng16-16t64 armhf 1.6.44-3 [263 kB] Get: 57 http://deb.debian.org/debian trixie/main armhf libdeflate0 armhf 1.23-1+b1 [36.7 kB] Get: 58 http://deb.debian.org/debian trixie/main armhf libjbig0 armhf 2.1-6.1+b2 [27.3 kB] Get: 59 http://deb.debian.org/debian trixie/main armhf liblerc4 armhf 4.0.0+ds-5 [146 kB] Get: 60 http://deb.debian.org/debian trixie/main armhf libsharpyuv0 armhf 1.5.0-0.1 [114 kB] Get: 61 http://deb.debian.org/debian trixie/main armhf libwebp7 armhf 1.5.0-0.1 [273 kB] Get: 62 http://deb.debian.org/debian trixie/main armhf libtiff6 armhf 4.5.1+git230720-5 [302 kB] Get: 63 http://deb.debian.org/debian trixie/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.12+dfsg-2 [126 kB] Get: 64 http://deb.debian.org/debian trixie/main armhf gtk-update-icon-cache armhf 4.16.12+ds-1 [49.5 kB] Get: 65 http://deb.debian.org/debian trixie/main armhf hicolor-icon-theme all 0.18-1 [12.0 kB] Get: 66 http://deb.debian.org/debian trixie/main armhf adwaita-icon-theme all 47.0-2 [463 kB] Get: 67 http://deb.debian.org/debian trixie/main armhf ca-certificates-java all 20240118 [11.6 kB] Get: 68 http://deb.debian.org/debian trixie/main armhf java-common all 0.76 [6776 B] Get: 69 http://deb.debian.org/debian trixie/main armhf liblcms2-2 armhf 2.16-2 [131 kB] Get: 70 http://deb.debian.org/debian trixie/main armhf libnspr4 armhf 2:4.36-1 [87.8 kB] Get: 71 http://deb.debian.org/debian trixie/main armhf libnss3 armhf 2:3.107-1 [1204 kB] Get: 72 http://deb.debian.org/debian trixie/main armhf libpcsclite1 armhf 2.3.1-1 [51.8 kB] Get: 73 http://deb.debian.org/debian trixie/main armhf openjdk-21-jre-headless armhf 21.0.5+11-1 [35.6 MB] Get: 74 http://deb.debian.org/debian trixie/main armhf default-jre-headless armhf 2:1.21-76 [3192 B] Get: 75 http://deb.debian.org/debian trixie/main armhf ant all 1.10.15-1 [2163 kB] Get: 76 http://deb.debian.org/debian trixie/main armhf ant-optional all 1.10.15-1 [456 kB] Get: 77 http://deb.debian.org/debian trixie/main armhf libantlr-java all 2.7.7+dfsg-14 [458 kB] Get: 78 http://deb.debian.org/debian trixie/main armhf antlr all 2.7.7+dfsg-14 [8376 B] Get: 79 http://deb.debian.org/debian trixie/main armhf at-spi2-common all 2.55.0.1-1 [170 kB] Get: 80 http://deb.debian.org/debian trixie/main armhf m4 armhf 1.4.19-5 [272 kB] Get: 81 http://deb.debian.org/debian trixie/main armhf autoconf all 2.72-3 [493 kB] Get: 82 http://deb.debian.org/debian trixie/main armhf autotools-dev all 20220109.1 [51.6 kB] Get: 83 http://deb.debian.org/debian trixie/main armhf automake all 1:1.16.5-1.3 [823 kB] Get: 84 http://deb.debian.org/debian trixie/main armhf autopoint all 0.22.5-4 [723 kB] Get: 85 http://deb.debian.org/debian trixie/main armhf unzip armhf 6.0-28 [152 kB] Get: 86 http://deb.debian.org/debian trixie/main armhf java-wrappers all 0.5 [8848 B] Get: 87 http://deb.debian.org/debian trixie/main armhf libhamcrest-java all 2.2-2 [121 kB] Get: 88 http://deb.debian.org/debian trixie/main armhf junit4 all 4.13.2-5 [350 kB] Get: 89 http://deb.debian.org/debian trixie/main armhf libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 90 http://deb.debian.org/debian trixie/main armhf libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 91 http://deb.debian.org/debian trixie/main armhf libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 92 http://deb.debian.org/debian trixie/main armhf libosgi-core-java all 8.0.0-2 [182 kB] Get: 93 http://deb.debian.org/debian trixie/main armhf libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 94 http://deb.debian.org/debian trixie/main armhf libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 95 http://deb.debian.org/debian trixie/main armhf libjansi-native-java all 1.8-2 [26.0 kB] Get: 96 http://deb.debian.org/debian trixie/main armhf libjansi1-java all 1.18-3.1 [66.6 kB] Get: 97 http://deb.debian.org/debian trixie/main armhf libjline2-java all 2.14.6-5 [151 kB] Get: 98 http://deb.debian.org/debian trixie/main armhf libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 99 http://deb.debian.org/debian trixie/main armhf libslf4j-java all 1.7.32-1 [144 kB] Get: 100 http://deb.debian.org/debian trixie/main armhf libxz-java all 1.9-1 [143 kB] Get: 101 http://deb.debian.org/debian trixie/main armhf libyaml-snake-java all 1.33-2 [321 kB] Get: 102 http://deb.debian.org/debian trixie/main armhf bnd all 5.0.1-5 [10.1 MB] Get: 103 http://deb.debian.org/debian trixie/main armhf dbus-user-session armhf 1.16.0-1 [51.0 kB] Get: 104 http://deb.debian.org/debian trixie/main armhf libdconf1 armhf 0.40.0-5 [37.0 kB] Get: 105 http://deb.debian.org/debian trixie/main armhf dconf-service armhf 0.40.0-5 [27.8 kB] Get: 106 http://deb.debian.org/debian trixie/main armhf dconf-gsettings-backend armhf 0.40.0-5 [24.1 kB] Get: 107 http://deb.debian.org/debian trixie/main armhf dctrl-tools armhf 2.24-3 [96.0 kB] Get: 108 http://deb.debian.org/debian trixie/main armhf libdebhelper-perl all 13.23 [90.6 kB] Get: 109 http://deb.debian.org/debian trixie/main armhf libtool all 2.5.4-2 [539 kB] Get: 110 http://deb.debian.org/debian trixie/main armhf dh-autoreconf all 20 [17.1 kB] Get: 111 http://deb.debian.org/debian trixie/main armhf libarchive-zip-perl all 1.68-1 [104 kB] Get: 112 http://deb.debian.org/debian trixie/main armhf libfile-stripnondeterminism-perl all 1.14.0-1 [19.5 kB] Get: 113 http://deb.debian.org/debian trixie/main armhf dh-strip-nondeterminism all 1.14.0-1 [8448 B] Get: 114 http://deb.debian.org/debian trixie/main armhf libelf1t64 armhf 0.192-4 [184 kB] Get: 115 http://deb.debian.org/debian trixie/main armhf dwz armhf 0.15-1+b2 [106 kB] Get: 116 http://deb.debian.org/debian trixie/main armhf libunistring5 armhf 1.3-1 [444 kB] Get: 117 http://deb.debian.org/debian trixie/main armhf gettext armhf 0.22.5-4 [1489 kB] Get: 118 http://deb.debian.org/debian trixie/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 119 http://deb.debian.org/debian trixie/main armhf po-debconf all 1.0.21+nmu1 [248 kB] Get: 120 http://deb.debian.org/debian trixie/main armhf debhelper all 13.23 [919 kB] Get: 121 http://deb.debian.org/debian trixie/main armhf libatk1.0-0t64 armhf 2.55.0.1-1 [44.5 kB] Get: 122 http://deb.debian.org/debian trixie/main armhf libxau6 armhf 1:1.0.11-1 [19.7 kB] Get: 123 http://deb.debian.org/debian trixie/main armhf libxdmcp6 armhf 1:1.1.5-1 [26.4 kB] Get: 124 http://deb.debian.org/debian trixie/main armhf libxcb1 armhf 1.17.0-2+b1 [140 kB] Get: 125 http://deb.debian.org/debian trixie/main armhf libx11-data all 2:1.8.10-2 [337 kB] Get: 126 http://deb.debian.org/debian trixie/main armhf libx11-6 armhf 2:1.8.10-2 [750 kB] Get: 127 http://deb.debian.org/debian trixie/main armhf libxext6 armhf 2:1.3.4-1+b3 [45.2 kB] Get: 128 http://deb.debian.org/debian trixie/main armhf libxi6 armhf 2:1.8.2-1 [73.6 kB] Get: 129 http://deb.debian.org/debian trixie/main armhf libatspi2.0-0t64 armhf 2.55.0.1-1 [66.8 kB] Get: 130 http://deb.debian.org/debian trixie/main armhf libatk-bridge2.0-0t64 armhf 2.55.0.1-1 [60.3 kB] Get: 131 http://deb.debian.org/debian trixie/main armhf libbrotli1 armhf 1.1.0-2+b6 [282 kB] Get: 132 http://deb.debian.org/debian trixie/main armhf libfreetype6 armhf 2.13.3+dfsg-1 [385 kB] Get: 133 http://deb.debian.org/debian trixie/main armhf fonts-dejavu-mono all 2.37-8 [489 kB] Get: 134 http://deb.debian.org/debian trixie/main armhf fonts-dejavu-core all 2.37-8 [840 kB] Get: 135 http://deb.debian.org/debian trixie/main armhf fontconfig-config armhf 2.15.0-2 [317 kB] Get: 136 http://deb.debian.org/debian trixie/main armhf libfontconfig1 armhf 2.15.0-2 [371 kB] Get: 137 http://deb.debian.org/debian trixie/main armhf libpixman-1-0 armhf 0.44.0-3 [164 kB] Get: 138 http://deb.debian.org/debian trixie/main armhf libxcb-render0 armhf 1.17.0-2+b1 [114 kB] Get: 139 http://deb.debian.org/debian trixie/main armhf libxcb-shm0 armhf 1.17.0-2+b1 [105 kB] Get: 140 http://deb.debian.org/debian trixie/main armhf libxrender1 armhf 1:0.9.10-1.1+b4 [25.0 kB] Get: 141 http://deb.debian.org/debian trixie/main armhf libcairo2 armhf 1.18.2-2 [443 kB] Get: 142 http://deb.debian.org/debian trixie/main armhf libcairo-gobject2 armhf 1.18.2-2 [129 kB] Get: 143 http://deb.debian.org/debian trixie/main armhf libcloudproviders0 armhf 0.3.6-1+b1 [24.7 kB] Get: 144 http://deb.debian.org/debian trixie/main armhf libcolord2 armhf 1.4.7-1+b2 [121 kB] Get: 145 http://deb.debian.org/debian trixie/main armhf libavahi-common-data armhf 0.8-16 [112 kB] Get: 146 http://deb.debian.org/debian trixie/main armhf libavahi-common3 armhf 0.8-16 [41.2 kB] Get: 147 http://deb.debian.org/debian trixie/main armhf libavahi-client3 armhf 0.8-16 [44.6 kB] Get: 148 http://deb.debian.org/debian trixie/main armhf libidn2-0 armhf 2.3.7-2+b1 [125 kB] Get: 149 http://deb.debian.org/debian trixie/main armhf libp11-kit0 armhf 0.25.5-3 [385 kB] Get: 150 http://deb.debian.org/debian trixie/main armhf libtasn1-6 armhf 4.19.0-3+b3 [43.9 kB] Get: 151 http://deb.debian.org/debian trixie/main armhf libgnutls30t64 armhf 3.8.8-2 [1370 kB] Get: 152 http://deb.debian.org/debian trixie/main armhf libcups2t64 armhf 2.4.10-2+b1 [220 kB] Get: 153 http://deb.debian.org/debian trixie/main armhf libepoxy0 armhf 1.5.10-2 [165 kB] Get: 154 http://deb.debian.org/debian trixie/main armhf libfribidi0 armhf 1.0.16-1 [24.6 kB] Get: 155 http://deb.debian.org/debian trixie/main armhf libgraphite2-3 armhf 1.3.14-2+b1 [63.1 kB] Get: 156 http://deb.debian.org/debian trixie/main armhf libharfbuzz0b armhf 10.2.0-1 [419 kB] Get: 157 http://deb.debian.org/debian trixie/main armhf fontconfig armhf 2.15.0-2 [462 kB] Get: 158 http://deb.debian.org/debian trixie/main armhf libthai-data all 0.1.29-2 [168 kB] Get: 159 http://deb.debian.org/debian trixie/main armhf libdatrie1 armhf 0.2.13-3+b1 [34.7 kB] Get: 160 http://deb.debian.org/debian trixie/main armhf libthai0 armhf 0.1.29-2+b1 [46.0 kB] Get: 161 http://deb.debian.org/debian trixie/main armhf libpango-1.0-0 armhf 1.56.1-1 [201 kB] Get: 162 http://deb.debian.org/debian trixie/main armhf libpangoft2-1.0-0 armhf 1.56.1-1 [48.6 kB] Get: 163 http://deb.debian.org/debian trixie/main armhf libpangocairo-1.0-0 armhf 1.56.1-1 [31.7 kB] Get: 164 http://deb.debian.org/debian trixie/main armhf libwayland-client0 armhf 1.23.0-1+b2 [21.3 kB] Get: 165 http://deb.debian.org/debian trixie/main armhf libwayland-cursor0 armhf 1.23.0-1+b2 [10.6 kB] Get: 166 http://deb.debian.org/debian trixie/main armhf libwayland-egl1 armhf 1.23.0-1+b2 [5568 B] Get: 167 http://deb.debian.org/debian trixie/main armhf libxcomposite1 armhf 1:0.4.6-1 [15.8 kB] Get: 168 http://deb.debian.org/debian trixie/main armhf libxfixes3 armhf 1:6.0.0-2+b4 [18.6 kB] Get: 169 http://deb.debian.org/debian trixie/main armhf libxcursor1 armhf 1:1.2.3-1 [36.2 kB] Get: 170 http://deb.debian.org/debian trixie/main armhf libxdamage1 armhf 1:1.1.6-1+b2 [14.8 kB] Get: 171 http://deb.debian.org/debian trixie/main armhf libxinerama1 armhf 2:1.1.4-3+b3 [15.7 kB] Get: 172 http://deb.debian.org/debian trixie/main armhf xkb-data all 2.42-1 [790 kB] Get: 173 http://deb.debian.org/debian trixie/main armhf libxkbcommon0 armhf 1.7.0-2 [99.7 kB] Get: 174 http://deb.debian.org/debian trixie/main armhf libxrandr2 armhf 2:1.5.4-1+b3 [33.2 kB] Get: 175 http://deb.debian.org/debian trixie/main armhf libgtk-3-common all 3.24.43-5 [4655 kB] Get: 176 http://deb.debian.org/debian trixie/main armhf libgtk-3-0t64 armhf 3.24.43-5 [2370 kB] Get: 177 http://deb.debian.org/debian trixie/main armhf libglvnd0 armhf 1.7.0-1+b2 [51.8 kB] Get: 178 http://deb.debian.org/debian trixie/main armhf libdrm-common all 2.4.123-1 [8084 B] Get: 179 http://deb.debian.org/debian trixie/main armhf libdrm2 armhf 2.4.123-1 [34.1 kB] Get: 180 http://deb.debian.org/debian trixie/main armhf libglapi-mesa armhf 24.2.8-1 [44.6 kB] Get: 181 http://deb.debian.org/debian trixie/main armhf libx11-xcb1 armhf 2:1.8.10-2 [241 kB] Get: 182 http://deb.debian.org/debian trixie/main armhf libxcb-dri2-0 armhf 1.17.0-2+b1 [106 kB] Get: 183 http://deb.debian.org/debian trixie/main armhf libxcb-dri3-0 armhf 1.17.0-2+b1 [107 kB] Get: 184 http://deb.debian.org/debian trixie/main armhf libxcb-glx0 armhf 1.17.0-2+b1 [120 kB] Get: 185 http://deb.debian.org/debian trixie/main armhf libxcb-present0 armhf 1.17.0-2+b1 [105 kB] Get: 186 http://deb.debian.org/debian trixie/main armhf libxcb-randr0 armhf 1.17.0-2+b1 [116 kB] Get: 187 http://deb.debian.org/debian trixie/main armhf libxcb-sync1 armhf 1.17.0-2+b1 [108 kB] Get: 188 http://deb.debian.org/debian trixie/main armhf libxcb-xfixes0 armhf 1.17.0-2+b1 [109 kB] Get: 189 http://deb.debian.org/debian trixie/main armhf libxshmfence1 armhf 1.3-1+b3 [8748 B] Get: 190 http://deb.debian.org/debian trixie/main armhf libxxf86vm1 armhf 1:1.1.4-1+b4 [18.2 kB] Get: 191 http://deb.debian.org/debian trixie/main armhf libdrm-amdgpu1 armhf 2.4.123-1 [20.4 kB] Get: 192 http://deb.debian.org/debian trixie/main armhf libdrm-radeon1 armhf 2.4.123-1 [19.6 kB] Get: 193 http://deb.debian.org/debian trixie/main armhf libedit2 armhf 3.1-20250104-1 [78.0 kB] Get: 194 http://deb.debian.org/debian trixie/main armhf libz3-4 armhf 4.13.3-1 [7252 kB] Get: 195 http://deb.debian.org/debian trixie/main armhf libllvm19 armhf 1:19.1.6-1+b1 [23.8 MB] Get: 196 http://deb.debian.org/debian trixie/main armhf libsensors-config all 1:3.6.0-10 [14.6 kB] Get: 197 http://deb.debian.org/debian trixie/main armhf libsensors5 armhf 1:3.6.0-10+b1 [32.3 kB] Get: 198 http://deb.debian.org/debian trixie/main armhf mesa-libgallium armhf 24.2.8-1 [7097 kB] Get: 199 http://deb.debian.org/debian trixie/main armhf libvulkan1 armhf 1.4.304.0-1 [113 kB] Get: 200 http://deb.debian.org/debian trixie/main armhf libwayland-server0 armhf 1.23.0-1+b2 [27.9 kB] Get: 201 http://deb.debian.org/debian trixie/main armhf libgbm1 armhf 24.2.8-1 [39.0 kB] Get: 202 http://deb.debian.org/debian trixie/main armhf libgl1-mesa-dri armhf 24.2.8-1 [41.0 kB] Get: 203 http://deb.debian.org/debian trixie/main armhf libglx-mesa0 armhf 24.2.8-1 [132 kB] Get: 204 http://deb.debian.org/debian trixie/main armhf libglx0 armhf 1.7.0-1+b2 [32.6 kB] Get: 205 http://deb.debian.org/debian trixie/main armhf libgl1 armhf 1.7.0-1+b2 [88.2 kB] Get: 206 http://deb.debian.org/debian trixie/main armhf libasound2-data all 1.2.13-1 [21.1 kB] Get: 207 http://deb.debian.org/debian trixie/main armhf libasound2t64 armhf 1.2.13-1+b1 [320 kB] Get: 208 http://deb.debian.org/debian trixie/main armhf libgif7 armhf 5.2.2-1+b1 [41.4 kB] Get: 209 http://deb.debian.org/debian trixie/main armhf x11-common all 1:7.7+23.2 [216 kB] Get: 210 http://deb.debian.org/debian trixie/main armhf libxtst6 armhf 2:1.2.3-1.1+b3 [24.3 kB] Get: 211 http://deb.debian.org/debian trixie/main armhf openjdk-21-jre armhf 21.0.5+11-1 [180 kB] Get: 212 http://deb.debian.org/debian trixie/main armhf default-jre armhf 2:1.21-76 [1068 B] Get: 213 http://deb.debian.org/debian trixie/main armhf openjdk-21-jdk-headless armhf 21.0.5+11-1 [78.3 MB] Get: 214 http://deb.debian.org/debian trixie/main armhf default-jdk-headless armhf 2:1.21-76 [1124 B] Get: 215 http://deb.debian.org/debian trixie/main armhf openjdk-21-jdk armhf 21.0.5+11-1 [3422 kB] Get: 216 http://deb.debian.org/debian trixie/main armhf default-jdk armhf 2:1.21-76 [1076 B] Get: 217 http://deb.debian.org/debian trixie/main armhf libgpg-error0 armhf 1.51-3 [71.9 kB] Get: 218 http://deb.debian.org/debian trixie/main armhf libassuan9 armhf 3.0.1-2 [53.7 kB] Get: 219 http://deb.debian.org/debian trixie/main armhf libgcrypt20 armhf 1.11.0-7 [727 kB] Get: 220 http://deb.debian.org/debian trixie/main armhf gpgconf armhf 2.2.46-1+b1 [105 kB] Get: 221 http://deb.debian.org/debian trixie/main armhf libksba8 armhf 1.6.7-2+b1 [115 kB] Get: 222 http://deb.debian.org/debian trixie/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-8+b1 [18.6 kB] Get: 223 http://deb.debian.org/debian trixie/main armhf libsasl2-2 armhf 2.1.28+dfsg1-8+b1 [50.6 kB] Get: 224 http://deb.debian.org/debian trixie/main armhf libldap2 armhf 2.6.9+dfsg-1 [167 kB] Get: 225 http://deb.debian.org/debian trixie/main armhf libnpth0t64 armhf 1.8-2 [21.8 kB] Get: 226 http://deb.debian.org/debian trixie/main armhf dirmngr armhf 2.2.46-1+b1 [324 kB] Get: 227 http://deb.debian.org/debian trixie/main armhf gnupg-l10n all 2.2.46-1 [702 kB] Get: 228 http://deb.debian.org/debian trixie/main armhf gpg armhf 2.2.46-1+b1 [465 kB] Get: 229 http://deb.debian.org/debian trixie/main armhf pinentry-curses armhf 1.3.1-2 [82.3 kB] Get: 230 http://deb.debian.org/debian trixie/main armhf gpg-agent armhf 2.2.46-1+b1 [210 kB] Get: 231 http://deb.debian.org/debian trixie/main armhf gpgsm armhf 2.2.46-1+b1 [219 kB] Get: 232 http://deb.debian.org/debian trixie/main armhf gnupg all 2.2.46-1 [376 kB] Get: 233 http://deb.debian.org/debian trixie/main armhf gpgv armhf 2.2.46-1+b1 [186 kB] Get: 234 http://deb.debian.org/debian trixie/main armhf sopv-gpgv all 0.1.1-1 [10.7 kB] Get: 235 http://deb.debian.org/debian trixie/main armhf libfile-dirlist-perl all 0.05-3 [7600 B] Get: 236 http://deb.debian.org/debian trixie/main armhf libfile-which-perl all 1.27-2 [15.1 kB] Get: 237 http://deb.debian.org/debian trixie/main armhf libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 238 http://deb.debian.org/debian trixie/main armhf libfile-touch-perl all 0.12-2 [8816 B] Get: 239 http://deb.debian.org/debian trixie/main armhf libio-pty-perl armhf 1:1.20-1+b2 [33.8 kB] Get: 240 http://deb.debian.org/debian trixie/main armhf libipc-run-perl all 20231003.0-2 [101 kB] Get: 241 http://deb.debian.org/debian trixie/main armhf libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 242 http://deb.debian.org/debian trixie/main armhf libclass-xsaccessor-perl armhf 1.19-4+b4 [35.1 kB] Get: 243 http://deb.debian.org/debian trixie/main armhf libb-hooks-op-check-perl armhf 0.22-3+b2 [10.3 kB] Get: 244 http://deb.debian.org/debian trixie/main armhf libdynaloader-functions-perl all 0.004-1 [12.1 kB] Get: 245 http://deb.debian.org/debian trixie/main armhf libdevel-callchecker-perl armhf 0.009-1+b1 [16.0 kB] Get: 246 http://deb.debian.org/debian trixie/main armhf libparams-classify-perl armhf 0.015-2+b4 [21.2 kB] Get: 247 http://deb.debian.org/debian trixie/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 248 http://deb.debian.org/debian trixie/main armhf libimport-into-perl all 1.002005-2 [11.3 kB] Get: 249 http://deb.debian.org/debian trixie/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 250 http://deb.debian.org/debian trixie/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 251 http://deb.debian.org/debian trixie/main armhf libmoo-perl all 2.005005-1 [58.0 kB] Get: 252 http://deb.debian.org/debian trixie/main armhf libencode-locale-perl all 1.05-3 [12.9 kB] Get: 253 http://deb.debian.org/debian trixie/main armhf libtimedate-perl all 2.3300-2 [39.3 kB] Get: 254 http://deb.debian.org/debian trixie/main armhf libhttp-date-perl all 6.06-1 [10.7 kB] Get: 255 http://deb.debian.org/debian trixie/main armhf libfile-listing-perl all 6.16-1 [12.4 kB] Get: 256 http://deb.debian.org/debian trixie/main armhf libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 257 http://deb.debian.org/debian trixie/main armhf liburi-perl all 5.30-1 [105 kB] Get: 258 http://deb.debian.org/debian trixie/main armhf libhtml-parser-perl armhf 3.83-1+b2 [96.5 kB] Get: 259 http://deb.debian.org/debian trixie/main armhf libhtml-tree-perl all 5.07-3 [211 kB] Get: 260 http://deb.debian.org/debian trixie/main armhf libclone-perl armhf 0.47-1+b1 [13.3 kB] Get: 261 http://deb.debian.org/debian trixie/main armhf libio-html-perl all 1.004-3 [16.2 kB] Get: 262 http://deb.debian.org/debian trixie/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 263 http://deb.debian.org/debian trixie/main armhf libhttp-message-perl all 7.00-2 [79.8 kB] Get: 264 http://deb.debian.org/debian trixie/main armhf libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 265 http://deb.debian.org/debian trixie/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 266 http://deb.debian.org/debian trixie/main armhf perl-openssl-defaults armhf 7+b2 [6708 B] Get: 267 http://deb.debian.org/debian trixie/main armhf libnet-ssleay-perl armhf 1.94-2 [319 kB] Get: 268 http://deb.debian.org/debian trixie/main armhf libio-socket-ssl-perl all 2.089-1 [223 kB] Get: 269 http://deb.debian.org/debian trixie/main armhf libnet-http-perl all 6.23-1 [23.9 kB] Get: 270 http://deb.debian.org/debian trixie/main armhf liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 271 http://deb.debian.org/debian trixie/main armhf libtry-tiny-perl all 0.32-1 [22.9 kB] Get: 272 http://deb.debian.org/debian trixie/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 273 http://deb.debian.org/debian trixie/main armhf libwww-perl all 6.77-1 [183 kB] Get: 274 http://deb.debian.org/debian trixie/main armhf patchutils armhf 0.4.2-1 [72.5 kB] Get: 275 http://deb.debian.org/debian trixie/main armhf wdiff armhf 1.2.2-7 [121 kB] Get: 276 http://deb.debian.org/debian trixie/main armhf devscripts all 2.25.1 [1053 kB] Get: 277 http://deb.debian.org/debian trixie/main armhf fastjar armhf 2:0.98-7 [43.9 kB] Get: 278 http://deb.debian.org/debian trixie/main armhf ivy all 2.5.2-1 [1295 kB] Get: 279 http://deb.debian.org/debian trixie/main armhf libasm-java all 9.7.1-1 [391 kB] Get: 280 http://deb.debian.org/debian trixie/main armhf libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 281 http://deb.debian.org/debian trixie/main armhf libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 282 http://deb.debian.org/debian trixie/main armhf libapache-pom-java all 33-2 [5852 B] Get: 283 http://deb.debian.org/debian trixie/main armhf libcommons-parent-java all 56-1 [10.8 kB] Get: 284 http://deb.debian.org/debian trixie/main armhf libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 285 http://deb.debian.org/debian trixie/main armhf libjansi-java all 2.4.1-2 [100 kB] Get: 286 http://deb.debian.org/debian trixie/main armhf libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 287 http://deb.debian.org/debian trixie/main armhf libqdox-java all 1.12.1-4 [173 kB] Get: 288 http://deb.debian.org/debian trixie/main armhf libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 289 http://deb.debian.org/debian trixie/main armhf libxpp3-java all 1.1.4c-3 [292 kB] Get: 290 http://deb.debian.org/debian trixie/main armhf libxstream-java all 1.4.21-1 [567 kB] Get: 291 http://deb.debian.org/debian trixie/main armhf groovy all 2.4.21-10 [12.8 MB] Get: 292 http://deb.debian.org/debian trixie/main armhf libatinject-jsr330-api-java all 1.0+ds1-6 [5112 B] Get: 293 http://deb.debian.org/debian trixie/main armhf libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 294 http://deb.debian.org/debian trixie/main armhf libcommons-codec-java all 1.17.1-1 [303 kB] Get: 295 http://deb.debian.org/debian trixie/main armhf libcommons-io-java all 2.17.0-1 [488 kB] Get: 296 http://deb.debian.org/debian trixie/main armhf libcommons-compress-java all 1.27.1-2 [641 kB] Get: 297 http://deb.debian.org/debian trixie/main armhf libcommons-lang-java all 2.6-10 [273 kB] Get: 298 http://deb.debian.org/debian trixie/main armhf liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 299 http://deb.debian.org/debian trixie/main armhf libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 300 http://deb.debian.org/debian trixie/main armhf libguava-java all 32.0.1-1 [2708 kB] Get: 301 http://deb.debian.org/debian trixie/main armhf libhttpcore-java all 4.4.16-1 [636 kB] Get: 302 http://deb.debian.org/debian trixie/main armhf libhttpclient-java all 4.5.14-1 [1247 kB] Get: 303 http://deb.debian.org/debian trixie/main armhf libjarjar-java all 1.4+svn142-12 [205 kB] Get: 304 http://deb.debian.org/debian trixie/main armhf libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 305 http://deb.debian.org/debian trixie/main armhf libjna-jni armhf 5.15.0-1 [60.7 kB] Get: 306 http://deb.debian.org/debian trixie/main armhf libjna-java all 5.15.0-1 [238 kB] Get: 307 http://deb.debian.org/debian trixie/main armhf libbcprov-java all 1.77-1 [5300 kB] Get: 308 http://deb.debian.org/debian trixie/main armhf libjunixsocket-jni armhf 2.6.1-1 [16.1 kB] Get: 309 http://deb.debian.org/debian trixie/main armhf libeclipse-jdt-annotation-java all 2.2.700+eclipse4.29-2 [25.5 kB] Get: 310 http://deb.debian.org/debian trixie/main armhf libjunixsocket-java all 2.6.1-1 [264 kB] Get: 311 http://deb.debian.org/debian trixie/main armhf libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 312 http://deb.debian.org/debian trixie/main armhf liblightcouch-java all 0.2.0-1 [75.0 kB] Get: 313 http://deb.debian.org/debian trixie/main armhf libmongodb-java all 3.6.3-2 [1901 kB] Get: 314 http://deb.debian.org/debian trixie/main armhf liblog4j2-java all 2.19.0-2 [2310 kB] Get: 315 http://deb.debian.org/debian trixie/main armhf libjzlib-java all 1.1.3-3 [79.4 kB] Get: 316 http://deb.debian.org/debian trixie/main armhf libjsch-java all 0.2.19-1 [513 kB] Get: 317 http://deb.debian.org/debian trixie/main armhf libminlog-java all 1.3.1-1 [7808 B] Get: 318 http://deb.debian.org/debian trixie/main armhf libobjenesis-java all 3.3-3 [41.3 kB] Get: 319 http://deb.debian.org/debian trixie/main armhf libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 320 http://deb.debian.org/debian trixie/main armhf libkryo-java all 2.20-7 [158 kB] Get: 321 http://deb.debian.org/debian trixie/main armhf liblogback-java all 1:1.2.11-6 [701 kB] Get: 322 http://deb.debian.org/debian trixie/main armhf libnative-platform-jni armhf 0.14-6 [10.2 kB] Get: 323 http://deb.debian.org/debian trixie/main armhf libnative-platform-java all 0.14-6 [69.8 kB] Get: 324 http://deb.debian.org/debian trixie/main armhf libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 325 http://deb.debian.org/debian trixie/main armhf libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 326 http://deb.debian.org/debian trixie/main armhf libxerces2-java all 2.12.2-1 [1440 kB] Get: 327 http://deb.debian.org/debian trixie/main armhf libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 328 http://deb.debian.org/debian trixie/main armhf libxbean-reflect-java all 4.5-9 [132 kB] Get: 329 http://deb.debian.org/debian trixie/main armhf libgradle-core-java all 4.4.1-21 [4318 kB] Get: 330 http://deb.debian.org/debian trixie/main armhf libbcpg-java all 1.77-1 [428 kB] Get: 331 http://deb.debian.org/debian trixie/main armhf libbsh-java all 2.0b4-20 [291 kB] Get: 332 http://deb.debian.org/debian trixie/main armhf libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 333 http://deb.debian.org/debian trixie/main armhf libjaxen-java all 1.1.6-5 [214 kB] Get: 334 http://deb.debian.org/debian trixie/main armhf libdom4j-java all 2.1.4-1 [312 kB] Get: 335 http://deb.debian.org/debian trixie/main armhf libcommons-lang3-java all 3.17.0-1 [641 kB] Get: 336 http://deb.debian.org/debian trixie/main armhf libbcel-java all 6.10.0-1 [674 kB] Get: 337 http://deb.debian.org/debian trixie/main armhf libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 338 http://deb.debian.org/debian trixie/main armhf libfindbugs-java all 3.1.0~preview2-4 [3535 kB] Get: 339 http://deb.debian.org/debian trixie/main armhf libaopalliance-java all 20070526-7 [8572 B] Get: 340 http://deb.debian.org/debian trixie/main armhf libguice-java all 5.1.0-1 [932 kB] Get: 341 http://deb.debian.org/debian trixie/main armhf libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 342 http://deb.debian.org/debian trixie/main armhf libjcifs-java all 1.3.19-2 [394 kB] Get: 343 http://deb.debian.org/debian trixie/main armhf libjavaewah-java all 1.2.3-1 [159 kB] Get: 344 http://deb.debian.org/debian trixie/main armhf libel-api-java all 3.0.0-3 [64.9 kB] Get: 345 http://deb.debian.org/debian trixie/main armhf libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 346 http://deb.debian.org/debian trixie/main armhf libjetty9-java all 9.4.56-1 [2964 kB] Get: 347 http://deb.debian.org/debian trixie/main armhf libjgit-java all 6.7.0-2 [3152 kB] Get: 348 http://deb.debian.org/debian trixie/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 349 http://deb.debian.org/debian trixie/main armhf libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 350 http://deb.debian.org/debian trixie/main armhf libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 351 http://deb.debian.org/debian trixie/main armhf libmaven-resolver-1.6-java all 1.6.3-3 [558 kB] Get: 352 http://deb.debian.org/debian trixie/main armhf libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 353 http://deb.debian.org/debian trixie/main armhf libmaven-parent-java all 43-2 [6252 B] Get: 354 http://deb.debian.org/debian trixie/main armhf libmaven-shared-utils-java all 3.4.2-1 [137 kB] Get: 355 http://deb.debian.org/debian trixie/main armhf libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 356 http://deb.debian.org/debian trixie/main armhf libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 357 http://deb.debian.org/debian trixie/main armhf libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 358 http://deb.debian.org/debian trixie/main armhf libplexus-interpolation-java all 1.27-1 [76.8 kB] Get: 359 http://deb.debian.org/debian trixie/main armhf libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 360 http://deb.debian.org/debian trixie/main armhf libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 361 http://deb.debian.org/debian trixie/main armhf libcdi-api-java all 1.2-4 [55.3 kB] Get: 362 http://deb.debian.org/debian trixie/main armhf libsisu-inject-java all 0.3.5-1 [352 kB] Get: 363 http://deb.debian.org/debian trixie/main armhf libsisu-plexus-java all 0.3.5-1 [183 kB] Get: 364 http://deb.debian.org/debian trixie/main armhf libmaven3-core-java all 3.8.8-2 [1579 kB] Get: 365 http://deb.debian.org/debian trixie/main armhf libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 366 http://deb.debian.org/debian trixie/main armhf libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 367 http://deb.debian.org/debian trixie/main armhf librhino-java all 1.7.14-2.1 [1357 kB] Get: 368 http://deb.debian.org/debian trixie/main armhf libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 369 http://deb.debian.org/debian trixie/main armhf libwagon-file-java all 3.5.3-1 [8388 B] Get: 370 http://deb.debian.org/debian trixie/main armhf libjsoup-java all 1.15.3-1 [431 kB] Get: 371 http://deb.debian.org/debian trixie/main armhf libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 372 http://deb.debian.org/debian trixie/main armhf libjcommander-java all 1.71-4 [73.0 kB] Get: 373 http://deb.debian.org/debian trixie/main armhf testng all 6.9.12-4 [795 kB] Get: 374 http://deb.debian.org/debian trixie/main armhf libgradle-plugins-java all 4.4.1-21 [5244 kB] Get: 375 http://deb.debian.org/debian trixie/main armhf gradle all 4.4.1-21 [400 kB] Get: 376 http://deb.debian.org/debian trixie/main armhf maven-repo-helper all 1.11 [142 kB] Get: 377 http://deb.debian.org/debian trixie/main armhf gradle-debian-helper all 2.4 [24.5 kB] Get: 378 http://deb.debian.org/debian trixie/main armhf jarwrapper all 0.80 [9692 B] Get: 379 http://deb.debian.org/debian trixie/main armhf javahelper all 0.80 [80.4 kB] Get: 380 http://deb.debian.org/debian trixie/main armhf libbyte-buddy-java all 1.14.19-1 [4756 kB] Get: 381 http://deb.debian.org/debian trixie/main armhf libcommons-math3-java all 3.6.1-4 [2040 kB] Get: 382 http://deb.debian.org/debian trixie/main armhf libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 383 http://deb.debian.org/debian trixie/main armhf libjackson2-core-java all 2.14.1-1 [447 kB] Get: 384 http://deb.debian.org/debian trixie/main armhf libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 385 http://deb.debian.org/debian trixie/main armhf liblz4-jni armhf 1.8.0-4 [9672 B] Get: 386 http://deb.debian.org/debian trixie/main armhf liblz4-java all 1.8.0-4 [116 kB] Get: 387 http://deb.debian.org/debian trixie/main armhf libmockito-java all 3.3.0-2 [510 kB] Get: 388 http://deb.debian.org/debian trixie/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 389 http://deb.debian.org/debian trixie/main armhf libtrove3-java all 3.0.3-5 [2146 kB] Fetched 320 MB in 26s (12.4 MB/s) Preconfiguring packages ... Selecting previously unselected package libapparmor1:armhf. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19569 files and directories currently installed.) Preparing to unpack .../libapparmor1_3.1.7-1+b3_armhf.deb ... Unpacking libapparmor1:armhf (3.1.7-1+b3) ... Selecting previously unselected package libsystemd-shared:armhf. Preparing to unpack .../libsystemd-shared_257.2-1_armhf.deb ... Unpacking libsystemd-shared:armhf (257.2-1) ... Selecting previously unselected package systemd. Preparing to unpack .../systemd_257.2-1_armhf.deb ... Unpacking systemd (257.2-1) ... Setting up libapparmor1:armhf (3.1.7-1+b3) ... Setting up libsystemd-shared:armhf (257.2-1) ... Setting up systemd (257.2-1) ... Created symlink '/etc/systemd/system/getty.target.wants/getty@tty1.service' -> '/usr/lib/systemd/system/getty@.service'. Created symlink '/etc/systemd/system/multi-user.target.wants/remote-fs.target' -> '/usr/lib/systemd/system/remote-fs.target'. Created symlink '/etc/systemd/system/sysinit.target.wants/systemd-pstore.service' -> '/usr/lib/systemd/system/systemd-pstore.service'. Initializing machine ID from random generator. Creating group 'systemd-journal' with GID 999. Creating group 'systemd-network' with GID 998. Creating user 'systemd-network' (systemd Network Management) with UID 998 and GID 998. /usr/lib/tmpfiles.d/legacy.conf:14: Duplicate line for path "/run/lock", ignoring. Selecting previously unselected package systemd-sysv. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20525 files and directories currently installed.) Preparing to unpack .../00-systemd-sysv_257.2-1_armhf.deb ... Unpacking systemd-sysv (257.2-1) ... Selecting previously unselected package libdbus-1-3:armhf. Preparing to unpack .../01-libdbus-1-3_1.16.0-1_armhf.deb ... Unpacking libdbus-1-3:armhf (1.16.0-1) ... Selecting previously unselected package dbus-bin. Preparing to unpack .../02-dbus-bin_1.16.0-1_armhf.deb ... Unpacking dbus-bin (1.16.0-1) ... Selecting previously unselected package dbus-session-bus-common. Preparing to unpack .../03-dbus-session-bus-common_1.16.0-1_all.deb ... Unpacking dbus-session-bus-common (1.16.0-1) ... Selecting previously unselected package libexpat1:armhf. Preparing to unpack .../04-libexpat1_2.6.4-1_armhf.deb ... Unpacking libexpat1:armhf (2.6.4-1) ... Selecting previously unselected package dbus-daemon. Preparing to unpack .../05-dbus-daemon_1.16.0-1_armhf.deb ... Unpacking dbus-daemon (1.16.0-1) ... Selecting previously unselected package dbus-system-bus-common. Preparing to unpack .../06-dbus-system-bus-common_1.16.0-1_all.deb ... Unpacking dbus-system-bus-common (1.16.0-1) ... Selecting previously unselected package dbus. Preparing to unpack .../07-dbus_1.16.0-1_armhf.deb ... Unpacking dbus (1.16.0-1) ... Selecting previously unselected package libpipeline1:armhf. Preparing to unpack .../08-libpipeline1_1.5.8-1_armhf.deb ... Unpacking libpipeline1:armhf (1.5.8-1) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../09-binfmt-support_2.2.2-7_armhf.deb ... Unpacking binfmt-support (2.2.2-7) ... Selecting previously unselected package libpython3.12-minimal:armhf. Preparing to unpack .../10-libpython3.12-minimal_3.12.8-5_armhf.deb ... Unpacking libpython3.12-minimal:armhf (3.12.8-5) ... Selecting previously unselected package python3.12-minimal. Preparing to unpack .../11-python3.12-minimal_3.12.8-5_armhf.deb ... Unpacking python3.12-minimal (3.12.8-5) ... Setting up libpython3.12-minimal:armhf (3.12.8-5) ... Setting up libexpat1:armhf (2.6.4-1) ... Setting up python3.12-minimal (3.12.8-5) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20959 files and directories currently installed.) Preparing to unpack .../00-python3-minimal_3.12.8-1_armhf.deb ... Unpacking python3-minimal (3.12.8-1) ... Selecting previously unselected package media-types. Preparing to unpack .../01-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../02-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../03-tzdata_2024b-6_all.deb ... Unpacking tzdata (2024b-6) ... Selecting previously unselected package libffi8:armhf. Preparing to unpack .../04-libffi8_3.4.6-1_armhf.deb ... Unpacking libffi8:armhf (3.4.6-1) ... Selecting previously unselected package libkrb5support0:armhf. Preparing to unpack .../05-libkrb5support0_1.21.3-3_armhf.deb ... Unpacking libkrb5support0:armhf (1.21.3-3) ... Selecting previously unselected package libcom-err2:armhf. Preparing to unpack .../06-libcom-err2_1.47.2-1_armhf.deb ... Unpacking libcom-err2:armhf (1.47.2-1) ... Selecting previously unselected package libk5crypto3:armhf. Preparing to unpack .../07-libk5crypto3_1.21.3-3_armhf.deb ... Unpacking libk5crypto3:armhf (1.21.3-3) ... Selecting previously unselected package libkeyutils1:armhf. Preparing to unpack .../08-libkeyutils1_1.6.3-4_armhf.deb ... Unpacking libkeyutils1:armhf (1.6.3-4) ... Selecting previously unselected package libkrb5-3:armhf. Preparing to unpack .../09-libkrb5-3_1.21.3-3_armhf.deb ... Unpacking libkrb5-3:armhf (1.21.3-3) ... Selecting previously unselected package libgssapi-krb5-2:armhf. Preparing to unpack .../10-libgssapi-krb5-2_1.21.3-3_armhf.deb ... Unpacking libgssapi-krb5-2:armhf (1.21.3-3) ... Selecting previously unselected package libtirpc-common. Preparing to unpack .../11-libtirpc-common_1.3.4+ds-1.3_all.deb ... Unpacking libtirpc-common (1.3.4+ds-1.3) ... Selecting previously unselected package libtirpc3t64:armhf. Preparing to unpack .../12-libtirpc3t64_1.3.4+ds-1.3+b1_armhf.deb ... Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3 to /lib/arm-linux-gnueabihf/libtirpc.so.3.usr-is-merged by libtirpc3t64' Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0 to /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0.usr-is-merged by libtirpc3t64' Unpacking libtirpc3t64:armhf (1.3.4+ds-1.3+b1) ... Selecting previously unselected package libnsl2:armhf. Preparing to unpack .../13-libnsl2_1.3.0-3+b3_armhf.deb ... Unpacking libnsl2:armhf (1.3.0-3+b3) ... Selecting previously unselected package readline-common. Preparing to unpack .../14-readline-common_8.2-6_all.deb ... Unpacking readline-common (8.2-6) ... Selecting previously unselected package libreadline8t64:armhf. Preparing to unpack .../15-libreadline8t64_8.2-6_armhf.deb ... Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8 to /lib/arm-linux-gnueabihf/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8.2 to /lib/arm-linux-gnueabihf/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8 to /lib/arm-linux-gnueabihf/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8.2 to /lib/arm-linux-gnueabihf/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:armhf (8.2-6) ... Selecting previously unselected package libpython3.12-stdlib:armhf. Preparing to unpack .../16-libpython3.12-stdlib_3.12.8-5_armhf.deb ... Unpacking libpython3.12-stdlib:armhf (3.12.8-5) ... Selecting previously unselected package python3.12. Preparing to unpack .../17-python3.12_3.12.8-5_armhf.deb ... Unpacking python3.12 (3.12.8-5) ... Selecting previously unselected package libpython3-stdlib:armhf. Preparing to unpack .../18-libpython3-stdlib_3.12.8-1_armhf.deb ... Unpacking libpython3-stdlib:armhf (3.12.8-1) ... Setting up python3-minimal (3.12.8-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 22027 files and directories currently installed.) Preparing to unpack .../000-python3_3.12.8-1_armhf.deb ... Unpacking python3 (3.12.8-1) ... Selecting previously unselected package libproc2-0:armhf. Preparing to unpack .../001-libproc2-0_2%3a4.0.4-6_armhf.deb ... Unpacking libproc2-0:armhf (2:4.0.4-6) ... Selecting previously unselected package procps. Preparing to unpack .../002-procps_2%3a4.0.4-6_armhf.deb ... Unpacking procps (2:4.0.4-6) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../003-sensible-utils_0.0.24_all.deb ... Unpacking sensible-utils (0.0.24) ... Selecting previously unselected package openssl. Preparing to unpack .../004-openssl_3.4.0-2_armhf.deb ... Unpacking openssl (3.4.0-2) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../005-ca-certificates_20241223_all.deb ... Unpacking ca-certificates (20241223) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../006-libmagic-mgc_1%3a5.45-3+b1_armhf.deb ... Unpacking libmagic-mgc (1:5.45-3+b1) ... Selecting previously unselected package libmagic1t64:armhf. Preparing to unpack .../007-libmagic1t64_1%3a5.45-3+b1_armhf.deb ... Unpacking libmagic1t64:armhf (1:5.45-3+b1) ... Selecting previously unselected package file. Preparing to unpack .../008-file_1%3a5.45-3+b1_armhf.deb ... Unpacking file (1:5.45-3+b1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../009-gettext-base_0.22.5-4_armhf.deb ... Unpacking gettext-base (0.22.5-4) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../010-libuchardet0_0.0.8-1+b2_armhf.deb ... Unpacking libuchardet0:armhf (0.0.8-1+b2) ... Selecting previously unselected package groff-base. Preparing to unpack .../011-groff-base_1.23.0-7_armhf.deb ... Unpacking groff-base (1.23.0-7) ... Selecting previously unselected package libpam-systemd:armhf. Preparing to unpack .../012-libpam-systemd_257.2-1_armhf.deb ... Unpacking libpam-systemd:armhf (257.2-1) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../013-bsdextrautils_2.40.4-1_armhf.deb ... Unpacking bsdextrautils (2.40.4-1) ... Selecting previously unselected package man-db. Preparing to unpack .../014-man-db_2.13.0-1_armhf.deb ... Unpacking man-db (2.13.0-1) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.12+dfsg-2_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-2) ... Selecting previously unselected package libglib2.0-0t64:armhf. Preparing to unpack .../016-libglib2.0-0t64_2.82.4-2_armhf.deb ... Unpacking libglib2.0-0t64:armhf (2.82.4-2) ... Selecting previously unselected package libicu72:armhf. Preparing to unpack .../017-libicu72_72.1-6_armhf.deb ... Unpacking libicu72:armhf (72.1-6) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../018-libxml2_2.12.7+dfsg+really2.9.14-0.2+b1_armhf.deb ... Unpacking libxml2:armhf (2.12.7+dfsg+really2.9.14-0.2+b1) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.4-5+b2_armhf.deb ... Unpacking shared-mime-info (2.4-5+b2) ... Selecting previously unselected package libjpeg62-turbo:armhf. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-3+b1_armhf.deb ... Unpacking libjpeg62-turbo:armhf (1:2.1.5-3+b1) ... Selecting previously unselected package libpng16-16t64:armhf. Preparing to unpack .../021-libpng16-16t64_1.6.44-3_armhf.deb ... Unpacking libpng16-16t64:armhf (1.6.44-3) ... Selecting previously unselected package libdeflate0:armhf. Preparing to unpack .../022-libdeflate0_1.23-1+b1_armhf.deb ... Unpacking libdeflate0:armhf (1.23-1+b1) ... Selecting previously unselected package libjbig0:armhf. Preparing to unpack .../023-libjbig0_2.1-6.1+b2_armhf.deb ... Unpacking libjbig0:armhf (2.1-6.1+b2) ... Selecting previously unselected package liblerc4:armhf. Preparing to unpack .../024-liblerc4_4.0.0+ds-5_armhf.deb ... Unpacking liblerc4:armhf (4.0.0+ds-5) ... Selecting previously unselected package libsharpyuv0:armhf. Preparing to unpack .../025-libsharpyuv0_1.5.0-0.1_armhf.deb ... Unpacking libsharpyuv0:armhf (1.5.0-0.1) ... Selecting previously unselected package libwebp7:armhf. Preparing to unpack .../026-libwebp7_1.5.0-0.1_armhf.deb ... Unpacking libwebp7:armhf (1.5.0-0.1) ... Selecting previously unselected package libtiff6:armhf. Preparing to unpack .../027-libtiff6_4.5.1+git230720-5_armhf.deb ... Unpacking libtiff6:armhf (4.5.1+git230720-5) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf. Preparing to unpack .../028-libgdk-pixbuf-2.0-0_2.42.12+dfsg-2_armhf.deb ... Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-2) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../029-gtk-update-icon-cache_4.16.12+ds-1_armhf.deb ... No diversion 'diversion of /usr/sbin/update-icon-caches to /usr/sbin/update-icon-caches.gtk2 by libgtk-3-bin', none removed. No diversion 'diversion of /usr/share/man/man8/update-icon-caches.8.gz to /usr/share/man/man8/update-icon-caches.gtk2.8.gz by libgtk-3-bin', none removed. Unpacking gtk-update-icon-cache (4.16.12+ds-1) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../030-hicolor-icon-theme_0.18-1_all.deb ... Unpacking hicolor-icon-theme (0.18-1) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../031-adwaita-icon-theme_47.0-2_all.deb ... Unpacking adwaita-icon-theme (47.0-2) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../032-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../033-java-common_0.76_all.deb ... Unpacking java-common (0.76) ... Selecting previously unselected package liblcms2-2:armhf. Preparing to unpack .../034-liblcms2-2_2.16-2_armhf.deb ... Unpacking liblcms2-2:armhf (2.16-2) ... Selecting previously unselected package libnspr4:armhf. Preparing to unpack .../035-libnspr4_2%3a4.36-1_armhf.deb ... Unpacking libnspr4:armhf (2:4.36-1) ... Selecting previously unselected package libnss3:armhf. Preparing to unpack .../036-libnss3_2%3a3.107-1_armhf.deb ... Unpacking libnss3:armhf (2:3.107-1) ... Selecting previously unselected package libpcsclite1:armhf. Preparing to unpack .../037-libpcsclite1_2.3.1-1_armhf.deb ... Unpacking libpcsclite1:armhf (2.3.1-1) ... Selecting previously unselected package openjdk-21-jre-headless:armhf. Preparing to unpack .../038-openjdk-21-jre-headless_21.0.5+11-1_armhf.deb ... Unpacking openjdk-21-jre-headless:armhf (21.0.5+11-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../039-default-jre-headless_2%3a1.21-76_armhf.deb ... Unpacking default-jre-headless (2:1.21-76) ... Selecting previously unselected package ant. Preparing to unpack .../040-ant_1.10.15-1_all.deb ... Unpacking ant (1.10.15-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../041-ant-optional_1.10.15-1_all.deb ... Unpacking ant-optional (1.10.15-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../042-libantlr-java_2.7.7+dfsg-14_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-14) ... Selecting previously unselected package antlr. Preparing to unpack .../043-antlr_2.7.7+dfsg-14_all.deb ... Unpacking antlr (2.7.7+dfsg-14) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../044-at-spi2-common_2.55.0.1-1_all.deb ... Unpacking at-spi2-common (2.55.0.1-1) ... Selecting previously unselected package m4. Preparing to unpack .../045-m4_1.4.19-5_armhf.deb ... Unpacking m4 (1.4.19-5) ... Selecting previously unselected package autoconf. Preparing to unpack .../046-autoconf_2.72-3_all.deb ... Unpacking autoconf (2.72-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../047-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../048-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../049-autopoint_0.22.5-4_all.deb ... Unpacking autopoint (0.22.5-4) ... Selecting previously unselected package unzip. Preparing to unpack .../050-unzip_6.0-28_armhf.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../051-java-wrappers_0.5_all.deb ... Unpacking java-wrappers (0.5) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../052-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../053-junit4_4.13.2-5_all.deb ... Unpacking junit4 (4.13.2-5) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../054-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../055-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../056-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../057-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../058-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../059-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../060-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../061-libjansi1-java_1.18-3.1_all.deb ... Unpacking libjansi1-java (1.18-3.1) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../062-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../063-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../064-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../065-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../066-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../067-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dbus-user-session. Preparing to unpack .../068-dbus-user-session_1.16.0-1_armhf.deb ... Unpacking dbus-user-session (1.16.0-1) ... Selecting previously unselected package libdconf1:armhf. Preparing to unpack .../069-libdconf1_0.40.0-5_armhf.deb ... Unpacking libdconf1:armhf (0.40.0-5) ... Selecting previously unselected package dconf-service. Preparing to unpack .../070-dconf-service_0.40.0-5_armhf.deb ... Unpacking dconf-service (0.40.0-5) ... Selecting previously unselected package dconf-gsettings-backend:armhf. Preparing to unpack .../071-dconf-gsettings-backend_0.40.0-5_armhf.deb ... Unpacking dconf-gsettings-backend:armhf (0.40.0-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../072-dctrl-tools_2.24-3_armhf.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../073-libdebhelper-perl_13.23_all.deb ... Unpacking libdebhelper-perl (13.23) ... Selecting previously unselected package libtool. Preparing to unpack .../074-libtool_2.5.4-2_all.deb ... Unpacking libtool (2.5.4-2) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../075-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../076-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../077-libfile-stripnondeterminism-perl_1.14.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.14.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../078-dh-strip-nondeterminism_1.14.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.14.0-1) ... Selecting previously unselected package libelf1t64:armhf. Preparing to unpack .../079-libelf1t64_0.192-4_armhf.deb ... Unpacking libelf1t64:armhf (0.192-4) ... Selecting previously unselected package dwz. Preparing to unpack .../080-dwz_0.15-1+b2_armhf.deb ... Unpacking dwz (0.15-1+b2) ... Selecting previously unselected package libunistring5:armhf. Preparing to unpack .../081-libunistring5_1.3-1_armhf.deb ... Unpacking libunistring5:armhf (1.3-1) ... Selecting previously unselected package gettext. Preparing to unpack .../082-gettext_0.22.5-4_armhf.deb ... Unpacking gettext (0.22.5-4) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../083-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../084-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../085-debhelper_13.23_all.deb ... Unpacking debhelper (13.23) ... Selecting previously unselected package libatk1.0-0t64:armhf. Preparing to unpack .../086-libatk1.0-0t64_2.55.0.1-1_armhf.deb ... Unpacking libatk1.0-0t64:armhf (2.55.0.1-1) ... Selecting previously unselected package libxau6:armhf. Preparing to unpack .../087-libxau6_1%3a1.0.11-1_armhf.deb ... Unpacking libxau6:armhf (1:1.0.11-1) ... Selecting previously unselected package libxdmcp6:armhf. Preparing to unpack .../088-libxdmcp6_1%3a1.1.5-1_armhf.deb ... Unpacking libxdmcp6:armhf (1:1.1.5-1) ... Selecting previously unselected package libxcb1:armhf. Preparing to unpack .../089-libxcb1_1.17.0-2+b1_armhf.deb ... Unpacking libxcb1:armhf (1.17.0-2+b1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../090-libx11-data_2%3a1.8.10-2_all.deb ... Unpacking libx11-data (2:1.8.10-2) ... Selecting previously unselected package libx11-6:armhf. Preparing to unpack .../091-libx11-6_2%3a1.8.10-2_armhf.deb ... Unpacking libx11-6:armhf (2:1.8.10-2) ... Selecting previously unselected package libxext6:armhf. Preparing to unpack .../092-libxext6_2%3a1.3.4-1+b3_armhf.deb ... Unpacking libxext6:armhf (2:1.3.4-1+b3) ... Selecting previously unselected package libxi6:armhf. Preparing to unpack .../093-libxi6_2%3a1.8.2-1_armhf.deb ... Unpacking libxi6:armhf (2:1.8.2-1) ... Selecting previously unselected package libatspi2.0-0t64:armhf. Preparing to unpack .../094-libatspi2.0-0t64_2.55.0.1-1_armhf.deb ... Unpacking libatspi2.0-0t64:armhf (2.55.0.1-1) ... Selecting previously unselected package libatk-bridge2.0-0t64:armhf. Preparing to unpack .../095-libatk-bridge2.0-0t64_2.55.0.1-1_armhf.deb ... Unpacking libatk-bridge2.0-0t64:armhf (2.55.0.1-1) ... Selecting previously unselected package libbrotli1:armhf. Preparing to unpack .../096-libbrotli1_1.1.0-2+b6_armhf.deb ... Unpacking libbrotli1:armhf (1.1.0-2+b6) ... Selecting previously unselected package libfreetype6:armhf. Preparing to unpack .../097-libfreetype6_2.13.3+dfsg-1_armhf.deb ... Unpacking libfreetype6:armhf (2.13.3+dfsg-1) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../098-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../099-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../100-fontconfig-config_2.15.0-2_armhf.deb ... Unpacking fontconfig-config (2.15.0-2) ... Selecting previously unselected package libfontconfig1:armhf. Preparing to unpack .../101-libfontconfig1_2.15.0-2_armhf.deb ... Unpacking libfontconfig1:armhf (2.15.0-2) ... Selecting previously unselected package libpixman-1-0:armhf. Preparing to unpack .../102-libpixman-1-0_0.44.0-3_armhf.deb ... Unpacking libpixman-1-0:armhf (0.44.0-3) ... Selecting previously unselected package libxcb-render0:armhf. Preparing to unpack .../103-libxcb-render0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-render0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxcb-shm0:armhf. Preparing to unpack .../104-libxcb-shm0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-shm0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxrender1:armhf. Preparing to unpack .../105-libxrender1_1%3a0.9.10-1.1+b4_armhf.deb ... Unpacking libxrender1:armhf (1:0.9.10-1.1+b4) ... Selecting previously unselected package libcairo2:armhf. Preparing to unpack .../106-libcairo2_1.18.2-2_armhf.deb ... Unpacking libcairo2:armhf (1.18.2-2) ... Selecting previously unselected package libcairo-gobject2:armhf. Preparing to unpack .../107-libcairo-gobject2_1.18.2-2_armhf.deb ... Unpacking libcairo-gobject2:armhf (1.18.2-2) ... Selecting previously unselected package libcloudproviders0:armhf. Preparing to unpack .../108-libcloudproviders0_0.3.6-1+b1_armhf.deb ... Unpacking libcloudproviders0:armhf (0.3.6-1+b1) ... Selecting previously unselected package libcolord2:armhf. Preparing to unpack .../109-libcolord2_1.4.7-1+b2_armhf.deb ... Unpacking libcolord2:armhf (1.4.7-1+b2) ... Selecting previously unselected package libavahi-common-data:armhf. Preparing to unpack .../110-libavahi-common-data_0.8-16_armhf.deb ... Unpacking libavahi-common-data:armhf (0.8-16) ... Selecting previously unselected package libavahi-common3:armhf. Preparing to unpack .../111-libavahi-common3_0.8-16_armhf.deb ... Unpacking libavahi-common3:armhf (0.8-16) ... Selecting previously unselected package libavahi-client3:armhf. Preparing to unpack .../112-libavahi-client3_0.8-16_armhf.deb ... Unpacking libavahi-client3:armhf (0.8-16) ... Selecting previously unselected package libidn2-0:armhf. Preparing to unpack .../113-libidn2-0_2.3.7-2+b1_armhf.deb ... Unpacking libidn2-0:armhf (2.3.7-2+b1) ... Selecting previously unselected package libp11-kit0:armhf. Preparing to unpack .../114-libp11-kit0_0.25.5-3_armhf.deb ... Unpacking libp11-kit0:armhf (0.25.5-3) ... Selecting previously unselected package libtasn1-6:armhf. Preparing to unpack .../115-libtasn1-6_4.19.0-3+b3_armhf.deb ... Unpacking libtasn1-6:armhf (4.19.0-3+b3) ... Selecting previously unselected package libgnutls30t64:armhf. Preparing to unpack .../116-libgnutls30t64_3.8.8-2_armhf.deb ... Unpacking libgnutls30t64:armhf (3.8.8-2) ... Selecting previously unselected package libcups2t64:armhf. Preparing to unpack .../117-libcups2t64_2.4.10-2+b1_armhf.deb ... Unpacking libcups2t64:armhf (2.4.10-2+b1) ... Selecting previously unselected package libepoxy0:armhf. Preparing to unpack .../118-libepoxy0_1.5.10-2_armhf.deb ... Unpacking libepoxy0:armhf (1.5.10-2) ... Selecting previously unselected package libfribidi0:armhf. Preparing to unpack .../119-libfribidi0_1.0.16-1_armhf.deb ... Unpacking libfribidi0:armhf (1.0.16-1) ... Selecting previously unselected package libgraphite2-3:armhf. Preparing to unpack .../120-libgraphite2-3_1.3.14-2+b1_armhf.deb ... Unpacking libgraphite2-3:armhf (1.3.14-2+b1) ... Selecting previously unselected package libharfbuzz0b:armhf. Preparing to unpack .../121-libharfbuzz0b_10.2.0-1_armhf.deb ... Unpacking libharfbuzz0b:armhf (10.2.0-1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../122-fontconfig_2.15.0-2_armhf.deb ... Unpacking fontconfig (2.15.0-2) ... Selecting previously unselected package libthai-data. Preparing to unpack .../123-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:armhf. Preparing to unpack .../124-libdatrie1_0.2.13-3+b1_armhf.deb ... Unpacking libdatrie1:armhf (0.2.13-3+b1) ... Selecting previously unselected package libthai0:armhf. Preparing to unpack .../125-libthai0_0.1.29-2+b1_armhf.deb ... Unpacking libthai0:armhf (0.1.29-2+b1) ... Selecting previously unselected package libpango-1.0-0:armhf. Preparing to unpack .../126-libpango-1.0-0_1.56.1-1_armhf.deb ... Unpacking libpango-1.0-0:armhf (1.56.1-1) ... Selecting previously unselected package libpangoft2-1.0-0:armhf. Preparing to unpack .../127-libpangoft2-1.0-0_1.56.1-1_armhf.deb ... Unpacking libpangoft2-1.0-0:armhf (1.56.1-1) ... Selecting previously unselected package libpangocairo-1.0-0:armhf. Preparing to unpack .../128-libpangocairo-1.0-0_1.56.1-1_armhf.deb ... Unpacking libpangocairo-1.0-0:armhf (1.56.1-1) ... Selecting previously unselected package libwayland-client0:armhf. Preparing to unpack .../129-libwayland-client0_1.23.0-1+b2_armhf.deb ... Unpacking libwayland-client0:armhf (1.23.0-1+b2) ... Selecting previously unselected package libwayland-cursor0:armhf. Preparing to unpack .../130-libwayland-cursor0_1.23.0-1+b2_armhf.deb ... Unpacking libwayland-cursor0:armhf (1.23.0-1+b2) ... Selecting previously unselected package libwayland-egl1:armhf. Preparing to unpack .../131-libwayland-egl1_1.23.0-1+b2_armhf.deb ... Unpacking libwayland-egl1:armhf (1.23.0-1+b2) ... Selecting previously unselected package libxcomposite1:armhf. Preparing to unpack .../132-libxcomposite1_1%3a0.4.6-1_armhf.deb ... Unpacking libxcomposite1:armhf (1:0.4.6-1) ... Selecting previously unselected package libxfixes3:armhf. Preparing to unpack .../133-libxfixes3_1%3a6.0.0-2+b4_armhf.deb ... Unpacking libxfixes3:armhf (1:6.0.0-2+b4) ... Selecting previously unselected package libxcursor1:armhf. Preparing to unpack .../134-libxcursor1_1%3a1.2.3-1_armhf.deb ... Unpacking libxcursor1:armhf (1:1.2.3-1) ... Selecting previously unselected package libxdamage1:armhf. Preparing to unpack .../135-libxdamage1_1%3a1.1.6-1+b2_armhf.deb ... Unpacking libxdamage1:armhf (1:1.1.6-1+b2) ... Selecting previously unselected package libxinerama1:armhf. Preparing to unpack .../136-libxinerama1_2%3a1.1.4-3+b3_armhf.deb ... Unpacking libxinerama1:armhf (2:1.1.4-3+b3) ... Selecting previously unselected package xkb-data. Preparing to unpack .../137-xkb-data_2.42-1_all.deb ... Unpacking xkb-data (2.42-1) ... Selecting previously unselected package libxkbcommon0:armhf. Preparing to unpack .../138-libxkbcommon0_1.7.0-2_armhf.deb ... Unpacking libxkbcommon0:armhf (1.7.0-2) ... Selecting previously unselected package libxrandr2:armhf. Preparing to unpack .../139-libxrandr2_2%3a1.5.4-1+b3_armhf.deb ... Unpacking libxrandr2:armhf (2:1.5.4-1+b3) ... Selecting previously unselected package libgtk-3-common. Preparing to unpack .../140-libgtk-3-common_3.24.43-5_all.deb ... Unpacking libgtk-3-common (3.24.43-5) ... Selecting previously unselected package libgtk-3-0t64:armhf. Preparing to unpack .../141-libgtk-3-0t64_3.24.43-5_armhf.deb ... Unpacking libgtk-3-0t64:armhf (3.24.43-5) ... Selecting previously unselected package libglvnd0:armhf. Preparing to unpack .../142-libglvnd0_1.7.0-1+b2_armhf.deb ... Unpacking libglvnd0:armhf (1.7.0-1+b2) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../143-libdrm-common_2.4.123-1_all.deb ... Unpacking libdrm-common (2.4.123-1) ... Selecting previously unselected package libdrm2:armhf. Preparing to unpack .../144-libdrm2_2.4.123-1_armhf.deb ... Unpacking libdrm2:armhf (2.4.123-1) ... Selecting previously unselected package libglapi-mesa:armhf. Preparing to unpack .../145-libglapi-mesa_24.2.8-1_armhf.deb ... Unpacking libglapi-mesa:armhf (24.2.8-1) ... Selecting previously unselected package libx11-xcb1:armhf. Preparing to unpack .../146-libx11-xcb1_2%3a1.8.10-2_armhf.deb ... Unpacking libx11-xcb1:armhf (2:1.8.10-2) ... Selecting previously unselected package libxcb-dri2-0:armhf. Preparing to unpack .../147-libxcb-dri2-0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-dri2-0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxcb-dri3-0:armhf. Preparing to unpack .../148-libxcb-dri3-0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-dri3-0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxcb-glx0:armhf. Preparing to unpack .../149-libxcb-glx0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-glx0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxcb-present0:armhf. Preparing to unpack .../150-libxcb-present0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-present0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxcb-randr0:armhf. Preparing to unpack .../151-libxcb-randr0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-randr0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxcb-sync1:armhf. Preparing to unpack .../152-libxcb-sync1_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-sync1:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxcb-xfixes0:armhf. Preparing to unpack .../153-libxcb-xfixes0_1.17.0-2+b1_armhf.deb ... Unpacking libxcb-xfixes0:armhf (1.17.0-2+b1) ... Selecting previously unselected package libxshmfence1:armhf. Preparing to unpack .../154-libxshmfence1_1.3-1+b3_armhf.deb ... Unpacking libxshmfence1:armhf (1.3-1+b3) ... Selecting previously unselected package libxxf86vm1:armhf. Preparing to unpack .../155-libxxf86vm1_1%3a1.1.4-1+b4_armhf.deb ... Unpacking libxxf86vm1:armhf (1:1.1.4-1+b4) ... Selecting previously unselected package libdrm-amdgpu1:armhf. Preparing to unpack .../156-libdrm-amdgpu1_2.4.123-1_armhf.deb ... Unpacking libdrm-amdgpu1:armhf (2.4.123-1) ... Selecting previously unselected package libdrm-radeon1:armhf. Preparing to unpack .../157-libdrm-radeon1_2.4.123-1_armhf.deb ... Unpacking libdrm-radeon1:armhf (2.4.123-1) ... Selecting previously unselected package libedit2:armhf. Preparing to unpack .../158-libedit2_3.1-20250104-1_armhf.deb ... Unpacking libedit2:armhf (3.1-20250104-1) ... Selecting previously unselected package libz3-4:armhf. Preparing to unpack .../159-libz3-4_4.13.3-1_armhf.deb ... Unpacking libz3-4:armhf (4.13.3-1) ... Selecting previously unselected package libllvm19:armhf. Preparing to unpack .../160-libllvm19_1%3a19.1.6-1+b1_armhf.deb ... Unpacking libllvm19:armhf (1:19.1.6-1+b1) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../161-libsensors-config_1%3a3.6.0-10_all.deb ... Unpacking libsensors-config (1:3.6.0-10) ... Selecting previously unselected package libsensors5:armhf. Preparing to unpack .../162-libsensors5_1%3a3.6.0-10+b1_armhf.deb ... Unpacking libsensors5:armhf (1:3.6.0-10+b1) ... Selecting previously unselected package mesa-libgallium:armhf. Preparing to unpack .../163-mesa-libgallium_24.2.8-1_armhf.deb ... Unpacking mesa-libgallium:armhf (24.2.8-1) ... Selecting previously unselected package libvulkan1:armhf. Preparing to unpack .../164-libvulkan1_1.4.304.0-1_armhf.deb ... Unpacking libvulkan1:armhf (1.4.304.0-1) ... Selecting previously unselected package libwayland-server0:armhf. Preparing to unpack .../165-libwayland-server0_1.23.0-1+b2_armhf.deb ... Unpacking libwayland-server0:armhf (1.23.0-1+b2) ... Selecting previously unselected package libgbm1:armhf. Preparing to unpack .../166-libgbm1_24.2.8-1_armhf.deb ... Unpacking libgbm1:armhf (24.2.8-1) ... Selecting previously unselected package libgl1-mesa-dri:armhf. Preparing to unpack .../167-libgl1-mesa-dri_24.2.8-1_armhf.deb ... Unpacking libgl1-mesa-dri:armhf (24.2.8-1) ... Selecting previously unselected package libglx-mesa0:armhf. Preparing to unpack .../168-libglx-mesa0_24.2.8-1_armhf.deb ... Unpacking libglx-mesa0:armhf (24.2.8-1) ... Selecting previously unselected package libglx0:armhf. Preparing to unpack .../169-libglx0_1.7.0-1+b2_armhf.deb ... Unpacking libglx0:armhf (1.7.0-1+b2) ... Selecting previously unselected package libgl1:armhf. Preparing to unpack .../170-libgl1_1.7.0-1+b2_armhf.deb ... Unpacking libgl1:armhf (1.7.0-1+b2) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../171-libasound2-data_1.2.13-1_all.deb ... Unpacking libasound2-data (1.2.13-1) ... Selecting previously unselected package libasound2t64:armhf. Preparing to unpack .../172-libasound2t64_1.2.13-1+b1_armhf.deb ... Unpacking libasound2t64:armhf (1.2.13-1+b1) ... Selecting previously unselected package libgif7:armhf. Preparing to unpack .../173-libgif7_5.2.2-1+b1_armhf.deb ... Unpacking libgif7:armhf (5.2.2-1+b1) ... Selecting previously unselected package x11-common. Preparing to unpack .../174-x11-common_1%3a7.7+23.2_all.deb ... Unpacking x11-common (1:7.7+23.2) ... Selecting previously unselected package libxtst6:armhf. Preparing to unpack .../175-libxtst6_2%3a1.2.3-1.1+b3_armhf.deb ... Unpacking libxtst6:armhf (2:1.2.3-1.1+b3) ... Selecting previously unselected package openjdk-21-jre:armhf. Preparing to unpack .../176-openjdk-21-jre_21.0.5+11-1_armhf.deb ... Unpacking openjdk-21-jre:armhf (21.0.5+11-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../177-default-jre_2%3a1.21-76_armhf.deb ... Unpacking default-jre (2:1.21-76) ... Selecting previously unselected package openjdk-21-jdk-headless:armhf. Preparing to unpack .../178-openjdk-21-jdk-headless_21.0.5+11-1_armhf.deb ... Unpacking openjdk-21-jdk-headless:armhf (21.0.5+11-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../179-default-jdk-headless_2%3a1.21-76_armhf.deb ... Unpacking default-jdk-headless (2:1.21-76) ... Selecting previously unselected package openjdk-21-jdk:armhf. Preparing to unpack .../180-openjdk-21-jdk_21.0.5+11-1_armhf.deb ... Unpacking openjdk-21-jdk:armhf (21.0.5+11-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../181-default-jdk_2%3a1.21-76_armhf.deb ... Unpacking default-jdk (2:1.21-76) ... Selecting previously unselected package libgpg-error0:armhf. Preparing to unpack .../182-libgpg-error0_1.51-3_armhf.deb ... Unpacking libgpg-error0:armhf (1.51-3) ... Selecting previously unselected package libassuan9:armhf. Preparing to unpack .../183-libassuan9_3.0.1-2_armhf.deb ... Unpacking libassuan9:armhf (3.0.1-2) ... Selecting previously unselected package libgcrypt20:armhf. Preparing to unpack .../184-libgcrypt20_1.11.0-7_armhf.deb ... Unpacking libgcrypt20:armhf (1.11.0-7) ... Selecting previously unselected package gpgconf. Preparing to unpack .../185-gpgconf_2.2.46-1+b1_armhf.deb ... Unpacking gpgconf (2.2.46-1+b1) ... Selecting previously unselected package libksba8:armhf. Preparing to unpack .../186-libksba8_1.6.7-2+b1_armhf.deb ... Unpacking libksba8:armhf (1.6.7-2+b1) ... Selecting previously unselected package libsasl2-modules-db:armhf. Preparing to unpack .../187-libsasl2-modules-db_2.1.28+dfsg1-8+b1_armhf.deb ... Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-8+b1) ... Selecting previously unselected package libsasl2-2:armhf. Preparing to unpack .../188-libsasl2-2_2.1.28+dfsg1-8+b1_armhf.deb ... Unpacking libsasl2-2:armhf (2.1.28+dfsg1-8+b1) ... Selecting previously unselected package libldap2:armhf. Preparing to unpack .../189-libldap2_2.6.9+dfsg-1_armhf.deb ... Unpacking libldap2:armhf (2.6.9+dfsg-1) ... Selecting previously unselected package libnpth0t64:armhf. Preparing to unpack .../190-libnpth0t64_1.8-2_armhf.deb ... Unpacking libnpth0t64:armhf (1.8-2) ... Selecting previously unselected package dirmngr. Preparing to unpack .../191-dirmngr_2.2.46-1+b1_armhf.deb ... Unpacking dirmngr (2.2.46-1+b1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../192-gnupg-l10n_2.2.46-1_all.deb ... Unpacking gnupg-l10n (2.2.46-1) ... Selecting previously unselected package gpg. Preparing to unpack .../193-gpg_2.2.46-1+b1_armhf.deb ... Unpacking gpg (2.2.46-1+b1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../194-pinentry-curses_1.3.1-2_armhf.deb ... Unpacking pinentry-curses (1.3.1-2) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../195-gpg-agent_2.2.46-1+b1_armhf.deb ... Unpacking gpg-agent (2.2.46-1+b1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../196-gpgsm_2.2.46-1+b1_armhf.deb ... Unpacking gpgsm (2.2.46-1+b1) ... Selecting previously unselected package gnupg. Preparing to unpack .../197-gnupg_2.2.46-1_all.deb ... Unpacking gnupg (2.2.46-1) ... Selecting previously unselected package gpgv. Preparing to unpack .../198-gpgv_2.2.46-1+b1_armhf.deb ... Unpacking gpgv (2.2.46-1+b1) ... Selecting previously unselected package sopv-gpgv. Preparing to unpack .../199-sopv-gpgv_0.1.1-1_all.deb ... Unpacking sopv-gpgv (0.1.1-1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../200-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../201-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../202-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../203-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../204-libio-pty-perl_1%3a1.20-1+b2_armhf.deb ... Unpacking libio-pty-perl (1:1.20-1+b2) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../205-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../206-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../207-libclass-xsaccessor-perl_1.19-4+b4_armhf.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b4) ... Selecting previously unselected package libb-hooks-op-check-perl:armhf. Preparing to unpack .../208-libb-hooks-op-check-perl_0.22-3+b2_armhf.deb ... Unpacking libb-hooks-op-check-perl:armhf (0.22-3+b2) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../209-libdynaloader-functions-perl_0.004-1_all.deb ... Unpacking libdynaloader-functions-perl (0.004-1) ... Selecting previously unselected package libdevel-callchecker-perl:armhf. Preparing to unpack .../210-libdevel-callchecker-perl_0.009-1+b1_armhf.deb ... Unpacking libdevel-callchecker-perl:armhf (0.009-1+b1) ... Selecting previously unselected package libparams-classify-perl:armhf. Preparing to unpack .../211-libparams-classify-perl_0.015-2+b4_armhf.deb ... Unpacking libparams-classify-perl:armhf (0.015-2+b4) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../212-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../213-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../214-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../215-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../216-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../217-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../218-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../219-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../220-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../221-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../222-liburi-perl_5.30-1_all.deb ... Unpacking liburi-perl (5.30-1) ... Selecting previously unselected package libhtml-parser-perl:armhf. Preparing to unpack .../223-libhtml-parser-perl_3.83-1+b2_armhf.deb ... Unpacking libhtml-parser-perl:armhf (3.83-1+b2) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../224-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:armhf. Preparing to unpack .../225-libclone-perl_0.47-1+b1_armhf.deb ... Unpacking libclone-perl:armhf (0.47-1+b1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../226-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../227-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../228-libhttp-message-perl_7.00-2_all.deb ... Unpacking libhttp-message-perl (7.00-2) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../229-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../230-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:armhf. Preparing to unpack .../231-perl-openssl-defaults_7+b2_armhf.deb ... Unpacking perl-openssl-defaults:armhf (7+b2) ... Selecting previously unselected package libnet-ssleay-perl:armhf. Preparing to unpack .../232-libnet-ssleay-perl_1.94-2_armhf.deb ... Unpacking libnet-ssleay-perl:armhf (1.94-2) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../233-libio-socket-ssl-perl_2.089-1_all.deb ... Unpacking libio-socket-ssl-perl (2.089-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../234-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../235-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../236-libtry-tiny-perl_0.32-1_all.deb ... Unpacking libtry-tiny-perl (0.32-1) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../237-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../238-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../239-patchutils_0.4.2-1_armhf.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../240-wdiff_1.2.2-7_armhf.deb ... Unpacking wdiff (1.2.2-7) ... Selecting previously unselected package devscripts. Preparing to unpack .../241-devscripts_2.25.1_all.deb ... Unpacking devscripts (2.25.1) ... Selecting previously unselected package fastjar. Preparing to unpack .../242-fastjar_2%3a0.98-7_armhf.deb ... Unpacking fastjar (2:0.98-7) ... Selecting previously unselected package ivy. Preparing to unpack .../243-ivy_2.5.2-1_all.deb ... Unpacking ivy (2.5.2-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../244-libasm-java_9.7.1-1_all.deb ... Unpacking libasm-java (9.7.1-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../245-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../246-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../247-libapache-pom-java_33-2_all.deb ... Unpacking libapache-pom-java (33-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../248-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../249-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../250-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../251-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../252-libqdox-java_1.12.1-4_all.deb ... Unpacking libqdox-java (1.12.1-4) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../253-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../254-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../255-libxstream-java_1.4.21-1_all.deb ... Unpacking libxstream-java (1.4.21-1) ... Selecting previously unselected package groovy. Preparing to unpack .../256-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../257-libatinject-jsr330-api-java_1.0+ds1-6_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-6) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../258-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../259-libcommons-codec-java_1.17.1-1_all.deb ... Unpacking libcommons-codec-java (1.17.1-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../260-libcommons-io-java_2.17.0-1_all.deb ... Unpacking libcommons-io-java (2.17.0-1) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../261-libcommons-compress-java_1.27.1-2_all.deb ... Unpacking libcommons-compress-java (1.27.1-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../262-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../263-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../264-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../265-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../266-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../267-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../268-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../269-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../270-libjna-jni_5.15.0-1_armhf.deb ... Unpacking libjna-jni (5.15.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../271-libjna-java_5.15.0-1_all.deb ... Unpacking libjna-java (5.15.0-1) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../272-libbcprov-java_1.77-1_all.deb ... Unpacking libbcprov-java (1.77-1) ... Selecting previously unselected package libjunixsocket-jni. Preparing to unpack .../273-libjunixsocket-jni_2.6.1-1_armhf.deb ... Unpacking libjunixsocket-jni (2.6.1-1) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../274-libeclipse-jdt-annotation-java_2.2.700+eclipse4.29-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ... Selecting previously unselected package libjunixsocket-java. Preparing to unpack .../275-libjunixsocket-java_2.6.1-1_all.deb ... Unpacking libjunixsocket-java (2.6.1-1) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../276-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package liblightcouch-java. Preparing to unpack .../277-liblightcouch-java_0.2.0-1_all.deb ... Unpacking liblightcouch-java (0.2.0-1) ... Selecting previously unselected package libmongodb-java. Preparing to unpack .../278-libmongodb-java_3.6.3-2_all.deb ... Unpacking libmongodb-java (3.6.3-2) ... Selecting previously unselected package liblog4j2-java. Preparing to unpack .../279-liblog4j2-java_2.19.0-2_all.deb ... Unpacking liblog4j2-java (2.19.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../280-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../281-libjsch-java_0.2.19-1_all.deb ... Unpacking libjsch-java (0.2.19-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../282-libminlog-java_1.3.1-1_all.deb ... Unpacking libminlog-java (1.3.1-1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../283-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../284-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../285-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../286-liblogback-java_1%3a1.2.11-6_all.deb ... Unpacking liblogback-java (1:1.2.11-6) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../287-libnative-platform-jni_0.14-6_armhf.deb ... Unpacking libnative-platform-jni (0.14-6) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../288-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../289-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../290-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../291-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../292-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../293-libxbean-reflect-java_4.5-9_all.deb ... Unpacking libxbean-reflect-java (4.5-9) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../294-libgradle-core-java_4.4.1-21_all.deb ... Unpacking libgradle-core-java (4.4.1-21) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../295-libbcpg-java_1.77-1_all.deb ... Unpacking libbcpg-java (1.77-1) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../296-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../297-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../298-libjaxen-java_1.1.6-5_all.deb ... Unpacking libjaxen-java (1.1.6-5) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../299-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../300-libcommons-lang3-java_3.17.0-1_all.deb ... Unpacking libcommons-lang3-java (3.17.0-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../301-libbcel-java_6.10.0-1_all.deb ... Unpacking libbcel-java (6.10.0-1) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../302-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../303-libfindbugs-java_3.1.0~preview2-4_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-4) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../304-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../305-libguice-java_5.1.0-1_all.deb ... Unpacking libguice-java (5.1.0-1) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../306-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../307-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../308-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../309-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../310-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../311-libjetty9-java_9.4.56-1_all.deb ... Unpacking libjetty9-java (9.4.56-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../312-libjgit-java_6.7.0-2_all.deb ... Unpacking libjgit-java (6.7.0-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../313-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../314-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../315-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-1.6-java. Preparing to unpack .../316-libmaven-resolver-1.6-java_1.6.3-3_all.deb ... Unpacking libmaven-resolver-1.6-java (1.6.3-3) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../317-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../318-libmaven-parent-java_43-2_all.deb ... Unpacking libmaven-parent-java (43-2) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../319-libmaven-shared-utils-java_3.4.2-1_all.deb ... Unpacking libmaven-shared-utils-java (3.4.2-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../320-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../321-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../322-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../323-libplexus-interpolation-java_1.27-1_all.deb ... Unpacking libplexus-interpolation-java (1.27-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../324-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../325-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../326-libcdi-api-java_1.2-4_all.deb ... Unpacking libcdi-api-java (1.2-4) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../327-libsisu-inject-java_0.3.5-1_all.deb ... Unpacking libsisu-inject-java (0.3.5-1) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../328-libsisu-plexus-java_0.3.5-1_all.deb ... Unpacking libsisu-plexus-java (0.3.5-1) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../329-libmaven3-core-java_3.8.8-2_all.deb ... Unpacking libmaven3-core-java (3.8.8-2) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../330-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../331-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../332-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../333-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../334-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../335-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../336-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../337-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../338-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../339-libgradle-plugins-java_4.4.1-21_all.deb ... Unpacking libgradle-plugins-java (4.4.1-21) ... Selecting previously unselected package gradle. Preparing to unpack .../340-gradle_4.4.1-21_all.deb ... Unpacking gradle (4.4.1-21) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../341-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../342-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../343-jarwrapper_0.80_all.deb ... Unpacking jarwrapper (0.80) ... Selecting previously unselected package javahelper. Preparing to unpack .../344-javahelper_0.80_all.deb ... Unpacking javahelper (0.80) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../345-libbyte-buddy-java_1.14.19-1_all.deb ... Unpacking libbyte-buddy-java (1.14.19-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../346-libcommons-math3-java_3.6.1-4_all.deb ... Unpacking libcommons-math3-java (3.6.1-4) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../347-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../348-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../349-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../350-liblz4-jni_1.8.0-4_armhf.deb ... Unpacking liblz4-jni (1.8.0-4) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../351-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../352-libmockito-java_3.3.0-2_all.deb ... Unpacking libmockito-java (3.3.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../353-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../354-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.77-1) ... Setting up media-types (10.1.0) ... Setting up libpipeline1:armhf (1.5.8-1) ... Setting up fastjar (2:0.98-7) ... Setting up libgraphite2-3:armhf (1.3.14-2+b1) ... Setting up liblcms2-2:armhf (2.16-2) ... Setting up libpixman-1-0:armhf (0.44.0-3) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-7) ... Setting up libsharpyuv0:armhf (1.5.0-0.1) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up systemd-sysv (257.2-1) ... Setting up libxau6:armhf (1:1.0.11-1) ... Setting up libxdmcp6:armhf (1:1.1.5-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libnpth0t64:armhf (1.8-2) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libkeyutils1:armhf (1.6.3-4) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libxcb1:armhf (1.17.0-2+b1) ... Setting up libqdox-java (1.12.1-4) ... Setting up libicu72:armhf (72.1-6) ... Setting up libxcb-xfixes0:armhf (1.17.0-2+b1) ... Setting up liblerc4:armhf (4.0.0+ds-5) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.40.4-1) ... Setting up hicolor-icon-theme (0.18-1) ... Setting up libgpg-error0:armhf (1.51-3) ... Setting up java-common (0.76) ... Setting up libdynaloader-functions-perl (0.004-1) ... Setting up libdatrie1:armhf (0.2.13-3+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1+b2) ... Setting up libmagic-mgc (1:5.45-3+b1) ... Setting up libxcb-render0:armhf (1.17.0-2+b1) ... Setting up liblogback-java (1:1.2.11-6) ... Setting up libclone-perl:armhf (0.47-1+b1) ... Setting up libminlog-java (1.3.1-1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglvnd0:armhf (1.7.0-1+b2) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libtirpc-common (1.3.4+ds-1.3) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up libxcb-glx0:armhf (1.17.0-2+b1) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.23) ... Setting up libbrotli1:armhf (1.1.0-2+b6) ... Setting up libedit2:armhf (3.1-20250104-1) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-2) ... Setting up libmagic1t64:armhf (1:5.45-3+b1) ... Setting up libasm-java (9.7.1-1) ... Setting up x11-common (1:7.7+23.2) ... Running in chroot, ignoring request. Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.32-1) ... Setting up libsensors-config (1:3.6.0-10) ... Setting up libdeflate0:armhf (1.23-1+b1) ... Setting up perl-openssl-defaults:armhf (7+b2) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.22.5-4) ... Setting up m4 (1.4.19-5) ... Setting up libel-api-java (3.0.0-3) ... Setting up libgcrypt20:armhf (1.11.0-7) ... Setting up xkb-data (2.42-1) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libxcb-shm0:armhf (1.17.0-2+b1) ... Setting up libcom-err2:armhf (1.47.2-1) ... Setting up file (1:5.45-3+b1) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:armhf (2.1-6.1+b2) ... Setting up libelf1t64:armhf (0.192-4) ... Setting up libkrb5support0:armhf (1.21.3-3) ... Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-8+b1) ... Setting up tzdata (2024b-6) ... Current default time zone: 'Etc/UTC' Local time is now: Sat Jan 25 13:51:18 UTC 2025. Universal Time is now: Sat Jan 25 13:51:18 UTC 2025. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libxcb-present0:armhf (1.17.0-2+b1) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.13-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:armhf (4.13.3-1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libasound2t64:armhf (1.2.13-1+b1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:armhf (1:2.1.5-3+b1) ... Setting up libjaxen-java (1.1.6-5) ... Setting up libx11-data (2:1.8.10-2) ... Setting up libepoxy0:armhf (1.5.10-2) ... Setting up libnspr4:armhf (2:4.36-1) ... Setting up gnupg-l10n (2.2.46-1) ... Setting up libxcb-sync1:armhf (1.17.0-2+b1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (33-2) ... Setting up libavahi-common-data:armhf (0.8-16) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libatinject-jsr330-api-java (1.0+ds1-6) ... Setting up libdbus-1-3:armhf (1.16.0-1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:armhf (1.0.16-1) ... Setting up libproc2-0:armhf (2:4.0.4-6) ... Setting up libplexus-interpolation-java (1.27-1) ... Setting up libunistring5:armhf (1.3-1) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16t64:armhf (1.6.44-3) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up autopoint (0.22.5-4) ... Setting up binfmt-support (2.2.2-7) ... Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Created symlink '/etc/systemd/system/multi-user.target.wants/binfmt-support.service' -> '/usr/lib/systemd/system/binfmt-support.service'. Setting up libb-hooks-op-check-perl:armhf (0.22-3+b2) ... Setting up libjunixsocket-jni (2.6.1-1) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up libpcsclite1:armhf (2.3.1-1) ... Setting up libsensors5:armhf (1:3.6.0-10+b1) ... Setting up libmongodb-java (3.6.3-2) ... Setting up libk5crypto3:armhf (1.21.3-3) ... Setting up libhamcrest-java (2.2-2) ... Setting up libglapi-mesa:armhf (24.2.8-1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:armhf (2.1.28+dfsg1-8+b1) ... Setting up libvulkan1:armhf (1.4.304.0-1) ... Setting up autoconf (2.72-3) ... Setting up libwebp7:armhf (1.5.0-0.1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libxcb-dri2-0:armhf (1.17.0-2+b1) ... Setting up libgif7:armhf (5.2.2-1+b1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libffi8:armhf (3.4.6-1) ... Setting up libtrove3-java (3.0.3-5) ... Setting up dwz (0.15-1+b2) ... Setting up sensible-utils (0.0.24) ... Setting up libxshmfence1:armhf (1.3-1+b3) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.55.0.1-1) ... Setting up gpgv (2.2.46-1+b1) ... Setting up libtiff6:armhf (4.5.1+git230720-5) ... Setting up libxcb-randr0:armhf (1.17.0-2+b1) ... Setting up dbus-session-bus-common (1.16.0-1) ... Setting up libuchardet0:armhf (0.0.8-1+b2) ... Setting up libassuan9:armhf (3.0.1-2) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up procps (2:4.0.4-6) ... Setting up libxbean-reflect-java (4.5-9) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libtasn1-6:armhf (4.19.0-3+b3) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libx11-6:armhf (2:1.8.10-2) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-4) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6) ... Setting up libclass-xsaccessor-perl (1.19-4+b4) ... Setting up libkrb5-3:armhf (1.21.3-3) ... Setting up liblz4-jni (1.8.0-4) ... Setting up libwayland-egl1:armhf (1.23.0-1+b2) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.77-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up dbus-system-bus-common (1.16.0-1) ... useradd: Warning: missing or non-executable shell '/usr/sbin/nologin' Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-14) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.4.0-2) ... Setting up libdrm-common (2.4.123-1) ... Setting up libcdi-api-java (1.2-4) ... Setting up libxcomposite1:armhf (1:0.4.6-1) ... Setting up readline-common (8.2-6) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:armhf (2.12.7+dfsg+really2.9.14-0.2+b1) ... Setting up libldap2:armhf (2.6.9+dfsg-1) ... Setting up liburi-perl (5.30-1) ... Setting up dbus-bin (1.16.0-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libxkbcommon0:armhf (1.7.0-2) ... Setting up libwayland-client0:armhf (1.23.0-1+b2) ... Setting up libnet-ssleay-perl:armhf (1.94-2) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up libksba8:armhf (1.6.7-2+b1) ... Setting up pinentry-curses (1.3.1-2) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libfile-stripnondeterminism-perl (1.14.0-1) ... Setting up libxcb-dri3-0:armhf (1.17.0-2+b1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libllvm19:armhf (1:19.1.6-1+b1) ... Setting up libwayland-server0:armhf (1.23.0-1+b2) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libx11-xcb1:armhf (2:1.8.10-2) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.21-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up liblz4-java (1.8.0-4) ... Setting up gettext (0.22.5-4) ... Setting up libjetty9-java (9.4.56-1) ... Setting up libxdamage1:armhf (1:1.1.6-1+b2) ... Setting up java-wrappers (0.5) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libxrender1:armhf (1:0.9.10-1.1+b4) ... Setting up jarwrapper (0.80) ... Setting up libtool (2.5.4-2) ... Setting up fontconfig-config (2.15.0-2) ... Setting up libmaven-parent-java (43-2) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:armhf (0.8-16) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libxext6:armhf (2:1.3.4-1+b3) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.5-1) ... Setting up libidn2-0:armhf (2.3.7-2+b1) ... Setting up libnss3:armhf (2:3.107-1) ... Setting up dbus-daemon (1.16.0-1) ... Setting up libdevel-callchecker-perl:armhf (0.009-1+b1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libjunixsocket-java (2.6.1-1) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up libxxf86vm1:armhf (1:1.1.4-1+b4) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:armhf (0.1.29-2+b1) ... Setting up ca-certificates (20241223) ... Updating certificates in /etc/ssl/certs... 152 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.5-1) ... Setting up libglib2.0-0t64:armhf (2.82.4-2) ... Setting up libfreetype6:armhf (2.13.3+dfsg-1) ... Setting up libxfixes3:armhf (1:6.0.0-2+b4) ... Setting up testng (6.9.12-4) ... Setting up dbus (1.16.0-1) ... Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Setting up shared-mime-info (2.4-5+b2) ... Setting up libp11-kit0:armhf (0.25.5-3) ... Setting up libxinerama1:armhf (2:1.1.4-3+b3) ... Setting up libgssapi-krb5-2:armhf (1.21.3-3) ... Setting up libxrandr2:armhf (2:1.5.4-1+b3) ... Setting up libjna-jni (5.15.0-1) ... Setting up libcommons-lang3-java (3.17.0-1) ... Setting up libreadline8t64:armhf (8.2-6) ... Setting up dh-strip-nondeterminism (1.14.0-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:armhf (2.4.123-1) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-7) ... Setting up libwayland-cursor0:armhf (1.23.0-1+b2) ... Setting up libhtml-parser-perl:armhf (3.83-1+b2) ... Setting up libjna-java (5.15.0-1) ... Setting up gpgconf (2.2.46-1+b1) ... Setting up libpam-systemd:armhf (257.2-1) ... Setting up libjansi1-java (1.18-3.1) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libharfbuzz0b:armhf (10.2.0-1) ... Setting up libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-2) ... Setting up libfontconfig1:armhf (2.15.0-2) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.17.1-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libavahi-client3:armhf (0.8-16) ... Setting up libio-socket-ssl-perl (2.089-1) ... Setting up gpg (2.2.46-1+b1) ... Setting up libhttp-message-perl (7.00-2) ... Setting up libdrm-amdgpu1:armhf (2.4.123-1) ... Setting up libgnutls30t64:armhf (3.8.8-2) ... Setting up gtk-update-icon-cache (4.16.12+ds-1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.15.0-2) ... Regenerating fonts cache... done. Setting up gpg-agent (2.2.46-1+b1) ... Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-browser.socket' -> '/usr/lib/systemd/user/gpg-agent-browser.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-extra.socket' -> '/usr/lib/systemd/user/gpg-agent-extra.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-ssh.socket' -> '/usr/lib/systemd/user/gpg-agent-ssh.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent.socket' -> '/usr/lib/systemd/user/gpg-agent.socket'. Setting up libatk1.0-0t64:armhf (2.55.0.1-1) ... Setting up openjdk-21-jre-headless:armhf (21.0.5+11-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up libxi6:armhf (2:1.8.2-1) ... Setting up libtirpc3t64:armhf (1.3.4+ds-1.3+b1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libcommons-io-java (2.17.0-1) ... Setting up libdrm-radeon1:armhf (2.4.123-1) ... Setting up libxtst6:armhf (2:1.2.3-1.1+b3) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libxcursor1:armhf (1:1.2.3-1) ... Setting up libparams-classify-perl:armhf (0.015-2+b4) ... Setting up gpgsm (2.2.46-1+b1) ... Setting up libpango-1.0-0:armhf (1.56.1-1) ... Setting up libcloudproviders0:armhf (0.3.6-1+b1) ... Setting up man-db (2.13.0-1) ... Not building database; man-db/auto-update is not 'true'. Created symlink '/etc/systemd/system/timers.target.wants/man-db.timer' -> '/usr/lib/systemd/system/man-db.timer'. Setting up libcairo2:armhf (1.18.2-2) ... Setting up libcolord2:armhf (1.4.7-1+b2) ... Setting up libmaven-resolver-1.6-java (1.6.3-3) ... Setting up libdconf1:armhf (0.40.0-5) ... Setting up dirmngr (2.2.46-1+b1) ... Created symlink '/etc/systemd/user/sockets.target.wants/dirmngr.socket' -> '/usr/lib/systemd/user/dirmngr.socket'. Setting up dbus-user-session (1.16.0-1) ... Setting up libbcel-java (6.10.0-1) ... Setting up adwaita-icon-theme (47.0-2) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libatspi2.0-0t64:armhf (2.55.0.1-1) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libnsl2:armhf (1.3.0-3+b3) ... Setting up gnupg (2.2.46-1) ... Setting up liblightcouch-java (0.2.0-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libcairo-gobject2:armhf (1.18.2-2) ... Setting up libmaven-shared-utils-java (3.4.2-1) ... Setting up libpangoft2-1.0-0:armhf (1.56.1-1) ... Setting up libcups2t64:armhf (2.4.10-2+b1) ... Setting up libpangocairo-1.0-0:armhf (1.56.1-1) ... Setting up libatk-bridge2.0-0t64:armhf (2.55.0.1-1) ... Setting up mesa-libgallium:armhf (24.2.8-1) ... Setting up libfindbugs-java (3.1.0~preview2-4) ... Setting up libpython3.12-stdlib:armhf (3.12.8-5) ... Setting up libcommons-compress-java (1.27.1-2) ... Setting up libgbm1:armhf (24.2.8-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libmoo-perl (2.005005-1) ... Setting up liblog4j2-java (2.19.0-2) ... Setting up python3.12 (3.12.8-5) ... Setting up libgl1-mesa-dri:armhf (24.2.8-1) ... Setting up debhelper (13.23) ... Setting up dconf-service (0.40.0-5) ... Setting up libjsch-java (0.2.19-1) ... Setting up libpython3-stdlib:armhf (3.12.8-1) ... Setting up libjgit-java (6.7.0-2) ... Setting up libglx-mesa0:armhf (24.2.8-1) ... Setting up libglx0:armhf (1.7.0-1+b2) ... Setting up dconf-gsettings-backend:armhf (0.40.0-5) ... Setting up python3 (3.12.8-1) ... Setting up sopv-gpgv (0.1.1-1) ... update-alternatives: using /usr/bin/sopv-gpgv to provide /usr/bin/sopv (sopv) in auto mode Setting up libgl1:armhf (1.7.0-1+b2) ... Setting up libgtk-3-common (3.24.43-5) ... Setting up libgtk-3-0t64:armhf (3.24.43-5) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.77-1) ... Setting up devscripts (2.25.1) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.80) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up libguice-java (5.1.0-1) ... Setting up libmaven3-core-java (3.8.8-2) ... Setting up libbyte-buddy-java (1.14.19-1) ... Setting up libmockito-java (3.3.0-2) ... Processing triggers for libc-bin (2.40-5) ... Processing triggers for systemd (257.2-1) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:FIRMAPROFESIONAL_CA_ROOT-A_WEB.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureSign_Root_CA12.pem Adding debian:SecureSign_Root_CA14.pem Adding debian:SecureSign_Root_CA15.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_CYBER_Root_CA.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:Telekom_Security_TLS_ECC_Root_2020.pem Adding debian:Telekom_Security_TLS_RSA_Root_2023.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up antlr (2.7.7+dfsg-14) ... Setting up openjdk-21-jre:armhf (21.0.5+11-1) ... Setting up ivy (2.5.2-1) ... Setting up ant (1.10.15-1) ... Setting up junit4 (4.13.2-5) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up openjdk-21-jdk-headless:armhf (21.0.5+11-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up default-jre-headless (2:1.21-76) ... Setting up maven-repo-helper (1.11) ... Setting up default-jre (2:1.21-76) ... Setting up ant-optional (1.10.15-1) ... Setting up openjdk-21-jdk:armhf (21.0.5+11-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.21-76) ... Setting up libgradle-core-java (4.4.1-21) ... Setting up libgradle-plugins-java (4.4.1-21) ... Setting up gradle (4.4.1-21) ... Setting up default-jdk (2:1.21-76) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20241223) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean Duplicate specification "unlink|u" for option "u" dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 jar openjdk version "21.0.5" 2024-10-15 OpenJDK Runtime Environment (build 21.0.5+11-Debian-1) OpenJDK Server VM (build 21.0.5+11-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 7.739 secs. The client will now receive all logging from the daemon (pid: 1676). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-1676.out.log Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Daemon will be stopped at the end of the build stopping after processing Using 3 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c20a53 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c20a53 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@13867de Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@9cc5aa Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@e127f3 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@13867de Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@18c7fb7 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1921885 :compileJava (Thread[#41,Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.136 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@ba0b5c Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through commons-codec:commons-codec:jar:debian Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1144) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:642) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:1583) Up-to-date check for task ':compileJava' took 28.555 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. warning: [options] source value 8 is obsolete and will be removed in a future release warning: [options] target value 8 is obsolete and will be removed in a future release warning: [options] To suppress warnings about obsolete options, use -Xlint:-options. /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1279: warning: [removal] finalize() in Object has been deprecated and marked for removal protected void finalize() throws Throwable { ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1280: warning: [removal] finalize() in Object has been deprecated and marked for removal super.finalize(); ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:108: warning: [removal] finalize() in Object has been deprecated and marked for removal protected void finalize() throws Throwable { ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:116: warning: [removal] finalize() in Object has been deprecated and marked for removal super.finalize(); ^ Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. 7 warnings :compileJava (Thread[#41,Task worker for ':',5,main]) completed. Took 1 mins 25.396 secs. :processResources (Thread[#41,Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.077 secs. It is not up-to-date because: No history is available. :processResources (Thread[#41,Task worker for ':',5,main]) completed. Took 0.286 secs. :classes (Thread[#42,Task worker for ':' Thread 2,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[#42,Task worker for ':' Thread 2,5,main]) completed. Took 0.008 secs. :debianMavenPom (Thread[#42,Task worker for ':' Thread 2,5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.004 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[#42,Task worker for ':' Thread 2,5,main]) completed. Took 0.654 secs. :jar (Thread[#42,Task worker for ':' Thread 2,5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.294 secs. It is not up-to-date because: No history is available. :jar (Thread[#42,Task worker for ':' Thread 2,5,main]) completed. Took 1.754 secs. BUILD SUCCESSFUL in 2m 10s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 test openjdk version "21.0.5" 2024-10-15 OpenJDK Runtime Environment (build 21.0.5+11-Debian-1) OpenJDK Server VM (build 21.0.5+11-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 6.859 secs. The client will now receive all logging from the daemon (pid: 2035). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-2035.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 3 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c20a53 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c20a53 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@135e009 Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@1220d91 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@c1052 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@135e009 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@45a473 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@116051c :compileJava (Thread[#41,Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.024 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@7a6a0f Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through commons-codec:commons-codec:jar:debian Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 6.304 secs). :compileJava UP-TO-DATE :compileJava (Thread[#41,Task worker for ':',5,main]) completed. Took 6.511 secs. :processResources (Thread[#41,Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.056 secs). :processResources UP-TO-DATE :processResources (Thread[#41,Task worker for ':',5,main]) completed. Took 0.08 secs. :classes (Thread[#41,Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[#41,Task worker for ':',5,main]) completed. Took 0.017 secs. :compileTestJava (Thread[#42,Task worker for ':' Thread 2,5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 21.143 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. warning: [options] source value 8 is obsolete and will be removed in a future release warning: [options] target value 8 is obsolete and will be removed in a future release warning: [options] To suppress warnings about obsolete options, use -Xlint:-options. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. 3 warnings :compileTestJava (Thread[#42,Task worker for ':' Thread 2,5,main]) completed. Took 1 mins 4.979 secs. :processTestResources (Thread[#42,Task worker for ':' Thread 2,5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.117 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[#42,Task worker for ':' Thread 2,5,main]) completed. Took 0.239 secs. :testClasses (Thread[#42,Task worker for ':' Thread 2,5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[#42,Task worker for ':' Thread 2,5,main]) completed. Took 0.011 secs. :test (Thread[#42,Task worker for ':' Thread 2,5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 4.732 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-21-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath14488975695661553882txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT Pending / IO / Serde: 0 / 1 / 3 ================== High compression: false Concurrency: 4 File size: 6799510 Write time: 2.48s O. Stats: Wall clock time: 2.52s Total CPU time: 4.21s User wait time: 1.67s Serialization time: 2.26s (53.73%) Checksum calculation time: 1.53s (36.22%) Compression time: 375.72ms (8.91%) Total IO delay: 283.73ms Concurrency overhead: 291.75ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 22.91MiB/s Concurrency adjusted uncompressed speed: 13.02MiB/s Actual uncompressed speed: 7.32MiB/s Actual speed: 2.58MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 1.98s Total CPU time: 3.39s Serialization time: 2.95s (86.85%) Checksum calculation time: 240.41ms (7.09%) Compression time: 187.99ms (5.54%) Total IO delay: 248.81ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 26.15MiB/s Concurrency adjusted uncompressed speed: 20.26MiB/s Actual uncompressed speed: 9.34MiB/s Actual speed: 3.28MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 2.93s Total CPU time: 4.2s Serialization time: 3.47s (82.6%) Checksum calculation time: 353.97ms (8.42%) Compression time: 347.98ms (8.28%) Total IO delay: 523.19ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 24.8MiB/s Concurrency adjusted uncompressed speed: 31.22MiB/s Actual uncompressed speed: 12.58MiB/s Actual speed: 4.42MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 ================== High compression: false Concurrency: 4 File size: 6791878 Write time: 1.02s O. Stats: Wall clock time: 1.02s Total CPU time: 1.3s User wait time: 871.32ms Serialization time: 965.63ms (74.19%) Checksum calculation time: 92.31ms (7.09%) Compression time: 222.51ms (17.1%) Total IO delay: 165.15ms Concurrency overhead: 62.1ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 39.26MiB/s Concurrency adjusted uncompressed speed: 43.08MiB/s Actual uncompressed speed: 18.04MiB/s Actual speed: 6.34MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 905.07ms Total CPU time: 1.03s Serialization time: 457.16ms (44.55%) Checksum calculation time: 147.71ms (14.39%) Compression time: 417.42ms (40.68%) Total IO delay: 144.06ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 44.98MiB/s Concurrency adjusted uncompressed speed: 63.14MiB/s Actual uncompressed speed: 20.37MiB/s Actual speed: 7.16MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 1.97s Total CPU time: 2.12s Serialization time: 959.28ms (45.27%) Checksum calculation time: 316.01ms (14.91%) Compression time: 837.34ms (39.52%) Total IO delay: 282.15ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 45.94MiB/s Concurrency adjusted uncompressed speed: 61.46MiB/s Actual uncompressed speed: 18.73MiB/s Actual speed: 6.58MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6799510 Write time: 1.2s O. Stats: Wall clock time: 1.2s Total CPU time: 635.88ms User wait time: 873.67ms Serialization time: 305.2ms (48%) Checksum calculation time: 61.97ms (9.75%) Compression time: 220.93ms (34.74%) Total IO delay: 128.92ms Concurrency overhead: 63.64ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 50.66MiB/s Concurrency adjusted uncompressed speed: 22.27MiB/s Actual uncompressed speed: 15.38MiB/s Actual speed: 5.41MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 1 / 0 / 0 I. Stats 1: Wall clock time: 720.47ms Total CPU time: 970.46ms Serialization time: 485.2ms (50%) Checksum calculation time: 153.21ms (15.79%) Compression time: 319.82ms (32.96%) Total IO delay: 178.68ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 36.43MiB/s Concurrency adjusted uncompressed speed: 16.05MiB/s Actual uncompressed speed: 25.61MiB/s Actual speed: 9.01MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.66s Total CPU time: 2.07s Serialization time: 1.04s (50.08%) Checksum calculation time: 356.7ms (17.2%) Compression time: 645.73ms (31.14%) Total IO delay: 464.05ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 27.95MiB/s Concurrency adjusted uncompressed speed: 14.53MiB/s Actual uncompressed speed: 22.24MiB/s Actual speed: 7.82MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 Write time: 1.37s O. Stats: Wall clock time: 1.39s Total CPU time: 869.49ms User wait time: 1.13s Serialization time: 490.33ms (56.39%) Checksum calculation time: 91.13ms (10.48%) Compression time: 252.68ms (29.06%) Total IO delay: 175.41ms Concurrency overhead: 37.32ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 37.01MiB/s Concurrency adjusted uncompressed speed: 17.04MiB/s Actual uncompressed speed: 13.24MiB/s Actual speed: 4.65MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 0 / 1 / 0 I. Stats 1: Wall clock time: 699.83ms Total CPU time: 901.99ms Serialization time: 386.8ms (42.88%) Checksum calculation time: 131.98ms (14.63%) Compression time: 380.12ms (42.14%) Total IO delay: 103.39ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 62.89MiB/s Concurrency adjusted uncompressed speed: 18.35MiB/s Actual uncompressed speed: 26.38MiB/s Actual speed: 9.27MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.65s Total CPU time: 1.97s Serialization time: 872.55ms (44.29%) Checksum calculation time: 323.48ms (16.42%) Compression time: 768.31ms (39%) Total IO delay: 209ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 61.98MiB/s Concurrency adjusted uncompressed speed: 16.92MiB/s Actual uncompressed speed: 22.29MiB/s Actual speed: 7.83MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 1 / 1 / 2 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 11.41s O. Stats: Wall clock time: 11.43s Total CPU time: 30.65s User wait time: 10.79s Serialization time: 288.2ms (0.94%) Checksum calculation time: 77.3ms (0.25%) Compression time: 30.24s (98.66%) Total IO delay: 209.46ms Concurrency overhead: 168.49ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 18.97MiB/s Concurrency adjusted uncompressed speed: 2.34MiB/s Actual uncompressed speed: 1.61MiB/s Actual speed: 355.23KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 495.04ms Total CPU time: 523.9ms Serialization time: 357.95ms (68.32%) Checksum calculation time: 55.49ms (10.59%) Compression time: 100.21ms (19.13%) Total IO delay: 317.24ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 12.5MiB/s Concurrency adjusted uncompressed speed: 87.79MiB/s Actual uncompressed speed: 37.25MiB/s Actual speed: 8.01MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 954.29ms Total CPU time: 998.61ms Serialization time: 608.2ms (60.9%) Checksum calculation time: 159.74ms (16%) Compression time: 210.91ms (21.12%) Total IO delay: 529.75ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 14.99MiB/s Concurrency adjusted uncompressed speed: 96.53MiB/s Actual uncompressed speed: 38.65MiB/s Actual speed: 8.31MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 1 / 0 Pending / IO / Serde: 3 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 15.29s O. Stats: Wall clock time: 15.29s Total CPU time: 26.45s User wait time: 14.1s Serialization time: 196.92ms (0.74%) Checksum calculation time: 84.84ms (0.32%) Compression time: 26.15s (98.86%) Total IO delay: 109.98ms Concurrency overhead: 28.27ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 35.86MiB/s Concurrency adjusted uncompressed speed: 2.76MiB/s Actual uncompressed speed: 1.21MiB/s Actual speed: 261.75KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 324.29ms Total CPU time: 368.67ms Serialization time: 124.89ms (33.87%) Checksum calculation time: 79.93ms (21.68%) Compression time: 162.37ms (44.04%) Total IO delay: 62.22ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 63.05MiB/s Concurrency adjusted uncompressed speed: 172.31MiB/s Actual uncompressed speed: 56.9MiB/s Actual speed: 12.06MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 696.79ms Total CPU time: 713.86ms Serialization time: 257.42ms (36.06%) Checksum calculation time: 139.49ms (19.54%) Compression time: 314.22ms (44.02%) Total IO delay: 131ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 59.68MiB/s Concurrency adjusted uncompressed speed: 174.76MiB/s Actual uncompressed speed: 52.98MiB/s Actual speed: 11.23MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 18.95s O. Stats: Wall clock time: 18.95s Total CPU time: 18.79s User wait time: 18.87s Serialization time: 124.45ms (0.66%) Checksum calculation time: 55.6ms (0.3%) Compression time: 18.6s (99%) Total IO delay: 65.19ms Concurrency overhead: 14.33ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 60.98MiB/s Concurrency adjusted uncompressed speed: 1000.76KiB/s Actual uncompressed speed: 996.12KiB/s Actual speed: 214.16KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 388.54ms Total CPU time: 432.23ms Serialization time: 202.24ms (46.79%) Checksum calculation time: 99.24ms (22.96%) Compression time: 123.53ms (28.58%) Total IO delay: 172.07ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 23.05MiB/s Concurrency adjusted uncompressed speed: 30.52MiB/s Actual uncompressed speed: 47.52MiB/s Actual speed: 10.22MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 841.86ms Total CPU time: 844.46ms Serialization time: 387.62ms (45.9%) Checksum calculation time: 217.6ms (25.77%) Compression time: 222.66ms (26.37%) Total IO delay: 393.19ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 20.17MiB/s Concurrency adjusted uncompressed speed: 29.81MiB/s Actual uncompressed speed: 43.85MiB/s Actual speed: 9.43MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 0 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 19.92s O. Stats: Wall clock time: 19.92s Total CPU time: 19.82s User wait time: 19.86s Serialization time: 121.61ms (0.61%) Checksum calculation time: 50.06ms (0.25%) Compression time: 19.64s (99.09%) Total IO delay: 39.54ms Concurrency overhead: 2.97ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 100.23MiB/s Concurrency adjusted uncompressed speed: 950.62KiB/s Actual uncompressed speed: 947.67KiB/s Actual speed: 200.91KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 215.66ms Total CPU time: 244.58ms Serialization time: 68.91ms (28.18%) Checksum calculation time: 70.09ms (28.66%) Compression time: 104.52ms (42.73%) Total IO delay: 37.14ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 105.64MiB/s Concurrency adjusted uncompressed speed: 65.61MiB/s Actual uncompressed speed: 85.75MiB/s Actual speed: 18.18MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 521.94ms Total CPU time: 553.26ms Serialization time: 173.71ms (31.4%) Checksum calculation time: 127.91ms (23.12%) Compression time: 247.72ms (44.77%) Total IO delay: 82.92ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 95.34MiB/s Concurrency adjusted uncompressed speed: 57.98MiB/s Actual uncompressed speed: 70.78MiB/s Actual speed: 15MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 Pending / IO / Serde / Objs: 0 / 1 / 2 / 1000 Pending / IO / Serde / Objs: 1 / 1 / 1 / 3000 Pending / IO / Serde / Objs: 3 / 1 / 1 / 5000 Pending / IO / Serde / Objs: 5 / 1 / 1 / 7000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 9000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 10000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 10000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 10000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 12000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 12000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 13000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 13000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 14000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 14000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 15000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 15000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 16000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 16000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 17000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 18000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 18000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 18000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 19000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 19000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 4 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 3 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 3 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 2 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 2 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 O. Stats: Wall clock time: 1.34m Total CPU time: 23.11s User wait time: 31.35s Serialization time: 4.47s (19.34%) Checksum calculation time: 7.05s (30.52%) Compression time: 8.24s (35.66%) Total IO delay: 1.3m Concurrency overhead: 28.22ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 24.39MiB/s Concurrency adjusted uncompressed speed: 150.29MiB/s Actual uncompressed speed: 23.73MiB/s Actual speed: 23.73MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 576ns Addition to hash set (per operation): 1.68us Hash set removal (per operation): 770ns b com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_0efcc8eda0cdd94325b5bfbbfdbb156238dda73d4843383203121738644 timeInCollate: 22.74s timeInCollatorInit: 16.51s timeAwaitingO: 7.75ms timeAwaitingI: 3.71s timeInFinalSorting1: 0ns timeInFinalSorting2: 52.59ms timeInFinalSorting3: 181.92ms /19S (5|27|32): objs=50000 size=3.25MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_4c3dbe98b0fc4241246b22f7b0c91b925800b0b414890799390227759208 timeInCollate: 1.02m timeInCollatorInit: 5.97s timeAwaitingO: 3.55s timeAwaitingI: 13.05s timeInFinalSorting1: 9.03s timeInFinalSorting2: 7.48s timeInFinalSorting3: 2.03s /0N (5|27|32): objs=157160 size=8.95MiB /1N (5|27|32): objs=155543 size=8.66MiB /2N (5|27|32): objs=156304 size=9.19MiB /3N (5|27|32): objs=149654 size=7.96MiB /4N (5|27|32): objs=154484 size=8.54MiB /5N (5|27|32): objs=161593 size=9.26MiB /6N (5|27|32): objs=153761 size=8.43MiB /7N (5|27|32): objs=158784 size=8.96MiB /8N (5|27|32): objs=156361 size=8.87MiB /9N (5|27|32): objs=152513 size=8.69MiB /10N (5|27|32): objs=153672 size=8.6MiB /11N (5|27|32): objs=155812 size=8.8MiB /12N (5|27|32): objs=157915 size=8.87MiB /13N (5|27|32): objs=145834 size=8.14MiB /14N (5|27|32): objs=158318 size=8.81MiB /15N (5|27|32): objs=156340 size=8.91MiB /16N (5|27|32): objs=158930 size=8.99MiB /17N (5|27|32): objs=160653 size=9.04MiB /18N (5|27|32): objs=167845 size=9.54MiB /19N (5|27|32): objs=159839 size=8.83MiB /20N (5|27|32): objs=160059 size=9.01MiB /21N (5|27|32): objs=149483 size=8.27MiB /22N (5|27|32): objs=160793 size=8.97MiB /23N (5|27|32): objs=158932 size=8.93MiB /24N (5|27|32): objs=150245 size=8.42MiB /25N (5|27|32): objs=159334 size=9.06MiB /26N (5|27|32): objs=162340 size=9.19MiB /27N (5|27|32): objs=152509 size=8.62MiB /28N (5|27|32): objs=150852 size=8.31MiB /29N (5|27|32): objs=147542 size=8.12MiB /30N (5|27|32): objs=155889 size=8.86MiB /31N (5|27|32): objs=160707 size=9.22MiB /0/0N (2|25|36): objs=36124 size=762.94KiB /0/1S (2|25|36): objs=167 size=317B /0/2N (2|25|36): objs=3612 size=16.2KiB /0/3N (2|25|36): objs=41449 size=1018.05KiB /0/4N (2|25|36): objs=34555 size=667.53KiB /0/5N (2|25|36): objs=19580 size=159.46KiB /0/6S (2|25|36): objs=157 size=232B /0/7N (2|25|36): objs=2260 size=9.41KiB /0/8S (2|25|36): objs=165 size=133B /0/9N (2|25|36): objs=1141 size=4.51KiB /0/10S (2|25|36): objs=150 size=157B /0/11N (2|25|36): objs=2020 size=8.29KiB /0/12S (2|25|36): objs=159 size=121B /0/13N (2|25|36): objs=325 size=977B /0/14S (2|25|36): objs=170 size=149B /0/15N (2|25|36): objs=610 size=2.16KiB /0/16S (2|25|36): objs=155 size=114B /0/17N (2|25|36): objs=1411 size=5.73KiB /0/18S (2|25|36): objs=135 size=113B /0/19N (2|25|36): objs=603 size=2.1KiB /0/20S (2|25|36): objs=156 size=121B /0/21N (2|25|36): objs=1271 size=5.15KiB /0/22S (2|25|36): objs=150 size=198B /0/23N (2|25|36): objs=2441 size=10.06KiB /0/24S (2|25|36): objs=149 size=273B /0/25N (2|25|36): objs=3624 size=15.78KiB /0/26S (2|25|36): objs=154 size=320B /0/27S (2|25|36): objs=163 size=218B /0/28S (2|25|36): objs=159 size=106B /0/29N (2|25|36): objs=619 size=2.24KiB /0/30S (2|25|36): objs=152 size=227B /0/31N (2|25|36): objs=1813 size=7.47KiB /0/32S (2|25|36): objs=164 size=230B /0/33N (2|25|36): objs=1037 size=4.09KiB /0/34S (2|25|36): objs=160 size=94B /1/0N (2|25|36): objs=39498 size=840.1KiB /1/1N (2|25|36): objs=12882 size=77.5KiB /1/2S (2|25|36): objs=167 size=269B /1/3N (2|25|36): objs=23976 size=261.75KiB /1/4N (2|25|36): objs=33165 size=705.82KiB /1/5S (2|25|36): objs=146 size=145B /1/6N (2|25|36): objs=456 size=1.68KiB /1/7S (2|25|36): objs=154 size=90B /1/8N (2|25|36): objs=1404 size=5.84KiB /1/9S (2|25|36): objs=162 size=347B /1/10N (2|25|36): objs=3805 size=16.23KiB /1/11S (2|25|36): objs=140 size=86B /1/12N (2|25|36): objs=1872 size=7.79KiB /1/13N (2|25|36): objs=6812 size=31.83KiB /1/14S (2|25|36): objs=155 size=179B /1/15N (2|25|36): objs=2828 size=12.75KiB /1/16S (2|25|36): objs=149 size=191B /1/17N (2|25|36): objs=1359 size=5.51KiB /1/18S (2|25|36): objs=145 size=162B /1/19S (2|25|36): objs=166 size=99B /1/20S (2|25|36): objs=177 size=106B /1/21N (2|25|36): objs=2230 size=9.33KiB /1/22S (2|25|36): objs=168 size=312B /1/23N (2|25|36): objs=2464 size=10.14KiB /1/24S (2|25|36): objs=160 size=275B /1/25N (2|25|36): objs=5477 size=26.15KiB /1/26S (2|25|36): objs=128 size=316B /1/27N (2|25|36): objs=3504 size=14.98KiB /1/28S (2|25|36): objs=130 size=292B /1/29N (2|25|36): objs=3922 size=17.61KiB /1/30S (2|25|36): objs=161 size=264B /1/32S (2|25|36): objs=164 size=285B /1/33N (2|25|36): objs=271 size=821B /1/34S (2|25|36): objs=151 size=87B /1/35N (2|25|36): objs=6995 size=35.2KiB /2/0N (2|25|36): objs=36922 size=775.3KiB /2/1N (2|25|36): objs=43141 size=1.09MiB /2/2N (2|25|36): objs=35566 size=715.07KiB /2/3N (2|25|36): objs=1171 size=4.9KiB /2/4S (2|25|36): objs=160 size=327B /2/5N (2|25|36): objs=1664 size=7.1KiB /2/6S (2|25|36): objs=146 size=261B /2/7N (2|25|36): objs=2247 size=10.3KiB /2/8S (2|25|36): objs=134 size=303B /2/9N (2|25|36): objs=7075 size=37.81KiB /2/10S (2|25|36): objs=161 size=162B /2/11N (2|25|36): objs=2702 size=11.78KiB /2/12S (2|25|36): objs=144 size=330B /2/13N (2|25|36): objs=1291 size=5.32KiB /2/14S (2|25|36): objs=149 size=103B /2/15N (2|25|36): objs=1723 size=7.14KiB /2/16S (2|25|36): objs=141 size=255B /2/17N (2|25|36): objs=768 size=2.97KiB /2/18S (2|25|36): objs=150 size=240B /2/19N (2|25|36): objs=1063 size=4.35KiB /2/20S (2|25|36): objs=140 size=286B /2/21N (2|25|36): objs=3468 size=15.15KiB /2/22S (2|25|36): objs=155 size=329B /2/23S (2|25|36): objs=155 size=266B /2/24S (2|25|36): objs=151 size=318B /2/25N (2|25|36): objs=902 size=3.41KiB /2/26S (2|25|36): objs=143 size=325B /2/27N (2|25|36): objs=1928 size=7.91KiB /2/28S (2|25|36): objs=176 size=322B /2/29N (2|25|36): objs=470 size=1.43KiB /2/30S (2|25|36): objs=168 size=316B /2/31N (2|25|36): objs=4411 size=20.45KiB /2/32S (2|25|36): objs=170 size=195B /2/33N (2|25|36): objs=4886 size=24.28KiB /2/34S (2|25|36): objs=149 size=262B /2/35N (2|25|36): objs=2314 size=9.81KiB /3/0N (2|25|36): objs=39142 size=860.78KiB /3/1N (2|25|36): objs=35997 size=554.36KiB /3/2N (2|25|36): objs=37110 size=656.86KiB /3/3N (2|25|36): objs=3416 size=14.18KiB /3/4S (2|25|36): objs=137 size=282B /3/5N (2|25|36): objs=2790 size=12.48KiB /3/6S (2|25|36): objs=136 size=139B /3/7N (2|25|36): objs=295 size=838B /3/8S (2|25|36): objs=168 size=228B /3/9S (2|25|36): objs=157 size=112B /3/10S (2|25|36): objs=149 size=318B /3/12S (2|25|36): objs=147 size=204B /3/13N (2|25|36): objs=1985 size=8.48KiB /3/14S (2|25|36): objs=162 size=317B /3/15N (2|25|36): objs=2875 size=12.94KiB /3/16S (2|25|36): objs=163 size=272B /3/17N (2|25|36): objs=10062 size=51.94KiB /3/18S (2|25|36): objs=149 size=148B /3/19N (2|25|36): objs=609 size=2.32KiB /3/20S (2|25|36): objs=150 size=150B /3/21N (2|25|36): objs=604 size=2.1KiB /3/22S (2|25|36): objs=182 size=89B /3/23S (2|25|36): objs=148 size=306B /3/24S (2|25|36): objs=155 size=199B /3/25N (2|25|36): objs=1039 size=4.06KiB /3/26S (2|25|36): objs=176 size=301B /3/27N (2|25|36): objs=2877 size=13.19KiB /3/28S (2|25|36): objs=183 size=100B /3/29N (2|25|36): objs=2305 size=10.56KiB /3/30S (2|25|36): objs=161 size=211B /3/31N (2|25|36): objs=3783 size=16.99KiB /3/32S (2|25|36): objs=156 size=159B /3/33N (2|25|36): objs=442 size=1.54KiB /3/34S (2|25|36): objs=151 size=114B /3/35N (2|25|36): objs=1493 size=6.31KiB /4/0N (2|25|36): objs=6480 size=29.15KiB /4/1S (2|25|36): objs=168 size=88B /4/2N (2|25|36): objs=33138 size=545.52KiB /4/3N (2|25|36): objs=34438 size=559.68KiB /4/4N (2|25|36): objs=37974 size=844.94KiB /4/5N (2|25|36): objs=12776 size=75.46KiB /4/6S (2|25|36): objs=169 size=176B /4/7N (2|25|36): objs=1989 size=8.26KiB /4/8S (2|25|36): objs=144 size=302B /4/9N (2|25|36): objs=3855 size=17.49KiB /4/10S (2|25|36): objs=155 size=120B /4/12S (2|25|36): objs=139 size=247B /4/13N (2|25|36): objs=5385 size=29.33KiB /4/14S (2|25|36): objs=155 size=312B /4/15N (2|25|36): objs=906 size=3.6KiB /4/16S (2|25|36): objs=194 size=122B /4/17N (2|25|36): objs=744 size=2.77KiB /4/18S (2|25|36): objs=148 size=333B /4/19N (2|25|36): objs=672 size=2.52KiB /4/20S (2|25|36): objs=174 size=358B /4/21N (2|25|36): objs=6249 size=27.48KiB /4/22S (2|25|36): objs=155 size=287B /4/23N (2|25|36): objs=1036 size=4.26KiB /4/24S (2|25|36): objs=161 size=279B /4/25N (2|25|36): objs=290 size=817B /4/26S (2|25|36): objs=146 size=161B /4/27N (2|25|36): objs=737 size=2.85KiB /4/28S (2|25|36): objs=172 size=182B /4/29N (2|25|36): objs=300 size=1.08KiB /4/30S (2|25|36): objs=161 size=258B /4/31N (2|25|36): objs=3735 size=17.73KiB /4/32S (2|25|36): objs=153 size=336B /4/33S (2|25|36): objs=160 size=219B /4/34S (2|25|36): objs=156 size=178B /4/35N (2|25|36): objs=1070 size=4.4KiB /5/0N (2|25|36): objs=38390 size=814.73KiB /5/1N (2|25|36): objs=40452 size=949.33KiB /5/2N (2|25|36): objs=41175 size=909.64KiB /5/4S (2|25|36): objs=153 size=238B /5/5N (2|25|36): objs=11777 size=70.35KiB /5/6S (2|25|36): objs=153 size=188B /5/7N (2|25|36): objs=1234 size=4.94KiB /5/8S (2|25|36): objs=133 size=197B /5/9N (2|25|36): objs=1086 size=4.29KiB /5/10S (2|25|36): objs=160 size=121B /5/11N (2|25|36): objs=3186 size=13.78KiB /5/12S (2|25|36): objs=162 size=322B /5/13S (2|25|36): objs=181 size=137B /5/14S (2|25|36): objs=151 size=200B /5/15N (2|25|36): objs=736 size=2.68KiB /5/16S (2|25|36): objs=153 size=138B /5/17N (2|25|36): objs=2419 size=10.3KiB /5/18S (2|25|36): objs=154 size=206B /5/20S (2|25|36): objs=147 size=159B /5/21N (2|25|36): objs=3588 size=15.81KiB /5/22S (2|25|36): objs=154 size=254B /5/23N (2|25|36): objs=1583 size=6.45KiB /5/24S (2|25|36): objs=147 size=132B /5/25N (2|25|36): objs=445 size=1.49KiB /5/26S (2|25|36): objs=152 size=309B /5/27N (2|25|36): objs=2613 size=11.21KiB /5/28S (2|25|36): objs=162 size=87B /5/29S (2|25|36): objs=137 size=288B /5/30S (2|25|36): objs=185 size=117B /5/31N (2|25|36): objs=1113 size=4.62KiB /5/32S (2|25|36): objs=169 size=274B /5/33N (2|25|36): objs=4884 size=23.09KiB /5/34S (2|25|36): objs=145 size=188B /5/35N (2|25|36): objs=4114 size=18.91KiB /6/0N (2|25|36): objs=40215 size=846.11KiB /6/1N (2|25|36): objs=36835 size=836.89KiB /6/2N (2|25|36): objs=40597 size=940.07KiB /6/3N (2|25|36): objs=4062 size=18.45KiB /6/4S (2|25|36): objs=146 size=224B /6/5N (2|25|36): objs=3222 size=13.75KiB /6/6S (2|25|36): objs=162 size=308B /6/7N (2|25|36): objs=296 size=734B /6/8S (2|25|36): objs=157 size=290B /6/9N (2|25|36): objs=1835 size=7.67KiB /6/10S (2|25|36): objs=152 size=137B /6/11N (2|25|36): objs=1462 size=6.25KiB /6/12S (2|25|36): objs=127 size=196B /6/13N (2|25|36): objs=2986 size=12.9KiB /6/14S (2|25|36): objs=145 size=180B /6/15N (2|25|36): objs=8566 size=40.99KiB /6/16S (2|25|36): objs=127 size=93B /6/17S (2|25|36): objs=150 size=270B /6/18S (2|25|36): objs=148 size=222B /6/19N (2|25|36): objs=783 size=2.9KiB /6/20S (2|25|36): objs=159 size=170B /6/21N (2|25|36): objs=1845 size=7.77KiB /6/22S (2|25|36): objs=142 size=105B /6/23N (2|25|36): objs=621 size=2.35KiB /6/24S (2|25|36): objs=156 size=162B /6/25N (2|25|36): objs=920 size=3.72KiB /6/26S (2|25|36): objs=159 size=192B /6/27S (2|25|36): objs=144 size=118B /6/28S (2|25|36): objs=154 size=301B /6/29N (2|25|36): objs=569 size=2.33KiB /6/30S (2|25|36): objs=153 size=181B /6/31S (2|25|36): objs=137 size=262B /6/32S (2|25|36): objs=168 size=266B /6/33N (2|25|36): objs=2884 size=12.17KiB /6/34S (2|25|36): objs=176 size=364B /6/35N (2|25|36): objs=3201 size=14.46KiB /7/0N (2|25|36): objs=37791 size=818.31KiB /7/1N (2|25|36): objs=38795 size=859.93KiB /7/2N (2|25|36): objs=38552 size=885KiB /7/3N (2|25|36): objs=10180 size=57.21KiB /7/4S (2|25|36): objs=147 size=93B /7/5N (2|25|36): objs=3263 size=14.12KiB /7/6S (2|25|36): objs=131 size=287B /7/7N (2|25|36): objs=2571 size=10.97KiB /7/8S (2|25|36): objs=132 size=314B /7/10S (2|25|36): objs=129 size=210B /7/11N (2|25|36): objs=1959 size=8.25KiB /7/12S (2|25|36): objs=139 size=228B /7/13N (2|25|36): objs=3113 size=14.23KiB /7/14S (2|25|36): objs=140 size=142B /7/15N (2|25|36): objs=563 size=2.25KiB /7/16S (2|25|36): objs=128 size=103B /7/17N (2|25|36): objs=2016 size=9.26KiB /7/18S (2|25|36): objs=163 size=112B /7/19N (2|25|36): objs=4148 size=18.55KiB /7/20S (2|25|36): objs=150 size=279B /7/21S (2|25|36): objs=158 size=158B /7/22S (2|25|36): objs=163 size=114B /7/24S (2|25|36): objs=167 size=240B /7/25N (2|25|36): objs=5344 size=24.29KiB /7/26S (2|25|36): objs=128 size=225B /7/27N (2|25|36): objs=3180 size=13.3KiB /7/28S (2|25|36): objs=159 size=309B /7/30S (2|25|36): objs=167 size=215B /7/31N (2|25|36): objs=598 size=2.23KiB /7/32S (2|25|36): objs=163 size=160B /7/33N (2|25|36): objs=2528 size=10.72KiB /7/34S (2|25|36): objs=147 size=333B /7/35N (2|25|36): objs=1672 size=6.8KiB /8/0N (2|25|36): objs=41125 size=1004.8KiB /8/1N (2|25|36): objs=39130 size=971.01KiB /8/2N (2|25|36): objs=30678 size=463.72KiB /8/3S (2|25|36): objs=149 size=172B /8/4N (2|25|36): objs=7402 size=34.19KiB /8/5N (2|25|36): objs=2333 size=10.71KiB /8/6S (2|25|36): objs=153 size=196B /8/7N (2|25|36): objs=1872 size=7.73KiB /8/8S (2|25|36): objs=146 size=267B /8/9N (2|25|36): objs=769 size=2.92KiB /8/10S (2|25|36): objs=160 size=103B /8/11N (2|25|36): objs=2706 size=11.32KiB /8/12S (2|25|36): objs=160 size=196B /8/13N (2|25|36): objs=5682 size=28.92KiB /8/14S (2|25|36): objs=147 size=117B /8/15N (2|25|36): objs=456 size=1.61KiB /8/16S (2|25|36): objs=156 size=139B /8/17N (2|25|36): objs=1492 size=5.88KiB /8/18S (2|25|36): objs=155 size=157B /8/19N (2|25|36): objs=8389 size=47.72KiB /8/20S (2|25|36): objs=185 size=119B /8/21N (2|25|36): objs=3304 size=14.59KiB /8/22S (2|25|36): objs=139 size=246B /8/23N (2|25|36): objs=3061 size=13KiB /8/24S (2|25|36): objs=164 size=287B /8/25N (2|25|36): objs=1238 size=5.04KiB /8/26S (2|25|36): objs=142 size=89B /8/27N (2|25|36): objs=790 size=3.02KiB /8/28S (2|25|36): objs=152 size=318B /8/29N (2|25|36): objs=870 size=3.37KiB /8/30S (2|25|36): objs=149 size=292B /8/31S (2|25|36): objs=145 size=207B /8/32S (2|25|36): objs=165 size=119B /8/33N (2|25|36): objs=451 size=1.64KiB /8/34S (2|25|36): objs=165 size=227B /8/35N (2|25|36): objs=1981 size=8.51KiB /9/0N (2|25|36): objs=41122 size=1022.81KiB /9/1N (2|25|36): objs=39007 size=852.97KiB /9/2N (2|25|36): objs=37985 size=890.98KiB /9/3S (2|25|36): objs=166 size=102B /9/4S (2|25|36): objs=151 size=336B /9/5N (2|25|36): objs=1550 size=6.57KiB /9/6S (2|25|36): objs=166 size=195B /9/8S (2|25|36): objs=167 size=240B /9/9N (2|25|36): objs=310 size=1.03KiB /9/10S (2|25|36): objs=164 size=180B /9/11N (2|25|36): objs=473 size=1.67KiB /9/12S (2|25|36): objs=168 size=141B /9/14S (2|25|36): objs=158 size=302B /9/15N (2|25|36): objs=2959 size=12.74KiB /9/16S (2|25|36): objs=141 size=316B /9/17N (2|25|36): objs=2586 size=11.2KiB /9/18S (2|25|36): objs=138 size=178B /9/19N (2|25|36): objs=13159 size=84.91KiB /9/20S (2|25|36): objs=153 size=339B /9/21S (2|25|36): objs=163 size=145B /9/22S (2|25|36): objs=174 size=186B /9/23S (2|25|36): objs=147 size=281B /9/24S (2|25|36): objs=151 size=273B /9/26S (2|25|36): objs=146 size=338B /9/28S (2|25|36): objs=144 size=216B /9/29N (2|25|36): objs=3052 size=13.53KiB /9/30S (2|25|36): objs=150 size=338B /9/31N (2|25|36): objs=297 size=996B /9/32S (2|25|36): objs=152 size=139B /9/34S (2|25|36): objs=172 size=350B /9/35N (2|25|36): objs=7042 size=33.71KiB /10/0N (2|25|36): objs=37341 size=766.45KiB /10/1N (2|25|36): objs=40682 size=835.94KiB /10/2N (2|25|36): objs=35873 size=732.92KiB /10/3N (2|25|36): objs=4164 size=20.36KiB /10/4S (2|25|36): objs=157 size=93B /10/5N (2|25|36): objs=1038 size=3.99KiB /10/6S (2|25|36): objs=165 size=204B /10/7N (2|25|36): objs=3080 size=14.32KiB /10/8S (2|25|36): objs=156 size=311B /10/9N (2|25|36): objs=5021 size=22.77KiB /10/10S (2|25|36): objs=142 size=334B /10/11N (2|25|36): objs=3357 size=16.08KiB /10/12S (2|25|36): objs=161 size=295B /10/13N (2|25|36): objs=1105 size=4.22KiB /10/14S (2|25|36): objs=154 size=198B /10/15N (2|25|36): objs=1080 size=4.45KiB /10/16S (2|25|36): objs=150 size=301B /10/17N (2|25|36): objs=1282 size=5.14KiB /10/18S (2|25|36): objs=157 size=205B /10/19N (2|25|36): objs=4013 size=18.18KiB /10/20S (2|25|36): objs=152 size=111B /10/21N (2|25|36): objs=427 size=1.4KiB /10/22S (2|25|36): objs=137 size=312B /10/23N (2|25|36): objs=770 size=2.94KiB /10/24S (2|25|36): objs=149 size=314B /10/25N (2|25|36): objs=1970 size=8.55KiB /10/26S (2|25|36): objs=133 size=226B /10/27N (2|25|36): objs=1600 size=6.75KiB /10/28S (2|25|36): objs=159 size=108B /10/29N (2|25|36): objs=277 size=839B /10/30S (2|25|36): objs=170 size=336B /10/32S (2|25|36): objs=140 size=281B /10/33N (2|25|36): objs=5982 size=27.31KiB /10/34S (2|25|36): objs=163 size=158B /10/35N (2|25|36): objs=2165 size=9.34KiB /11/0N (2|25|36): objs=40372 size=956.78KiB /11/1N (2|25|36): objs=34488 size=638.75KiB /11/2N (2|25|36): objs=41378 size=942.21KiB /11/3N (2|25|36): objs=4456 size=19.77KiB /11/4S (2|25|36): objs=154 size=261B /11/5N (2|25|36): objs=459 size=1.56KiB /11/6S (2|25|36): objs=130 size=325B /11/7N (2|25|36): objs=2413 size=10.62KiB /11/8S (2|25|36): objs=146 size=217B /11/9N (2|25|36): objs=2698 size=12.04KiB /11/10S (2|25|36): objs=150 size=132B /11/11N (2|25|36): objs=1174 size=4.72KiB /11/12S (2|25|36): objs=188 size=155B /11/13N (2|25|36): objs=1699 size=7.04KiB /11/14S (2|25|36): objs=139 size=152B /11/15N (2|25|36): objs=2798 size=12.85KiB /11/16S (2|25|36): objs=158 size=301B /11/17N (2|25|36): objs=3803 size=17.46KiB /11/18S (2|25|36): objs=166 size=356B /11/20S (2|25|36): objs=166 size=342B /11/21N (2|25|36): objs=782 size=3.01KiB /11/22S (2|25|36): objs=170 size=350B /11/23N (2|25|36): objs=3352 size=15.68KiB /11/24S (2|25|36): objs=156 size=261B /11/25N (2|25|36): objs=5657 size=26.9KiB /11/26S (2|25|36): objs=162 size=244B /11/28S (2|25|36): objs=155 size=179B /11/29N (2|25|36): objs=821 size=2.84KiB /11/30S (2|25|36): objs=142 size=269B /11/32S (2|25|36): objs=144 size=129B /11/33N (2|25|36): objs=4989 size=22.66KiB /11/34S (2|25|36): objs=124 size=176B /11/35N (2|25|36): objs=2023 size=8.42KiB /12/0N (2|25|36): objs=37472 size=774.28KiB /12/1N (2|25|36): objs=36764 size=646.59KiB /12/2N (2|25|36): objs=35263 size=628.57KiB /12/3S (2|25|36): objs=166 size=253B /12/4N (2|25|36): objs=1211 size=5.03KiB /12/5S (2|25|36): objs=152 size=307B /12/6N (2|25|36): objs=1539 size=6.09KiB /12/7N (2|25|36): objs=5845 size=28.96KiB /12/8S (2|25|36): objs=170 size=172B /12/9N (2|25|36): objs=3482 size=15.12KiB /12/10S (2|25|36): objs=125 size=135B /12/11N (2|25|36): objs=4030 size=24.24KiB /12/12S (2|25|36): objs=176 size=274B /12/13N (2|25|36): objs=858 size=3.4KiB /12/14S (2|25|36): objs=148 size=312B /12/15N (2|25|36): objs=7176 size=35.27KiB /12/16S (2|25|36): objs=158 size=287B /12/17S (2|25|36): objs=137 size=195B /12/18S (2|25|36): objs=155 size=214B /12/19N (2|25|36): objs=446 size=1.37KiB /12/20S (2|25|36): objs=149 size=133B /12/21N (2|25|36): objs=3564 size=16.6KiB /12/22S (2|25|36): objs=156 size=159B /12/23N (2|25|36): objs=586 size=2.16KiB /12/24S (2|25|36): objs=176 size=91B /12/25N (2|25|36): objs=4859 size=22.51KiB /12/26S (2|25|36): objs=140 size=267B /12/27N (2|25|36): objs=2638 size=10.98KiB /12/28S (2|25|36): objs=130 size=283B /12/29N (2|25|36): objs=4229 size=18.19KiB /12/30S (2|25|36): objs=153 size=191B /12/31N (2|25|36): objs=3451 size=17.03KiB /12/32S (2|25|36): objs=160 size=142B /12/33N (2|25|36): objs=1194 size=4.9KiB /12/34S (2|25|36): objs=142 size=192B /12/35N (2|25|36): objs=715 size=2.81KiB /13/0N (1|26|34): objs=69919 size=2.54MiB /13/1N (1|26|34): objs=27117 size=431.84KiB /13/2S (1|26|34): objs=172 size=238B /13/3N (1|26|34): objs=2779 size=12.63KiB /13/4S (1|26|34): objs=141 size=156B /13/5N (1|26|34): objs=3234 size=14.73KiB /13/6S (1|26|34): objs=147 size=301B /13/7N (1|26|34): objs=2159 size=9.04KiB /13/8S (1|26|34): objs=168 size=259B /13/9N (1|26|34): objs=2690 size=12.45KiB /13/10S (1|26|34): objs=174 size=346B /13/11N (1|26|34): objs=1542 size=6.51KiB /13/12S (1|26|34): objs=153 size=300B /13/13N (1|26|34): objs=4637 size=21.48KiB /13/14S (1|26|34): objs=136 size=275B /13/15N (1|26|34): objs=2647 size=11.14KiB /13/16S (1|26|34): objs=183 size=236B /13/18S (1|26|34): objs=157 size=247B /13/19N (1|26|34): objs=5267 size=23.54KiB /13/20S (1|26|34): objs=152 size=118B /13/21N (1|26|34): objs=3958 size=18.13KiB /13/22S (1|26|34): objs=152 size=246B /13/23N (1|26|34): objs=2535 size=11.65KiB /13/24S (1|26|34): objs=153 size=105B /13/25N (1|26|34): objs=9726 size=53.48KiB /13/26S (1|26|34): objs=145 size=235B /13/27N (1|26|34): objs=615 size=2.17KiB /13/28S (1|26|34): objs=164 size=319B /13/29N (1|26|34): objs=471 size=1.64KiB /13/30S (1|26|34): objs=142 size=299B /13/31N (1|26|34): objs=462 size=1.58KiB /13/32S (1|26|34): objs=156 size=342B /13/33N (1|26|34): objs=3581 size=15.37KiB /14/0N (2|25|36): objs=41672 size=1.02MiB /14/1N (2|25|36): objs=39737 size=783.62KiB /14/2N (2|25|36): objs=38908 size=866.17KiB /14/3N (2|25|36): objs=5871 size=30.92KiB /14/4S (2|25|36): objs=154 size=279B /14/5N (2|25|36): objs=1117 size=4.34KiB /14/6S (2|25|36): objs=167 size=348B /14/7N (2|25|36): objs=3655 size=16.81KiB /14/8S (2|25|36): objs=156 size=164B /14/9N (2|25|36): objs=4104 size=18.87KiB /14/10S (2|25|36): objs=149 size=188B /14/11N (2|25|36): objs=463 size=1.36KiB /14/12S (2|25|36): objs=155 size=109B /14/13N (2|25|36): objs=4013 size=19.05KiB /14/14S (2|25|36): objs=142 size=149B /14/15S (2|25|36): objs=162 size=243B /14/16S (2|25|36): objs=144 size=159B /14/17N (2|25|36): objs=634 size=2.34KiB /14/18S (2|25|36): objs=148 size=225B /14/19N (2|25|36): objs=1224 size=5.25KiB /14/20S (2|25|36): objs=146 size=140B /14/21N (2|25|36): objs=2283 size=9.87KiB /14/22S (2|25|36): objs=146 size=285B /14/23N (2|25|36): objs=3931 size=18.18KiB /14/24S (2|25|36): objs=145 size=85B /14/25S (2|25|36): objs=139 size=202B /14/26S (2|25|36): objs=115 size=168B /14/27N (2|25|36): objs=3385 size=14.35KiB /14/28S (2|25|36): objs=167 size=280B /14/29N (2|25|36): objs=303 size=931B /14/30S (2|25|36): objs=152 size=285B /14/31N (2|25|36): objs=2234 size=9.21KiB /14/32S (2|25|36): objs=170 size=145B /14/33N (2|25|36): objs=1201 size=4.87KiB /14/34S (2|25|36): objs=116 size=269B /14/35N (2|25|36): objs=910 size=3.44KiB /15/0N (2|25|36): objs=36356 size=710.71KiB /15/1N (2|25|36): objs=40358 size=912.85KiB /15/2N (2|25|36): objs=31249 size=511.83KiB /15/3S (2|25|36): objs=156 size=249B /15/4N (2|25|36): objs=775 size=2.86KiB /15/5S (2|25|36): objs=147 size=283B /15/6N (2|25|36): objs=1195 size=4.71KiB /15/7S (2|25|36): objs=147 size=273B /15/8N (2|25|36): objs=5447 size=24.26KiB /15/9S (2|25|36): objs=143 size=298B /15/10N (2|25|36): objs=2711 size=12.88KiB /15/11S (2|25|36): objs=146 size=203B /15/12N (2|25|36): objs=1255 size=5.38KiB /15/13N (2|25|36): objs=1615 size=6.64KiB /15/14S (2|25|36): objs=156 size=248B /15/15N (2|25|36): objs=928 size=3.56KiB /15/16S (2|25|36): objs=143 size=157B /15/17N (2|25|36): objs=2869 size=12.86KiB /15/18S (2|25|36): objs=133 size=276B /15/19N (2|25|36): objs=4303 size=18.9KiB /15/20S (2|25|36): objs=160 size=292B /15/21N (2|25|36): objs=4302 size=19.56KiB /15/22S (2|25|36): objs=149 size=246B /15/24S (2|25|36): objs=159 size=163B /15/25N (2|25|36): objs=596 size=2.07KiB /15/26S (2|25|36): objs=156 size=238B /15/27N (2|25|36): objs=2577 size=11.05KiB /15/28S (2|25|36): objs=151 size=293B /15/29N (2|25|36): objs=3557 size=17.47KiB /15/30S (2|25|36): objs=151 size=342B /15/31N (2|25|36): objs=3992 size=17.52KiB /15/32S (2|25|36): objs=158 size=203B /15/33N (2|25|36): objs=1766 size=7.32KiB /15/34S (2|25|36): objs=163 size=218B /15/35N (2|25|36): objs=8071 size=42.53KiB /16/0N (2|25|36): objs=39486 size=882.7KiB /16/1N (2|25|36): objs=39053 size=919.84KiB /16/2N (2|25|36): objs=38496 size=792.34KiB /16/3N (2|25|36): objs=8136 size=40.12KiB /16/4S (2|25|36): objs=144 size=185B /16/5N (2|25|36): objs=299 size=858B /16/6S (2|25|36): objs=155 size=275B /16/7N (2|25|36): objs=2380 size=10.53KiB /16/8S (2|25|36): objs=167 size=156B /16/9N (2|25|36): objs=2189 size=9.3KiB /16/10S (2|25|36): objs=147 size=314B /16/11N (2|25|36): objs=566 size=2.04KiB /16/12S (2|25|36): objs=153 size=228B /16/13N (2|25|36): objs=1504 size=6.25KiB /16/14S (2|25|36): objs=158 size=270B /16/15N (2|25|36): objs=3246 size=14.48KiB /16/16S (2|25|36): objs=178 size=310B /16/17N (2|25|36): objs=453 size=1.51KiB /16/18S (2|25|36): objs=148 size=92B /16/19N (2|25|36): objs=452 size=1.38KiB /16/20S (2|25|36): objs=166 size=267B /16/21N (2|25|36): objs=3407 size=14.46KiB /16/22S (2|25|36): objs=155 size=169B /16/23N (2|25|36): objs=1869 size=7.84KiB /16/24S (2|25|36): objs=167 size=250B /16/25N (2|25|36): objs=3380 size=15.65KiB /16/26S (2|25|36): objs=164 size=176B /16/27N (2|25|36): objs=739 size=2.96KiB /16/28S (2|25|36): objs=148 size=261B /16/29N (2|25|36): objs=4042 size=17.79KiB /16/30S (2|25|36): objs=141 size=306B /16/31N (2|25|36): objs=2603 size=11.18KiB /16/32S (2|25|36): objs=149 size=154B /16/33N (2|25|36): objs=314 size=1.03KiB /16/34S (2|25|36): objs=145 size=226B /16/35N (2|25|36): objs=3831 size=16.84KiB /17/0N (2|25|36): objs=40993 size=901.53KiB /17/1N (2|25|36): objs=39784 size=898.2KiB /17/2N (2|25|36): objs=39026 size=883.42KiB /17/3N (2|25|36): objs=3577 size=15.05KiB /17/4S (2|25|36): objs=161 size=181B /17/5N (2|25|36): objs=1562 size=6.33KiB /17/6S (2|25|36): objs=150 size=287B /17/7N (2|25|36): objs=4964 size=22.85KiB /17/8S (2|25|36): objs=164 size=240B /17/9N (2|25|36): objs=631 size=2.21KiB /17/10S (2|25|36): objs=142 size=244B /17/11N (2|25|36): objs=2469 size=10.59KiB /17/12S (2|25|36): objs=127 size=313B /17/14S (2|25|36): objs=145 size=196B /17/15N (2|25|36): objs=731 size=2.68KiB /17/16S (2|25|36): objs=144 size=139B /17/17N (2|25|36): objs=2251 size=9.91KiB /17/18S (2|25|36): objs=146 size=222B /17/19N (2|25|36): objs=4054 size=17.67KiB /17/20S (2|25|36): objs=185 size=181B /17/21N (2|25|36): objs=3423 size=15.19KiB /17/22S (2|25|36): objs=132 size=260B /17/23N (2|25|36): objs=1393 size=5.75KiB /17/24S (2|25|36): objs=136 size=236B /17/25N (2|25|36): objs=892 size=3.33KiB /17/26S (2|25|36): objs=143 size=145B /17/27N (2|25|36): objs=3901 size=17.77KiB /17/28S (2|25|36): objs=159 size=101B /17/29N (2|25|36): objs=896 size=3.34KiB /17/30S (2|25|36): objs=148 size=92B /17/31N (2|25|36): objs=4240 size=20.37KiB /17/32S (2|25|36): objs=149 size=300B /17/33N (2|25|36): objs=467 size=1.34KiB /17/34S (2|25|36): objs=159 size=145B /17/35N (2|25|36): objs=3009 size=12.97KiB /18/0N (2|25|36): objs=38617 size=939.42KiB /18/1N (2|25|36): objs=44749 size=1.02MiB /18/2N (2|25|36): objs=42413 size=943.99KiB /18/3S (2|25|36): objs=153 size=127B /18/4N (2|25|36): objs=1587 size=6.67KiB /18/5N (2|25|36): objs=3831 size=18.26KiB /18/6S (2|25|36): objs=143 size=209B /18/7N (2|25|36): objs=1708 size=7.25KiB /18/8S (2|25|36): objs=151 size=139B /18/9N (2|25|36): objs=4720 size=22.92KiB /18/10S (2|25|36): objs=129 size=277B /18/11S (2|25|36): objs=138 size=280B /18/12S (2|25|36): objs=141 size=202B /18/13N (2|25|36): objs=1956 size=7.96KiB /18/14S (2|25|36): objs=164 size=144B /18/15N (2|25|36): objs=1555 size=6.21KiB /18/16S (2|25|36): objs=172 size=137B /18/17N (2|25|36): objs=613 size=2.16KiB /18/18S (2|25|36): objs=149 size=284B /18/19N (2|25|36): objs=3387 size=15.45KiB /18/20S (2|25|36): objs=164 size=239B /18/21N (2|25|36): objs=770 size=2.72KiB /18/22S (2|25|36): objs=138 size=161B /18/23N (2|25|36): objs=2517 size=10.51KiB /18/24S (2|25|36): objs=150 size=266B /18/25N (2|25|36): objs=1880 size=7.76KiB /18/26S (2|25|36): objs=172 size=224B /18/28S (2|25|36): objs=147 size=296B /18/29N (2|25|36): objs=5632 size=26.39KiB /18/30S (2|25|36): objs=171 size=291B /18/31N (2|25|36): objs=4811 size=21.53KiB /18/32S (2|25|36): objs=154 size=223B /18/33N (2|25|36): objs=2930 size=12.53KiB /18/34S (2|25|36): objs=169 size=128B /18/35N (2|25|36): objs=1564 size=6.78KiB /19/0N (2|25|36): objs=40977 size=915.18KiB /19/1N (2|25|36): objs=42723 size=999.14KiB /19/2N (2|25|36): objs=38300 size=735.72KiB /19/3N (2|25|36): objs=3978 size=20.05KiB /19/4S (2|25|36): objs=162 size=120B /19/5N (2|25|36): objs=1232 size=5.03KiB /19/6S (2|25|36): objs=170 size=157B /19/7N (2|25|36): objs=1027 size=4.09KiB /19/8S (2|25|36): objs=173 size=273B /19/9N (2|25|36): objs=4541 size=20.49KiB /19/10S (2|25|36): objs=171 size=240B /19/11N (2|25|36): objs=703 size=2.83KiB /19/12S (2|25|36): objs=151 size=331B /19/13N (2|25|36): objs=617 size=2.36KiB /19/14S (2|25|36): objs=146 size=220B /19/15N (2|25|36): objs=5723 size=26.62KiB /19/16S (2|25|36): objs=145 size=234B /19/17N (2|25|36): objs=335 size=1KiB /19/18S (2|25|36): objs=149 size=302B /19/19S (2|25|36): objs=180 size=270B /19/20S (2|25|36): objs=158 size=325B /19/21N (2|25|36): objs=1073 size=4.38KiB /19/22S (2|25|36): objs=145 size=118B /19/23N (2|25|36): objs=1700 size=6.94KiB /19/24S (2|25|36): objs=151 size=193B /19/25N (2|25|36): objs=2149 size=9.28KiB /19/26S (2|25|36): objs=137 size=241B /19/27N (2|25|36): objs=4410 size=21.67KiB /19/28S (2|25|36): objs=137 size=136B /19/29N (2|25|36): objs=622 size=2.27KiB /19/30S (2|25|36): objs=167 size=318B /19/31N (2|25|36): objs=4390 size=18.73KiB /19/32S (2|25|36): objs=144 size=284B /19/33N (2|25|36): objs=1795 size=7.56KiB /19/34S (2|25|36): objs=153 size=183B /19/35N (2|25|36): objs=905 size=3.47KiB /20/0N (2|25|36): objs=42063 size=948.67KiB /20/1N (2|25|36): objs=39217 size=883.57KiB /20/2N (2|25|36): objs=41202 size=929.31KiB /20/3N (2|25|36): objs=766 size=3KiB /20/4S (2|25|36): objs=140 size=299B /20/5N (2|25|36): objs=277 size=732B /20/6S (2|25|36): objs=142 size=272B /20/7N (2|25|36): objs=3507 size=15.11KiB /20/8S (2|25|36): objs=152 size=218B /20/9N (2|25|36): objs=5940 size=28.55KiB /20/10S (2|25|36): objs=141 size=255B /20/11N (2|25|36): objs=5257 size=23.53KiB /20/12S (2|25|36): objs=144 size=197B /20/13N (2|25|36): objs=2164 size=9.16KiB /20/14S (2|25|36): objs=146 size=101B /20/15N (2|25|36): objs=2195 size=9.03KiB /20/16S (2|25|36): objs=160 size=90B /20/17N (2|25|36): objs=1193 size=4.73KiB /20/18S (2|25|36): objs=147 size=216B /20/19N (2|25|36): objs=820 size=3.14KiB /20/20S (2|25|36): objs=131 size=258B /20/21N (2|25|36): objs=2549 size=10.74KiB /20/22S (2|25|36): objs=147 size=134B /20/23N (2|25|36): objs=6239 size=28.48KiB /20/24S (2|25|36): objs=148 size=139B /20/25N (2|25|36): objs=1357 size=5.5KiB /20/26S (2|25|36): objs=154 size=154B /20/27N (2|25|36): objs=2013 size=8.28KiB /20/28S (2|25|36): objs=162 size=123B /20/29N (2|25|36): objs=596 size=2.37KiB /20/30S (2|25|36): objs=170 size=239B /20/31N (2|25|36): objs=304 size=829B /20/32S (2|25|36): objs=155 size=109B /20/34S (2|25|36): objs=161 size=114B /21/0N (2|25|36): objs=37729 size=782.12KiB /21/1N (2|25|36): objs=30769 size=590KiB /21/2S (2|25|36): objs=137 size=312B /21/3N (2|25|36): objs=6526 size=31.91KiB /21/4N (2|25|36): objs=35344 size=741.93KiB /21/5N (2|25|36): objs=8072 size=44.44KiB /21/6S (2|25|36): objs=159 size=245B /21/7N (2|25|36): objs=820 size=3.03KiB /21/8S (2|25|36): objs=155 size=226B /21/9N (2|25|36): objs=1179 size=4.79KiB /21/10S (2|25|36): objs=150 size=262B /21/11N (2|25|36): objs=613 size=2.14KiB /21/12S (2|25|36): objs=153 size=281B /21/13N (2|25|36): objs=615 size=2.17KiB /21/14S (2|25|36): objs=142 size=154B /21/15N (2|25|36): objs=2738 size=11.53KiB /21/16S (2|25|36): objs=154 size=272B /21/17N (2|25|36): objs=1366 size=5.7KiB /21/18S (2|25|36): objs=149 size=163B /21/19N (2|25|36): objs=5991 size=26.6KiB /21/20S (2|25|36): objs=150 size=91B /21/21N (2|25|36): objs=2328 size=9.9KiB /21/22S (2|25|36): objs=146 size=99B /21/23N (2|25|36): objs=884 size=3.48KiB /21/24S (2|25|36): objs=160 size=332B /21/25N (2|25|36): objs=478 size=1.75KiB /21/26S (2|25|36): objs=163 size=320B /21/27N (2|25|36): objs=571 size=2.04KiB /21/28S (2|25|36): objs=152 size=219B /21/29N (2|25|36): objs=3149 size=14.36KiB /21/30S (2|25|36): objs=147 size=123B /21/31N (2|25|36): objs=1333 size=5.65KiB /21/32S (2|25|36): objs=138 size=240B /21/33N (2|25|36): objs=3665 size=16KiB /21/34S (2|25|36): objs=187 size=322B /21/35N (2|25|36): objs=2871 size=12.18KiB /22/0N (2|25|36): objs=38391 size=807.62KiB /22/1N (2|25|36): objs=41056 size=913.34KiB /22/2N (2|25|36): objs=31936 size=538.07KiB /22/3S (2|25|36): objs=163 size=89B /22/4N (2|25|36): objs=3727 size=16.36KiB /22/5S (2|25|36): objs=168 size=320B /22/6N (2|25|36): objs=317 size=767B /22/7S (2|25|36): objs=162 size=86B /22/8N (2|25|36): objs=4148 size=18.67KiB /22/9S (2|25|36): objs=125 size=209B /22/10S (2|25|36): objs=149 size=341B /22/12S (2|25|36): objs=168 size=155B /22/14S (2|25|36): objs=154 size=155B /22/15N (2|25|36): objs=5352 size=28.65KiB /22/16S (2|25|36): objs=143 size=262B /22/17N (2|25|36): objs=2641 size=11.15KiB /22/18S (2|25|36): objs=144 size=267B /22/19N (2|25|36): objs=1370 size=5.7KiB /22/20S (2|25|36): objs=154 size=183B /22/21N (2|25|36): objs=4723 size=21.6KiB /22/22S (2|25|36): objs=171 size=90B /22/23N (2|25|36): objs=1366 size=5.43KiB /22/24S (2|25|36): objs=155 size=228B /22/25N (2|25|36): objs=450 size=1.68KiB /22/26S (2|25|36): objs=149 size=272B /22/27N (2|25|36): objs=3066 size=13.29KiB /22/28S (2|25|36): objs=148 size=267B /22/29N (2|25|36): objs=9488 size=52.61KiB /22/30S (2|25|36): objs=137 size=107B /22/31N (2|25|36): objs=6887 size=34.5KiB /22/32S (2|25|36): objs=153 size=301B /22/33N (2|25|36): objs=2732 size=12.92KiB /22/34S (2|25|36): objs=134 size=221B /22/35N (2|25|36): objs=566 size=2.07KiB /23/0N (2|25|36): objs=37562 size=680.55KiB /23/1N (2|25|36): objs=40276 size=770.44KiB /23/2N (2|25|36): objs=9349 size=46.16KiB /23/3S (2|25|36): objs=166 size=341B /23/4N (2|25|36): objs=32128 size=570.74KiB /23/5N (2|25|36): objs=5651 size=29.97KiB /23/6S (2|25|36): objs=165 size=188B /23/7N (2|25|36): objs=2093 size=8.71KiB /23/8S (2|25|36): objs=161 size=220B /23/9N (2|25|36): objs=817 size=3.18KiB /23/10S (2|25|36): objs=149 size=214B /23/12S (2|25|36): objs=153 size=327B /23/13N (2|25|36): objs=653 size=2.52KiB /23/14S (2|25|36): objs=157 size=205B /23/15N (2|25|36): objs=1700 size=8.17KiB /23/16S (2|25|36): objs=158 size=137B /23/17N (2|25|36): objs=1447 size=5.91KiB /23/18S (2|25|36): objs=144 size=85B /23/19N (2|25|36): objs=1659 size=6.88KiB /23/20S (2|25|36): objs=145 size=146B /23/21N (2|25|36): objs=934 size=3.5KiB /23/22S (2|25|36): objs=162 size=93B /23/24S (2|25|36): objs=160 size=323B /23/25S (2|25|36): objs=150 size=315B /23/26S (2|25|36): objs=151 size=270B /23/27N (2|25|36): objs=929 size=3.65KiB /23/28S (2|25|36): objs=158 size=261B /23/29N (2|25|36): objs=909 size=3.5KiB /23/30S (2|25|36): objs=163 size=201B /23/31N (2|25|36): objs=10481 size=67.25KiB /23/32S (2|25|36): objs=164 size=237B /23/33N (2|25|36): objs=2252 size=9.47KiB /23/34S (2|25|36): objs=175 size=216B /23/35N (2|25|36): objs=7411 size=37.24KiB /24/0N (2|25|36): objs=37786 size=777.1KiB /24/1N (2|25|36): objs=37720 size=789.25KiB /24/2N (2|25|36): objs=31684 size=590.89KiB /24/3S (2|25|36): objs=149 size=319B /24/4N (2|25|36): objs=4172 size=19.29KiB /24/5N (2|25|36): objs=773 size=2.94KiB /24/6S (2|25|36): objs=145 size=93B /24/7N (2|25|36): objs=3225 size=13.67KiB /24/8S (2|25|36): objs=149 size=190B /24/9S (2|25|36): objs=166 size=280B /24/10S (2|25|36): objs=143 size=151B /24/11N (2|25|36): objs=2532 size=11.1KiB /24/12S (2|25|36): objs=141 size=155B /24/13N (2|25|36): objs=12113 size=75.75KiB /24/14S (2|25|36): objs=136 size=279B /24/15S (2|25|36): objs=168 size=258B /24/16S (2|25|36): objs=159 size=263B /24/17N (2|25|36): objs=2040 size=8.63KiB /24/18S (2|25|36): objs=148 size=215B /24/19N (2|25|36): objs=1807 size=7.62KiB /24/20S (2|25|36): objs=170 size=252B /24/21N (2|25|36): objs=3793 size=16.93KiB /24/22S (2|25|36): objs=153 size=198B /24/23N (2|25|36): objs=1366 size=5.63KiB /24/24S (2|25|36): objs=173 size=306B /24/25N (2|25|36): objs=754 size=2.87KiB /24/26S (2|25|36): objs=156 size=117B /24/27N (2|25|36): objs=1854 size=7.43KiB /24/28S (2|25|36): objs=132 size=125B /24/29N (2|25|36): objs=3000 size=13.11KiB /24/30S (2|25|36): objs=168 size=226B /24/31N (2|25|36): objs=1006 size=3.92KiB /24/32S (2|25|36): objs=169 size=335B /24/33N (2|25|36): objs=291 size=837B /24/34S (2|25|36): objs=142 size=140B /24/35N (2|25|36): objs=1562 size=6.32KiB /25/0N (2|25|36): objs=39312 size=892.85KiB /25/1S (2|25|36): objs=155 size=283B /25/2N (2|25|36): objs=1497 size=6.21KiB /25/3N (2|25|36): objs=40500 size=976.67KiB /25/4N (2|25|36): objs=37613 size=758.89KiB /25/5N (2|25|36): objs=5594 size=24.42KiB /25/6S (2|25|36): objs=166 size=231B /25/7N (2|25|36): objs=7739 size=35.53KiB /25/8S (2|25|36): objs=153 size=133B /25/9N (2|25|36): objs=1075 size=4.27KiB /25/10S (2|25|36): objs=144 size=118B /25/11N (2|25|36): objs=298 size=862B /25/12S (2|25|36): objs=144 size=184B /25/14S (2|25|36): objs=136 size=300B /25/15N (2|25|36): objs=11319 size=70.43KiB /25/16S (2|25|36): objs=146 size=245B /25/17N (2|25|36): objs=1721 size=7.18KiB /25/18S (2|25|36): objs=145 size=204B /25/20S (2|25|36): objs=145 size=173B /25/21N (2|25|36): objs=477 size=1.6KiB /25/22S (2|25|36): objs=168 size=307B /25/24S (2|25|36): objs=163 size=314B /25/25N (2|25|36): objs=2151 size=8.92KiB /25/26S (2|25|36): objs=137 size=318B /25/27N (2|25|36): objs=760 size=2.75KiB /25/28S (2|25|36): objs=163 size=127B /25/29N (2|25|36): objs=2890 size=13.52KiB /25/30S (2|25|36): objs=149 size=91B /25/32S (2|25|36): objs=150 size=287B /25/33N (2|25|36): objs=1419 size=5.75KiB /25/34S (2|25|36): objs=136 size=125B /25/35N (2|25|36): objs=2569 size=10.85KiB /26/0N (2|25|36): objs=36387 size=688.36KiB /26/1N (2|25|36): objs=9972 size=59.08KiB /26/2S (2|25|36): objs=174 size=224B /26/3N (2|25|36): objs=37610 size=693.75KiB /26/4N (2|25|36): objs=36572 size=706.02KiB /26/5N (2|25|36): objs=11953 size=69.08KiB /26/6S (2|25|36): objs=144 size=110B /26/7N (2|25|36): objs=1703 size=7.17KiB /26/8S (2|25|36): objs=150 size=152B /26/9N (2|25|36): objs=625 size=2.37KiB /26/10S (2|25|36): objs=128 size=169B /26/12S (2|25|36): objs=146 size=268B /26/13N (2|25|36): objs=782 size=3.29KiB /26/14S (2|25|36): objs=141 size=323B /26/15N (2|25|36): objs=1799 size=7.56KiB /26/16S (2|25|36): objs=146 size=168B /26/17N (2|25|36): objs=905 size=3.59KiB /26/18S (2|25|36): objs=155 size=298B /26/19N (2|25|36): objs=3579 size=15.23KiB /26/20S (2|25|36): objs=157 size=233B /26/21S (2|25|36): objs=150 size=311B /26/22S (2|25|36): objs=143 size=286B /26/23N (2|25|36): objs=5339 size=23.12KiB /26/24S (2|25|36): objs=163 size=271B /26/25N (2|25|36): objs=3145 size=13.95KiB /26/26S (2|25|36): objs=154 size=317B /26/27N (2|25|36): objs=5658 size=27.71KiB /26/28S (2|25|36): objs=161 size=112B /26/29N (2|25|36): objs=1047 size=4.31KiB /26/30S (2|25|36): objs=176 size=265B /26/31S (2|25|36): objs=158 size=185B /26/32S (2|25|36): objs=149 size=253B /26/33N (2|25|36): objs=760 size=2.75KiB /26/34S (2|25|36): objs=172 size=325B /26/35N (2|25|36): objs=1737 size=7.24KiB /27/0N (2|25|36): objs=36845 size=741.39KiB /27/1N (2|25|36): objs=38887 size=844.13KiB /27/2N (2|25|36): objs=40355 size=869.3KiB /27/3N (2|25|36): objs=2698 size=12.79KiB /27/4S (2|25|36): objs=153 size=171B /27/5N (2|25|36): objs=599 size=2.18KiB /27/6S (2|25|36): objs=157 size=101B /27/7N (2|25|36): objs=579 size=1.93KiB /27/8S (2|25|36): objs=141 size=144B /27/9N (2|25|36): objs=2112 size=9KiB /27/10S (2|25|36): objs=165 size=138B /27/11N (2|25|36): objs=768 size=3.02KiB /27/12S (2|25|36): objs=160 size=280B /27/13N (2|25|36): objs=8627 size=44.97KiB /27/14S (2|25|36): objs=143 size=304B /27/15N (2|25|36): objs=453 size=1.49KiB /27/16S (2|25|36): objs=151 size=263B /27/17N (2|25|36): objs=1396 size=5.71KiB /27/18S (2|25|36): objs=142 size=221B /27/19N (2|25|36): objs=317 size=844B /27/20S (2|25|36): objs=146 size=267B /27/21N (2|25|36): objs=1971 size=8.27KiB /27/22S (2|25|36): objs=162 size=208B /27/23N (2|25|36): objs=1242 size=5.03KiB /27/24S (2|25|36): objs=145 size=273B /27/25N (2|25|36): objs=722 size=2.74KiB /27/26S (2|25|36): objs=147 size=252B /27/27N (2|25|36): objs=2617 size=12.06KiB /27/28S (2|25|36): objs=140 size=317B /27/29N (2|25|36): objs=1343 size=5.5KiB /27/30S (2|25|36): objs=154 size=318B /27/31N (2|25|36): objs=4200 size=18.8KiB /27/32S (2|25|36): objs=156 size=202B /27/33N (2|25|36): objs=3331 size=15.84KiB /27/34S (2|25|36): objs=143 size=292B /27/35N (2|25|36): objs=1042 size=4.03KiB /28/0N (2|25|36): objs=38564 size=771.23KiB /28/1N (2|25|36): objs=37848 size=722.99KiB /28/2N (2|25|36): objs=35650 size=679.25KiB /28/3N (2|25|36): objs=11500 size=62.87KiB /28/4S (2|25|36): objs=163 size=216B /28/5N (2|25|36): objs=2184 size=9.27KiB /28/6S (2|25|36): objs=152 size=203B /28/7N (2|25|36): objs=4882 size=21.17KiB /28/8S (2|25|36): objs=149 size=137B /28/9N (2|25|36): objs=1204 size=4.77KiB /28/10S (2|25|36): objs=153 size=244B /28/11N (2|25|36): objs=268 size=839B /28/12S (2|25|36): objs=125 size=294B /28/13N (2|25|36): objs=3365 size=14.93KiB /28/14S (2|25|36): objs=130 size=258B /28/15N (2|25|36): objs=1375 size=5.83KiB /28/16S (2|25|36): objs=169 size=343B /28/18S (2|25|36): objs=131 size=99B /28/19N (2|25|36): objs=813 size=3.29KiB /28/20S (2|25|36): objs=148 size=254B /28/21N (2|25|36): objs=3198 size=13.44KiB /28/22S (2|25|36): objs=135 size=89B /28/23N (2|25|36): objs=2111 size=8.56KiB /28/24S (2|25|36): objs=150 size=194B /28/26S (2|25|36): objs=135 size=198B /28/27N (2|25|36): objs=605 size=2.14KiB /28/28S (2|25|36): objs=167 size=231B /28/29N (2|25|36): objs=929 size=3.85KiB /28/30S (2|25|36): objs=162 size=239B /28/31N (2|25|36): objs=1230 size=5.09KiB /28/32S (2|25|36): objs=154 size=283B /28/33N (2|25|36): objs=748 size=2.85KiB /28/34S (2|25|36): objs=172 size=106B /28/35N (2|25|36): objs=1983 size=8.2KiB /29/0N (2|25|36): objs=38366 size=804.92KiB /29/1N (2|25|36): objs=31807 size=454.19KiB /29/2N (2|25|36): objs=39883 size=888.77KiB /29/3N (2|25|36): objs=7582 size=35.09KiB /29/4S (2|25|36): objs=147 size=210B /29/5N (2|25|36): objs=766 size=2.99KiB /29/6S (2|25|36): objs=158 size=167B /29/7N (2|25|36): objs=1398 size=5.72KiB /29/8S (2|25|36): objs=150 size=195B /29/9N (2|25|36): objs=2392 size=10.8KiB /29/10S (2|25|36): objs=149 size=233B /29/11N (2|25|36): objs=257 size=804B /29/12S (2|25|36): objs=159 size=240B /29/13N (2|25|36): objs=2012 size=8.24KiB /29/14S (2|25|36): objs=147 size=187B /29/15S (2|25|36): objs=141 size=275B /29/16S (2|25|36): objs=164 size=175B /29/17N (2|25|36): objs=1170 size=4.81KiB /29/18S (2|25|36): objs=139 size=214B /29/19N (2|25|36): objs=1995 size=8.38KiB /29/20S (2|25|36): objs=133 size=311B /29/22S (2|25|36): objs=144 size=191B /29/23N (2|25|36): objs=907 size=3.41KiB /29/24S (2|25|36): objs=140 size=166B /29/25N (2|25|36): objs=626 size=2.22KiB /29/26S (2|25|36): objs=142 size=129B /29/27N (2|25|36): objs=2146 size=8.87KiB /29/28S (2|25|36): objs=153 size=137B /29/29N (2|25|36): objs=3435 size=14.76KiB /29/30S (2|25|36): objs=149 size=258B /29/31N (2|25|36): objs=7788 size=40.07KiB /29/32S (2|25|36): objs=162 size=248B /29/33N (2|25|36): objs=1099 size=4.35KiB /29/34S (2|25|36): objs=160 size=287B /29/35N (2|25|36): objs=1376 size=5.72KiB /30/0N (2|25|36): objs=40498 size=877.58KiB /30/1N (2|25|36): objs=37783 size=707.36KiB /30/2N (2|25|36): objs=35979 size=799.55KiB /30/3S (2|25|36): objs=170 size=108B /30/4N (2|25|36): objs=482 size=1.8KiB /30/5S (2|25|36): objs=151 size=293B /30/6N (2|25|36): objs=618 size=2.29KiB /30/7S (2|25|36): objs=156 size=304B /30/8N (2|25|36): objs=762 size=2.93KiB /30/9S (2|25|36): objs=139 size=239B /30/10S (2|25|36): objs=140 size=136B /30/11S (2|25|36): objs=175 size=346B /30/12S (2|25|36): objs=154 size=226B /30/13N (2|25|36): objs=5218 size=25.8KiB /30/14S (2|25|36): objs=179 size=300B /30/15N (2|25|36): objs=5986 size=28.9KiB /30/16S (2|25|36): objs=152 size=251B /30/17N (2|25|36): objs=746 size=2.78KiB /30/18S (2|25|36): objs=143 size=310B /30/19N (2|25|36): objs=4331 size=19.37KiB /30/20S (2|25|36): objs=169 size=122B /30/21N (2|25|36): objs=1372 size=5.61KiB /30/22S (2|25|36): objs=128 size=216B /30/23N (2|25|36): objs=1070 size=4.3KiB /30/24S (2|25|36): objs=154 size=256B /30/25N (2|25|36): objs=1526 size=6.19KiB /30/26S (2|25|36): objs=149 size=316B /30/27N (2|25|36): objs=786 size=3.1KiB /30/28S (2|25|36): objs=153 size=186B /30/29N (2|25|36): objs=11250 size=71.31KiB /30/30S (2|25|36): objs=176 size=188B /30/31N (2|25|36): objs=960 size=3.54KiB /30/32S (2|25|36): objs=169 size=354B /30/33N (2|25|36): objs=599 size=2.1KiB /30/34S (2|25|36): objs=169 size=97B /30/35N (2|25|36): objs=3097 size=13.2KiB /31/0N (2|25|36): objs=39978 size=930.87KiB /31/1N (2|25|36): objs=40383 size=896.02KiB /31/2N (2|25|36): objs=39362 size=751.04KiB /31/3N (2|25|36): objs=8104 size=39.04KiB /31/4S (2|25|36): objs=150 size=278B /31/5N (2|25|36): objs=586 size=2.03KiB /31/6S (2|25|36): objs=166 size=90B /31/7N (2|25|36): objs=464 size=1.49KiB /31/8S (2|25|36): objs=146 size=289B /31/9N (2|25|36): objs=2957 size=12.73KiB /31/10S (2|25|36): objs=154 size=331B /31/11N (2|25|36): objs=1617 size=6.72KiB /31/12S (2|25|36): objs=161 size=299B /31/13N (2|25|36): objs=1680 size=6.96KiB /31/14S (2|25|36): objs=134 size=238B /31/15N (2|25|36): objs=2256 size=9.9KiB /31/16S (2|25|36): objs=141 size=325B /31/18S (2|25|36): objs=149 size=144B /31/19N (2|25|36): objs=7754 size=39.21KiB /31/20S (2|25|36): objs=172 size=281B /31/21N (2|25|36): objs=930 size=3.61KiB /31/22S (2|25|36): objs=159 size=298B /31/23N (2|25|36): objs=726 size=2.83KiB /31/24S (2|25|36): objs=148 size=111B /31/25N (2|25|36): objs=2145 size=9.26KiB /31/26S (2|25|36): objs=180 size=291B /31/27S (2|25|36): objs=131 size=321B /31/28S (2|25|36): objs=145 size=157B /31/29N (2|25|36): objs=4958 size=24.69KiB /31/30S (2|25|36): objs=149 size=230B /31/31N (2|25|36): objs=595 size=2.42KiB /31/32S (2|25|36): objs=151 size=105B /31/33N (2|25|36): objs=2110 size=8.81KiB /31/34S (2|25|36): objs=147 size=130B /31/35N (2|25|36): objs=1519 size=6.18KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 380.93ms Sorting: 201.04ms 1 217 41514 99556 99997 com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_5541cc6181ff307213c000e70819beb567f1cf0714928469039949378070 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_3fba364efc11bfdfc34474b99f58672516396c5c1513021175858774367.tmp com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 362.41us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 612.15us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 315.37us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 343.05us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 410.00us C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 556.37us C=2999;I=0;M=1;ScE=0;R=0.0 AlignmentTime = 693.49us C=2997;I=0;M=2;ScE=0;R=0.0 AlignmentTime = 823.30us com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1719 Cluster 0: Q 27 -> T 15 - -12 Q 36 -> T 25 - -11 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1260 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 183 -> T 147 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 289 noHits2: 0 noHits3: 0 wrongTopHit: 56 wrongTopHitS: 35 noCorrectHitInList: 27 Timings: DescriptiveStatistics: n: 100000 min: 15749.0 max: 5.63957898E8 mean: 289387.37057004153 std dev: 4109916.7938129683 median: 209996.0 skewness: 105.71893038792882 kurtosis: 11964.033387324029 Clusters basicSize DescriptiveStatistics: n: 99655 min: 1.0 max: 6.0 mean: 2.848216346395056 std dev: 1.1098572765623802 median: 3.0 skewness: 0.31256210244352367 kurtosis: -0.6859910518388515 Top Delta DescriptiveStatistics: n: 99684 min: -20.0 max: 0.0 mean: -0.0012138357208783402 std dev: 0.13867043209724092 median: 0.0 skewness: -119.47840589166229 kurtosis: 14855.225141761506 com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4970 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED Gradle is still running, please be patient... com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 3.21ms Processed queries: 15 Bad percent: 0.0 False positive percent: 0.8111615833874107 Scoring error percent: 0.0 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 7.17us 6.76us 4.78us com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1669 rTrimmed = 1711 lTrimmed = 2789 rTrimmed = 2814 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99947 elements with 366.06KiB in raw nucleotide entropy serialized into 272.88KiB com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 54 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 628 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2474 com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_e9ec15b3f46c9d5d444da88e38f256fa875f12398647902494266400749.fasta: 0% Indexing milib_e9ec15b3f46c9d5d444da88e38f256fa875f12398647902494266400749.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_e9ec15b3f46c9d5d444da88e38f256fa875f12398647902494266400749.fasta: 0% Indexing milib_e9ec15b3f46c9d5d444da88e38f256fa875f12398647902494266400749.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_7cfb72f7a5b3cf100b4dc297ebebde48b59ef7933723865382438298900.tmp: 0% Indexing milib_7cfb72f7a5b3cf100b4dc297ebebde48b59ef7933723865382438298900.tmp: 96.8% Indexing milib_7cfb72f7a5b3cf100b4dc297ebebde48b59ef7933723865382438298900.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT CTCGAGAGACAAATAGAGGTCTTCGCCACCGTAAGTTCTCTGGGCACAGCTTCCGTTGATGTCCTCAATACGGAAGCTCGGCAGTGAATGCCGACCCCGACTGGGAGAGGACAGCAGCTCTTGGCGGGTACTATGACGAGATTAAGGGTAAACAGAATCTCCGCCGCAAATCGGCAAAAGGTCTTGTTGGTTCGGATAGGGAAGTTGCGCGTATTGTAACTGATAGGTAGAAGCATAATGCAAATACCCCCCAACCTGCATCCGTGACGGGAAGCTCCAAATAATACGATTCACGTACATCAGGGTCAGGTGTTCGCTGATGAGTTTCACATTTTCATTCCCTTTTGTTTTATGACCTCCGAACTGTTAAGGGGGAACTTAAGTGAGTGTCATTATACGACCGCCTGAACCCCATCAATACGTGGAGGGCCAAACCGTACTTACCAACGACTGTACTGAAGCATCATATGCCACTCTATAAGAAGATTCTACTCGACACCTTTTTGAAGCCGAGATTCGCACCCCTCCAAGACCATCAATTGCCGGCTCGCCTTCTTACGGTTGATGTACGATGCCCCAGCAGTAGGGTACACATCGGTAAGACCGCATACCTGGGCAGCTACCGTACAGACGCCCGCGTTTGAAGTCGATGTCCGAGATAATGCGAAAATCTGGGGTGTCTGGACAGTGGTT CGTCGAGTTACAAATAGGGGTCTTCGCCACCGTAATTCTCTGGGCACAGCTTCCTCTGATGTCTCTCATACGGAGCTCGGCAGTAATGCCGACCCGACCAGGGAGGAGGACAGCATGCTCTTGGCGGGTCTCTATAGAGATTAAGGGTAAACAGAATCTCCTCCGCATGTCTGCAAAGTCTTGTTGGTTGGATAGGAAGTTGCGCGTATTGTAACTGTATGTAGAAGCATAATGCAAATACCCCCCAGCCTGCATCCGGTGACGGGAAGCTCCAAATAATACGATATCACGGTACATCAGGGCAGTATTCGCTAAGTTTCGACATTTTCATTCCCTTTTGTTTTTGCCTCCCGAACTGTTAAGGGGAACTTAAGGTGTGTCATTATACGACCGCCTGAACCCCGTCATACGGAGGCAAACGTACTTACCACACGACTGTACTGAGCATCAATGCCACTCTATAAGAAGATTCTACTCGACACCTTTTTGAAGCCGAATCGCACCCTCAAGACCATCAATGCCGGCTCCCTTCTTACGGTTGATTACGATGCCCCAGCGAGGGTACACATCGGTAAGACCGCATACCTGGGCAGCTACCGTACATACGCCCGCGTTTGAGTCGATCCGAATAATGCGAAAATCTGGGGTGTCTGGACAGTGGTT GTCAGAGTTACAAATAGGGGTCTTCTCCACCGTAATTCTCGGCACGCTCCTCTATGCTCGTATACGGAGCTTCGGCAGTAGTGTCCGACCCGACCAGGGAGGAGGACAGCATGCTCTTGGCGGTCTCTATAGAGATTAAGGGTAAACAGAATCTCCTCCGCATTCTGCAAAGTCGTTTTTGGTTGGATAGGAGTTGCGTGTTTGTAACTGTATGTAGGAGCAAATGCAAATACCCCCAGCTGCATCTGTGACGGGCAGCTCCAAATAATACGATATCACGGTCATCGGGCAGTATTCAGCTAAGTTTCGACATTTTCTTCTTTGTTTTTGCCTCCCGAACTGTTAAGGGCGAACTTAAGGTGTGTCATTATACGACGCTGAACCCCGTCAGACGGAGGCAAACGTATCTTAACCACACGATTGTACTGAGCATCAATGCCATCTATAAGAAGATTCACTCGACATCTTTTGCAGCTGGATCGCACCCTCAGGACCATCAAGCCGGCTCCCTCTTACTTTATTACGTGCCCCAGCGAGGGTACACAATCGGTAAGACCGCATACCTGGGCAGCTACTCACACATAGCACCCGCGTTTGAGTTGTTCCGAGTAATGCGAAATCTTGGTGTCTGACAGTGGTT 0 GTC-AGAGTTACAAATAGGGGTCTTCTCCACCGTAA-TTCTC--GGCAC-GC-TCC-TCT-ATG--CTCGTATACGG-AGCTTCGGCAGT-AGTGTCCGA-CCCGACCAGGGAGGAGGACAGCATGCTCTTGGC-GGTCTCTAT-A-GAGATTAAGGGTAAACAGAATCTCCTCCGC-ATTCTGC-AAA-GTCGTTTTTGGTT-GGATA-GG-AGTTGCGTGT-TTGTAACTG-TATGTAGGAGCA-AATGCAAATA-CCCCC-AGCTGCATCTGTGACGGGCAGCTCCAAATAATACGATATCACGGT-CATC-GGG-CA-GTATTCAGCT-A--AGTTTCGACATTTTC-TT--C-TTTGTTTT-TG-CCTCCCGAACTGTTAAGGGCGAACTTAAG-GTGTGTCATTATACGA-CG-CTGAACCCCGTC-AGAC--GGA-GG-CAAA-CGTATCTTAACCACACGATTGTACTG-AGCATCA-ATGCCA-TCTATAAGAAGATTC-ACTCGACATC-TTTTGCAGCTG-GA-TCGCA-CCCT-CAGGACCATCAA--GCCGGCTC-CC-TCTTAC--TTTAT-TACG-TGCCCCAGC-G-AGGGTACACAATCGGTAAGACCGCATACCTGGGCAGCTACTCACACATAGCACCCGCGTTTG-AGTTG-T-TCCGAG-TAATGCG-AAATCT-TGGTGTCT-GACAGTGGTT 639 || |||| |||||||| ||||||| ||||||||| ||||| ||||| || ||| | | ||| ||| |||||| ||| |||||||| | || |||| ||||| | |||| |||||||||| ||||||||| ||| |||| | ||||||||||||||||||||||||| |||| | || || ||| ||| || |||||| ||||| || ||||||| || ||||||||| || |||| |||| |||||||||| ||||| | ||||||| |||||||| |||||||||||||||||| |||| || |||| ||| || || ||| ||| | |||||| |||||||| || | |||||||| || ||| ||||||||||||||| ||||||||| | |||||||||||||| || ||||||||| || | || ||| || |||| |||| ||| |||| |||| ||||||| ||||||| |||||| ||||||||||||||| |||||||| | ||||| ||| | || ||||| |||| || ||||||||| |||||||| || |||||| || || |||| ||||||||| | ||||||||| |||||||||||||||||||||||||||||| | ||| | | |||||||||| ||| | | |||||| ||||||| |||||| ||||||| |||||||||| 0 CTCGAGAG--ACAAATAGAGGTCTTCGCCACCGTAAGTTCTCTGGGCACAGCTTCCGT-TGATGTCCTC-AATACGGAAGC-TCGGCAGTGAATG-CCGACCCCGA-CTGGGA-GAGGACAGCA-GCTCTTGGCGGGT-ACTATGACGAGATTAAGGGTAAACAGAATCTCCGCCGCAAATCGGCAAAAGGTC-TTGTTGGTTCGGATAGGGAAGTTGCGCGTATTGTAACTGATAGGTAGAAGCATAATGCAAATACCCCCCAACCTGCATCCGTGACGGGAAGCTCCAAATAATACGAT-TCAC-GTACATCAGGGTCAGGTGTTC-GCTGATGAGTTTC-ACATTTTCATTCCCTTTTGTTTTATGACCT-CCGAACTGTTAAGGGGGAACTTAAGTGAGTGTCATTATACGACCGCCTGAACCCCATCAATACGTGGAGGGCCAAACCGTA-CTT-ACCA-ACGACTGTACTGAAGCATCATATGCCACTCTATAAGAAGATTCTACTCGACACCTTTTTGAAGCCGAGATTCGCACCCCTCCAAGACCATCAATTGCCGGCTCGCCTTCTTACGGTTGATGTACGATGCCCCAGCAGTAGGGTACAC-ATCGGTAAGACCGCATACCTGGGCAGCTAC-CGTACAGA-CGCCCGCGTTTGAAGTCGATGTCCGAGATAATGCGAAAATCTGGGGTGTCTGGACAGTGGTT 692 [I3:G,I3:A,D6:A,D7:G,I40:T,S40:T->G,D41:G,I50:T,D51:T,I61:T,I61:C,S61:T->C,S62:C->T,S64:T->A,D65:C,D66:A,I73:A,D74:A,I94:C,D95:C,D100:C,S101:T->C,I102:T,I125:G,D126:G,I167:A,D169:A,I175:A,D177:A,I179:G,D180:G,I198:G,D199:G,I201:A,D202:A,I246:C,D250:C,I252:A,S253:A->C,D254:C,I301:A,S301:A->G,S304:G->T,D305:T,I320:T,S320:T->G,D321:G,I339:C,I339:C,S340:C->T,D341:C,D345:T,D358:C,I360:C,I400:C,D401:C,I416:A,D417:A,I421:G,I421:T,D422:T,D423:G,I426:G,S428:G->C,D429:C,I434:C,D435:C,I458:A,D459:A,I500:T,D504:T,I512:A,S512:A->G,D513:G,I539:T,D540:T,I559:G,I559:G,S559:G->T,D560:G,S562:T->G,D563:G,I643:A,D644:A,I649:A,S649:A->T,S650:T->G,D651:G,D657:G,S658:A->G,I659:A,I673:G,D674:G] 0 CTC--GAGAGACAAATAGAGGTCTTCGCCACCGTAAGTTCTC-TGGGCACAGC-TTCCGTTGATG--TCCTCAATACGG-AAGCTCGGCAGTGAATGCCGA-CCCCGACT-GGGAGAGGACAGCAGCTCTTGGC-GGGTACTATGACGAGATTAAGGGTAAACAGAATCTCCGCCGC-AAATCGGC-AAAA-GGTCTTGTTGGTTCGGATA-GGG-AAGTTGCGCGTATTGTAACTGATAGGTAGAAGCATAATGCAAATA-CCCCCC-AACCTGCATCCGTGACGGGAAGCTCCAAATAATACGATTCACGTACATC-AGGGTCAGGTGTTCGCTGA-TGAGTTTCACATTTTCATT--CCCTTTTGTTTTATGACCTCC-GAACTGTTAAGGGGGAACTTAAGTGAGTGTCATTATACGA-CCGCCTGAACCCCATC-AATAC--GTGGA-GGGCCAAA-CCGTACTTACCAACGACTGTACTG-AAGCATCATATGCCACTCTATAAGAAGATTCTACTCGACACC-TTTTTGAAGCCG-AGATTCGCACCCCTCCAAGACCATCAA-TTGCCGGCTCGCCTTCTTAC--GGTTGATGTACGATGCCCCAGCAGTAGGGTACACATCGGTAAGACCGCATACCTGGGCAGCTACCGTACAGACGCCCGCGTTTG-AAGTCG-ATGTCCGAGA-TAATGCGAAAATCT-GGGGTGTCTGGACAGTGGTT 692 ||| ||| |||||||||||||||||||||||||||||||| |||||||| | ||||||||| | |||||| | ||||||||||||||||||| | |||| ||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||| || ||||| || | | ||||||||||||||||| | | | ||||||||||||||||||||||||||||||||||||||||||| |||| | | |||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||| ||||||||||||||||| | ||| |||||||||||| | |||||||||||||||||||||||||||||||||||||||| | |||||||||||||| | ||| | || || |||| | |||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||| |||| ||||||| ||||||||||||||||||||||||| | |||||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||| ||||| |||||||||||||| | |||||||||||||||||| 0 CTCGAGAG--ACAAATAGAGGTCTTCGCCACCGTAAGTTCTCTG-GGCACAGCTT-CCGTTGATGTCCTCA--ATACGGAA-GCTCGGCAGTGAATGCCGACC-CCGA-CTGGGAGAGGACAGCAGCTCTTGGCGG-GTACTATGACGAGATTAAGGGTAAACAGAATCTCCGCCGCAAA-TCGGCAAA-AGG-TCTTGTTGGTTCGGATAGG-GAA-GTTGCGCGTATTGTAACTGATAGGTAGAAGCATAATGCAAATACCCCC-CAAC-CTGCATCCGTGACGGGAAGCTCCAAATAATACGATTCACGTACATCAGGGT-CAGGTGTTCGCTGATG-AGTTTCACATTTTCATTCCCT-TTT-GTTTTATGACCT-CCGAACTGTTAAGGGGGAACTTAAGTGAGTGTCATTATACGACC-GCCTGAACCCCATCAA-TACGTG--GAGGGC-CAAACC-GTACTTACCAACGACTGTACTGAA-GCATCATATGCCACTCTATAAGAAGATTCTACTCGACACCTTTTT-GAAGCCGAG-ATTCGCACCCCTCCAAGACCATCAATT-GCCGGCTCGCCTTCTTACGGT-TG-ATGTACGATGCCCCAGCAGTAGGGTACACATCGGTAAGACCGCATACCTGGGCAGCTACCGTACAGACGCCCGCGTTTGAA-GTCGATG-TCCGA-GATAATGCGAAAATCTGG-GGTGTCTGGACAGTGGTT 692 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 Gradle Test Executor 1 finished executing tests. Finished generating test XML results (2.319 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (3.913 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[#42,Task worker for ':' Thread 2,5,main]) completed. Took 13 mins 15.991 secs. BUILD SUCCESSFUL in 15m 8s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath Duplicate specification "version|V" for option "V" jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_armhf.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_armhf.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/16883 and its subdirectories I: Current time: Sat Jan 25 02:11:38 -12 2025 I: pbuilder-time-stamp: 1737814298