I: pbuilder: network access will be disabled during build I: Current time: Mon Sep 7 07:48:29 -12 2026 I: pbuilder-time-stamp: 1788810509 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/unstable-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [varnish_7.7.0-3.dsc] I: copying [./varnish_7.7.0.orig.tar.xz] I: copying [./varnish_7.7.0-3.debian.tar.xz] I: Extracting source dpkg-source: warning: cannot verify inline signature for ./varnish_7.7.0-3.dsc: no acceptable signature found dpkg-source: info: extracting varnish in varnish-7.7.0 dpkg-source: info: unpacking varnish_7.7.0.orig.tar.xz dpkg-source: info: unpacking varnish_7.7.0-3.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying set_vcs_version dpkg-source: info: applying skip_tests dpkg-source: warning: diff 'varnish-7.7.0/debian/patches/fix_vsv16' patches file varnish-7.7.0/bin/varnishd/http1/cache_http1_vfp.c more than once dpkg-source: info: applying fix_vsv16 I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/3540360/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build/reproducible-path' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='amd64' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=42 ' DISTRIBUTION='unstable' HOME='/root' HOST_ARCH='amd64' IFS=' ' INVOCATION_ID='545535c0bc984cbb876aaa1b172edbfd' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='3540360' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.gCn0azF0/pbuilderrc_UzJs --distribution unstable --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/unstable-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.gCn0azF0/b1 --logfile b1/build.log varnish_7.7.0-3.dsc' SUDO_GID='111' SUDO_UID='106' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://213.165.73.152:3128' I: uname -a Linux ionos15-amd64 6.12.33+deb12-amd64 #1 SMP PREEMPT_DYNAMIC Debian 6.12.33-1~bpo12+1 (2025-07-09) x86_64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 May 12 2025 /bin -> usr/bin I: user script /srv/workspace/pbuilder/3540360/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: amd64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: automake, debhelper-compat (= 13), debhelper (>= 13.9), dh-sequence-installsysusers, graphviz, libedit-dev, libjemalloc-dev, libncurses-dev, libpcre2-dev, libtool, pkgconf, python3-sphinx:native, xsltproc dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19850 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on automake; however: Package automake is not installed. pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on debhelper (>= 13.9); however: Package debhelper is not installed. pbuilder-satisfydepends-dummy depends on dh-sequence-installsysusers; however: Package dh-sequence-installsysusers is not installed. pbuilder-satisfydepends-dummy depends on graphviz; however: Package graphviz is not installed. pbuilder-satisfydepends-dummy depends on libedit-dev; however: Package libedit-dev is not installed. pbuilder-satisfydepends-dummy depends on libjemalloc-dev; however: Package libjemalloc-dev is not installed. pbuilder-satisfydepends-dummy depends on libncurses-dev; however: Package libncurses-dev is not installed. pbuilder-satisfydepends-dummy depends on libpcre2-dev; however: Package libpcre2-dev is not installed. pbuilder-satisfydepends-dummy depends on libtool; however: Package libtool is not installed. pbuilder-satisfydepends-dummy depends on pkgconf; however: Package pkgconf is not installed. pbuilder-satisfydepends-dummy depends on python3-sphinx:native. pbuilder-satisfydepends-dummy depends on xsltproc; however: Package xsltproc is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: autoconf{a} automake{a} autopoint{a} autotools-dev{a} bsdextrautils{a} ca-certificates{a} debhelper{a} dh-autoreconf{a} dh-strip-nondeterminism{a} docutils-common{a} dwz{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} graphviz{a} groff-base{a} intltool-debian{a} libabsl20240722{a} libann0{a} libaom3{a} libarchive-zip-perl{a} libavif16{a} libbrotli1{a} libbsd-dev{a} libcairo2{a} libcdt5{a} libcgraph6{a} libdatrie1{a} libdav1d7{a} libde265-0{a} libdebhelper-perl{a} libdeflate0{a} libedit-dev{a} libedit2{a} libelf1t64{a} libexpat1{a} libffi8{a} libfile-stripnondeterminism-perl{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgav1-1{a} libgcrypt20{a} libgd3{a} libglib2.0-0t64{a} libgpg-error0{a} libgraphite2-3{a} libgts-0.7-5t64{a} libgvc6{a} libgvpr2{a} libharfbuzz0b{a} libheif-plugin-dav1d{a} libheif-plugin-libde265{a} libheif1{a} libice6{a} libimagequant0{a} libjbig0{a} libjemalloc-dev{a} libjemalloc2{a} libjpeg62-turbo{a} libjs-jquery{a} libjs-sphinxdoc{a} libjs-underscore{a} libjson-perl{a} liblab-gamut1{a} liblerc4{a} libltdl7{a} libmagic-mgc{a} libmagic1t64{a} libmd-dev{a} libncurses-dev{a} libncurses6{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libpathplan4{a} libpcre2-16-0{a} libpcre2-32-0{a} libpcre2-dev{a} libpcre2-posix3{a} libpipeline1{a} libpixman-1-0{a} libpkgconf3{a} libpng16-16t64{a} libpython3-stdlib{a} libpython3.13-minimal{a} libpython3.13-stdlib{a} librav1e0.7{a} libreadline8t64{a} libsharpyuv0{a} libsm6{a} libsvtav1enc2{a} libthai-data{a} libthai0{a} libtiff6{a} libtool{a} libuchardet0{a} libunistring5{a} libwebp7{a} libx11-6{a} libx11-data{a} libxau6{a} libxaw7{a} libxcb-render0{a} libxcb-shm0{a} libxcb1{a} libxdmcp6{a} libxext6{a} libxml2{a} libxmu6{a} libxpm4{a} libxrender1{a} libxslt1.1{a} libxt6t64{a} libyuv0{a} m4{a} man-db{a} media-types{a} netbase{a} openssl{a} pkgconf{a} pkgconf-bin{a} po-debconf{a} python-babel-localedata{a} python3{a} python3-alabaster{a} python3-babel{a} python3-certifi{a} python3-chardet{a} python3-charset-normalizer{a} python3-defusedxml{a} python3-docutils{a} python3-idna{a} python3-imagesize{a} python3-jinja2{a} python3-markupsafe{a} python3-minimal{a} python3-packaging{a} python3-pygments{a} python3-requests{a} python3-roman{a} python3-snowballstemmer{a} python3-sphinx{a} python3-urllib3{a} python3.13{a} python3.13-minimal{a} readline-common{a} sensible-utils{a} sgml-base{a} sphinx-common{a} tzdata{a} x11-common{a} xml-core{a} xsltproc{a} The following packages are RECOMMENDED but will NOT be installed: curl fonts-liberation javascript-common libarchive-cpio-perl libglib2.0-data libgpg-error-l10n libgpm2 libgts-bin libheif-plugin-aomenc libheif-plugin-x265 libjson-xs-perl libltdl-dev libmail-sendmail-perl libpaper-utils lynx python3-pil shared-mime-info wget xdg-user-dirs 0 packages upgraded, 158 newly installed, 0 to remove and 0 not upgraded. Need to get 55.1 MB of archives. After unpacking 202 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian unstable/main amd64 libexpat1 amd64 2.7.1-2 [108 kB] Get: 2 http://deb.debian.org/debian unstable/main amd64 libpython3.13-minimal amd64 3.13.5-2 [862 kB] Get: 3 http://deb.debian.org/debian unstable/main amd64 python3.13-minimal amd64 3.13.5-2 [2224 kB] Get: 4 http://deb.debian.org/debian unstable/main amd64 python3-minimal amd64 3.13.5-1 [27.2 kB] Get: 5 http://deb.debian.org/debian unstable/main amd64 media-types all 13.0.0 [29.3 kB] Get: 6 http://deb.debian.org/debian unstable/main amd64 netbase all 6.5 [12.4 kB] Get: 7 http://deb.debian.org/debian unstable/main amd64 tzdata all 2025b-4 [260 kB] Get: 8 http://deb.debian.org/debian unstable/main amd64 libffi8 amd64 3.4.8-2 [24.1 kB] Get: 9 http://deb.debian.org/debian unstable/main amd64 readline-common all 8.2-6 [69.4 kB] Get: 10 http://deb.debian.org/debian unstable/main amd64 libreadline8t64 amd64 8.2-6 [169 kB] Get: 11 http://deb.debian.org/debian unstable/main amd64 libpython3.13-stdlib amd64 3.13.5-2 [1956 kB] Get: 12 http://deb.debian.org/debian unstable/main amd64 python3.13 amd64 3.13.5-2 [757 kB] Get: 13 http://deb.debian.org/debian unstable/main amd64 libpython3-stdlib amd64 3.13.5-1 [10.2 kB] Get: 14 http://deb.debian.org/debian unstable/main amd64 python3 amd64 3.13.5-1 [28.2 kB] Get: 15 http://deb.debian.org/debian unstable/main amd64 sensible-utils all 0.0.25 [25.0 kB] Get: 16 http://deb.debian.org/debian unstable/main amd64 openssl amd64 3.5.1-1 [1494 kB] Get: 17 http://deb.debian.org/debian unstable/main amd64 ca-certificates all 20250419 [162 kB] Get: 18 http://deb.debian.org/debian unstable/main amd64 libmagic-mgc amd64 1:5.46-5 [338 kB] Get: 19 http://deb.debian.org/debian unstable/main amd64 libmagic1t64 amd64 1:5.46-5 [109 kB] Get: 20 http://deb.debian.org/debian unstable/main amd64 file amd64 1:5.46-5 [43.6 kB] Get: 21 http://deb.debian.org/debian unstable/main amd64 gettext-base amd64 0.23.1-2 [243 kB] Get: 22 http://deb.debian.org/debian unstable/main amd64 libuchardet0 amd64 0.0.8-1+b2 [68.9 kB] Get: 23 http://deb.debian.org/debian unstable/main amd64 groff-base amd64 1.23.0-9 [1187 kB] Get: 24 http://deb.debian.org/debian unstable/main amd64 bsdextrautils amd64 2.41-5 [94.6 kB] Get: 25 http://deb.debian.org/debian unstable/main amd64 libpipeline1 amd64 1.5.8-1 [42.0 kB] Get: 26 http://deb.debian.org/debian unstable/main amd64 man-db amd64 2.13.1-1 [1469 kB] Get: 27 http://deb.debian.org/debian unstable/main amd64 m4 amd64 1.4.19-8 [294 kB] Get: 28 http://deb.debian.org/debian unstable/main amd64 autoconf all 2.72-3.1 [494 kB] Get: 29 http://deb.debian.org/debian unstable/main amd64 autotools-dev all 20240727.1 [60.2 kB] Get: 30 http://deb.debian.org/debian unstable/main amd64 automake all 1:1.17-4 [862 kB] Get: 31 http://deb.debian.org/debian unstable/main amd64 autopoint all 0.23.1-2 [770 kB] Get: 32 http://deb.debian.org/debian unstable/main amd64 libdebhelper-perl all 13.24.2 [90.9 kB] Get: 33 http://deb.debian.org/debian unstable/main amd64 libtool all 2.5.4-4 [539 kB] Get: 34 http://deb.debian.org/debian unstable/main amd64 dh-autoreconf all 20 [17.1 kB] Get: 35 http://deb.debian.org/debian unstable/main amd64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 36 http://deb.debian.org/debian unstable/main amd64 libfile-stripnondeterminism-perl all 1.14.1-2 [19.7 kB] Get: 37 http://deb.debian.org/debian unstable/main amd64 dh-strip-nondeterminism all 1.14.1-2 [8620 B] Get: 38 http://deb.debian.org/debian unstable/main amd64 libelf1t64 amd64 0.192-4 [189 kB] Get: 39 http://deb.debian.org/debian unstable/main amd64 dwz amd64 0.15-1+b1 [110 kB] Get: 40 http://deb.debian.org/debian unstable/main amd64 libunistring5 amd64 1.3-2 [477 kB] Get: 41 http://deb.debian.org/debian unstable/main amd64 libxml2 amd64 2.12.7+dfsg+really2.9.14-2.1 [698 kB] Get: 42 http://deb.debian.org/debian unstable/main amd64 gettext amd64 0.23.1-2 [1680 kB] Get: 43 http://deb.debian.org/debian unstable/main amd64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 44 http://deb.debian.org/debian unstable/main amd64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 45 http://deb.debian.org/debian unstable/main amd64 debhelper all 13.24.2 [919 kB] Get: 46 http://deb.debian.org/debian unstable/main amd64 sgml-base all 1.31+nmu1 [10.9 kB] Get: 47 http://deb.debian.org/debian unstable/main amd64 xml-core all 0.19 [20.1 kB] Get: 48 http://deb.debian.org/debian unstable/main amd64 docutils-common all 0.21.2+dfsg-2 [128 kB] Get: 49 http://deb.debian.org/debian unstable/main amd64 libbrotli1 amd64 1.1.0-2+b7 [307 kB] Get: 50 http://deb.debian.org/debian unstable/main amd64 libpng16-16t64 amd64 1.6.48-1 [282 kB] Get: 51 http://deb.debian.org/debian unstable/main amd64 libfreetype6 amd64 2.13.3+dfsg-1 [452 kB] Get: 52 http://deb.debian.org/debian unstable/main amd64 fonts-dejavu-mono all 2.37-8 [489 kB] Get: 53 http://deb.debian.org/debian unstable/main amd64 fonts-dejavu-core all 2.37-8 [840 kB] Get: 54 http://deb.debian.org/debian unstable/main amd64 fontconfig-config amd64 2.15.0-2.3 [318 kB] Get: 55 http://deb.debian.org/debian unstable/main amd64 libfontconfig1 amd64 2.15.0-2.3 [392 kB] Get: 56 http://deb.debian.org/debian unstable/main amd64 fontconfig amd64 2.15.0-2.3 [463 kB] Get: 57 http://deb.debian.org/debian unstable/main amd64 libann0 amd64 1.1.2+doc-9+b1 [25.1 kB] Get: 58 http://deb.debian.org/debian unstable/main amd64 libcdt5 amd64 2.42.4-3 [40.3 kB] Get: 59 http://deb.debian.org/debian unstable/main amd64 libcgraph6 amd64 2.42.4-3 [64.0 kB] Get: 60 http://deb.debian.org/debian unstable/main amd64 libaom3 amd64 3.12.1-1 [1871 kB] Get: 61 http://deb.debian.org/debian unstable/main amd64 libdav1d7 amd64 1.5.1-1 [559 kB] Get: 62 http://deb.debian.org/debian unstable/main amd64 libabsl20240722 amd64 20240722.0-4 [492 kB] Get: 63 http://deb.debian.org/debian unstable/main amd64 libgav1-1 amd64 0.19.0-3+b1 [353 kB] Get: 64 http://deb.debian.org/debian unstable/main amd64 librav1e0.7 amd64 0.7.1-9+b2 [946 kB] Get: 65 http://deb.debian.org/debian unstable/main amd64 libsvtav1enc2 amd64 2.3.0+dfsg-1 [2489 kB] Get: 66 http://deb.debian.org/debian unstable/main amd64 libjpeg62-turbo amd64 1:2.1.5-4 [168 kB] Get: 67 http://deb.debian.org/debian unstable/main amd64 libyuv0 amd64 0.0.1904.20250204-1 [174 kB] Get: 68 http://deb.debian.org/debian unstable/main amd64 libavif16 amd64 1.2.1-1.2 [133 kB] Get: 69 http://deb.debian.org/debian unstable/main amd64 libsharpyuv0 amd64 1.5.0-0.1 [116 kB] Get: 70 http://deb.debian.org/debian unstable/main amd64 libheif-plugin-dav1d amd64 1.19.8-1 [11.7 kB] Get: 71 http://deb.debian.org/debian unstable/main amd64 libde265-0 amd64 1.0.16-1 [189 kB] Get: 72 http://deb.debian.org/debian unstable/main amd64 libheif-plugin-libde265 amd64 1.19.8-1 [15.3 kB] Get: 73 http://deb.debian.org/debian unstable/main amd64 libheif1 amd64 1.19.8-1 [520 kB] Get: 74 http://deb.debian.org/debian unstable/main amd64 libimagequant0 amd64 2.18.0-1+b2 [35.2 kB] Get: 75 http://deb.debian.org/debian unstable/main amd64 libdeflate0 amd64 1.23-2 [47.3 kB] Get: 76 http://deb.debian.org/debian unstable/main amd64 libjbig0 amd64 2.1-6.1+b2 [32.1 kB] Get: 77 http://deb.debian.org/debian unstable/main amd64 liblerc4 amd64 4.0.0+ds-5 [183 kB] Get: 78 http://deb.debian.org/debian unstable/main amd64 libwebp7 amd64 1.5.0-0.1 [318 kB] Get: 79 http://deb.debian.org/debian unstable/main amd64 libtiff6 amd64 4.7.0-3 [346 kB] Get: 80 http://deb.debian.org/debian unstable/main amd64 libxau6 amd64 1:1.0.11-1 [20.4 kB] Get: 81 http://deb.debian.org/debian unstable/main amd64 libxdmcp6 amd64 1:1.1.5-1 [27.8 kB] Get: 82 http://deb.debian.org/debian unstable/main amd64 libxcb1 amd64 1.17.0-2+b1 [144 kB] Get: 83 http://deb.debian.org/debian unstable/main amd64 libx11-data all 2:1.8.12-1 [343 kB] Get: 84 http://deb.debian.org/debian unstable/main amd64 libx11-6 amd64 2:1.8.12-1 [815 kB] Get: 85 http://deb.debian.org/debian unstable/main amd64 libxpm4 amd64 1:3.5.17-1+b3 [56.2 kB] Get: 86 http://deb.debian.org/debian unstable/main amd64 libgd3 amd64 2.3.3-13 [126 kB] Get: 87 http://deb.debian.org/debian unstable/main amd64 libglib2.0-0t64 amd64 2.84.3-1 [1515 kB] Get: 88 http://deb.debian.org/debian unstable/main amd64 libgts-0.7-5t64 amd64 0.7.6+darcs121130-5.2+b1 [160 kB] Get: 89 http://deb.debian.org/debian unstable/main amd64 libpixman-1-0 amd64 0.44.0-3 [248 kB] Get: 90 http://deb.debian.org/debian unstable/main amd64 libxcb-render0 amd64 1.17.0-2+b1 [115 kB] Get: 91 http://deb.debian.org/debian unstable/main amd64 libxcb-shm0 amd64 1.17.0-2+b1 [105 kB] Get: 92 http://deb.debian.org/debian unstable/main amd64 libxext6 amd64 2:1.3.4-1+b3 [50.4 kB] Get: 93 http://deb.debian.org/debian unstable/main amd64 libxrender1 amd64 1:0.9.12-1 [27.9 kB] Get: 94 http://deb.debian.org/debian unstable/main amd64 libcairo2 amd64 1.18.4-1+b1 [538 kB] Get: 95 http://deb.debian.org/debian unstable/main amd64 libltdl7 amd64 2.5.4-4 [416 kB] Get: 96 http://deb.debian.org/debian unstable/main amd64 libfribidi0 amd64 1.0.16-1 [26.5 kB] Get: 97 http://deb.debian.org/debian unstable/main amd64 libgraphite2-3 amd64 1.3.14-2+b1 [75.4 kB] Get: 98 http://deb.debian.org/debian unstable/main amd64 libharfbuzz0b amd64 10.2.0-1+b1 [479 kB] Get: 99 http://deb.debian.org/debian unstable/main amd64 libthai-data all 0.1.29-2 [168 kB] Get: 100 http://deb.debian.org/debian unstable/main amd64 libdatrie1 amd64 0.2.13-4 [38.0 kB] Get: 101 http://deb.debian.org/debian unstable/main amd64 libthai0 amd64 0.1.29-2+b1 [49.4 kB] Get: 102 http://deb.debian.org/debian unstable/main amd64 libpango-1.0-0 amd64 1.56.3-1 [226 kB] Get: 103 http://deb.debian.org/debian unstable/main amd64 libpangoft2-1.0-0 amd64 1.56.3-1 [55.6 kB] Get: 104 http://deb.debian.org/debian unstable/main amd64 libpangocairo-1.0-0 amd64 1.56.3-1 [35.7 kB] Get: 105 http://deb.debian.org/debian unstable/main amd64 libpathplan4 amd64 2.42.4-3 [42.6 kB] Get: 106 http://deb.debian.org/debian unstable/main amd64 libgvc6 amd64 2.42.4-3 [686 kB] Get: 107 http://deb.debian.org/debian unstable/main amd64 libgvpr2 amd64 2.42.4-3 [192 kB] Get: 108 http://deb.debian.org/debian unstable/main amd64 liblab-gamut1 amd64 2.42.4-3 [198 kB] Get: 109 http://deb.debian.org/debian unstable/main amd64 x11-common all 1:7.7+24 [217 kB] Get: 110 http://deb.debian.org/debian unstable/main amd64 libice6 amd64 2:1.1.1-1 [65.4 kB] Get: 111 http://deb.debian.org/debian unstable/main amd64 libsm6 amd64 2:1.2.6-1 [37.3 kB] Get: 112 http://deb.debian.org/debian unstable/main amd64 libxt6t64 amd64 1:1.2.1-1.2+b2 [188 kB] Get: 113 http://deb.debian.org/debian unstable/main amd64 libxmu6 amd64 2:1.1.3-3+b4 [59.0 kB] Get: 114 http://deb.debian.org/debian unstable/main amd64 libxaw7 amd64 2:1.0.16-1 [212 kB] Get: 115 http://deb.debian.org/debian unstable/main amd64 graphviz amd64 2.42.4-3 [621 kB] Get: 116 http://deb.debian.org/debian unstable/main amd64 libmd-dev amd64 1.1.0-2+b1 [55.3 kB] Get: 117 http://deb.debian.org/debian unstable/main amd64 libbsd-dev amd64 0.12.2-2 [258 kB] Get: 118 http://deb.debian.org/debian unstable/main amd64 libedit2 amd64 3.1-20250104-1 [93.8 kB] Get: 119 http://deb.debian.org/debian unstable/main amd64 libncurses6 amd64 6.5+20250216-2 [105 kB] Get: 120 http://deb.debian.org/debian unstable/main amd64 libncurses-dev amd64 6.5+20250216-2 [353 kB] Get: 121 http://deb.debian.org/debian unstable/main amd64 libedit-dev amd64 3.1-20250104-1 [115 kB] Get: 122 http://deb.debian.org/debian unstable/main amd64 libgpg-error0 amd64 1.51-4 [82.1 kB] Get: 123 http://deb.debian.org/debian unstable/main amd64 libgcrypt20 amd64 1.11.0-7 [843 kB] Get: 124 http://deb.debian.org/debian unstable/main amd64 libjemalloc2 amd64 5.3.0-3 [274 kB] Get: 125 http://deb.debian.org/debian unstable/main amd64 libjemalloc-dev amd64 5.3.0-3 [490 kB] Get: 126 http://deb.debian.org/debian unstable/main amd64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 127 http://deb.debian.org/debian unstable/main amd64 libjs-underscore all 1.13.4~dfsg+~1.11.4-3 [116 kB] Get: 128 http://deb.debian.org/debian unstable/main amd64 libjs-sphinxdoc all 8.1.3-5 [30.5 kB] Get: 129 http://deb.debian.org/debian unstable/main amd64 libjson-perl all 4.10000-1 [87.5 kB] Get: 130 http://deb.debian.org/debian unstable/main amd64 libpcre2-16-0 amd64 10.45-1 [281 kB] Get: 131 http://deb.debian.org/debian unstable/main amd64 libpcre2-32-0 amd64 10.45-1 [268 kB] Get: 132 http://deb.debian.org/debian unstable/main amd64 libpcre2-posix3 amd64 10.45-1 [63.5 kB] Get: 133 http://deb.debian.org/debian unstable/main amd64 libpcre2-dev amd64 10.45-1 [853 kB] Get: 134 http://deb.debian.org/debian unstable/main amd64 libpkgconf3 amd64 1.8.1-4 [36.4 kB] Get: 135 http://deb.debian.org/debian unstable/main amd64 libxslt1.1 amd64 1.1.35-1.2 [233 kB] Get: 136 http://deb.debian.org/debian unstable/main amd64 pkgconf-bin amd64 1.8.1-4 [30.2 kB] Get: 137 http://deb.debian.org/debian unstable/main amd64 pkgconf amd64 1.8.1-4 [26.2 kB] Get: 138 http://deb.debian.org/debian unstable/main amd64 python-babel-localedata all 2.17.0-1 [6050 kB] Get: 139 http://deb.debian.org/debian unstable/main amd64 python3-alabaster all 0.7.16-0.1 [27.9 kB] Get: 140 http://deb.debian.org/debian unstable/main amd64 python3-babel all 2.17.0-1 [117 kB] Get: 141 http://deb.debian.org/debian unstable/main amd64 python3-certifi all 2025.1.31+ds-1 [9652 B] Get: 142 http://deb.debian.org/debian unstable/main amd64 python3-chardet all 5.2.0+dfsg-2 [108 kB] Get: 143 http://deb.debian.org/debian unstable/main amd64 python3-charset-normalizer amd64 3.4.2-1 [128 kB] Get: 144 http://deb.debian.org/debian unstable/main amd64 python3-defusedxml all 0.7.1-3 [43.4 kB] Get: 145 http://deb.debian.org/debian unstable/main amd64 python3-roman all 5.0-1 [10.6 kB] Get: 146 http://deb.debian.org/debian unstable/main amd64 python3-docutils all 0.21.2+dfsg-2 [403 kB] Get: 147 http://deb.debian.org/debian unstable/main amd64 python3-idna all 3.10-1 [42.0 kB] Get: 148 http://deb.debian.org/debian unstable/main amd64 python3-imagesize all 1.4.1-1 [6688 B] Get: 149 http://deb.debian.org/debian unstable/main amd64 python3-markupsafe amd64 2.1.5-1+b3 [14.0 kB] Get: 150 http://deb.debian.org/debian unstable/main amd64 python3-jinja2 all 3.1.6-1 [107 kB] Get: 151 http://deb.debian.org/debian unstable/main amd64 python3-packaging all 25.0-1 [56.6 kB] Get: 152 http://deb.debian.org/debian unstable/main amd64 python3-pygments all 2.18.0+dfsg-2 [836 kB] Get: 153 http://deb.debian.org/debian unstable/main amd64 python3-urllib3 all 2.3.0-3 [115 kB] Get: 154 http://deb.debian.org/debian unstable/main amd64 python3-requests all 2.32.3+dfsg-5 [72.2 kB] Get: 155 http://deb.debian.org/debian unstable/main amd64 python3-snowballstemmer all 2.2.0-4 [58.0 kB] Get: 156 http://deb.debian.org/debian unstable/main amd64 sphinx-common all 8.1.3-5 [617 kB] Get: 157 http://deb.debian.org/debian unstable/main amd64 python3-sphinx all 8.1.3-5 [468 kB] Get: 158 http://deb.debian.org/debian unstable/main amd64 xsltproc amd64 1.1.35-1.2 [115 kB] Fetched 55.1 MB in 2s (25.6 MB/s) Preconfiguring packages ... Selecting previously unselected package libexpat1:amd64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19850 files and directories currently installed.) Preparing to unpack .../libexpat1_2.7.1-2_amd64.deb ... Unpacking libexpat1:amd64 (2.7.1-2) ... Selecting previously unselected package libpython3.13-minimal:amd64. Preparing to unpack .../libpython3.13-minimal_3.13.5-2_amd64.deb ... Unpacking libpython3.13-minimal:amd64 (3.13.5-2) ... Selecting previously unselected package python3.13-minimal. Preparing to unpack .../python3.13-minimal_3.13.5-2_amd64.deb ... Unpacking python3.13-minimal (3.13.5-2) ... Setting up libpython3.13-minimal:amd64 (3.13.5-2) ... Setting up libexpat1:amd64 (2.7.1-2) ... Setting up python3.13-minimal (3.13.5-2) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20184 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.13.5-1_amd64.deb ... Unpacking python3-minimal (3.13.5-1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_13.0.0_all.deb ... Unpacking media-types (13.0.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.5_all.deb ... Unpacking netbase (6.5) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2025b-4_all.deb ... Unpacking tzdata (2025b-4) ... Selecting previously unselected package libffi8:amd64. Preparing to unpack .../4-libffi8_3.4.8-2_amd64.deb ... Unpacking libffi8:amd64 (3.4.8-2) ... Selecting previously unselected package readline-common. Preparing to unpack .../5-readline-common_8.2-6_all.deb ... Unpacking readline-common (8.2-6) ... Selecting previously unselected package libreadline8t64:amd64. Preparing to unpack .../6-libreadline8t64_8.2-6_amd64.deb ... Adding 'diversion of /lib/x86_64-linux-gnu/libhistory.so.8 to /lib/x86_64-linux-gnu/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/x86_64-linux-gnu/libhistory.so.8.2 to /lib/x86_64-linux-gnu/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/x86_64-linux-gnu/libreadline.so.8 to /lib/x86_64-linux-gnu/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/x86_64-linux-gnu/libreadline.so.8.2 to /lib/x86_64-linux-gnu/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:amd64 (8.2-6) ... Selecting previously unselected package libpython3.13-stdlib:amd64. Preparing to unpack .../7-libpython3.13-stdlib_3.13.5-2_amd64.deb ... Unpacking libpython3.13-stdlib:amd64 (3.13.5-2) ... Selecting previously unselected package python3.13. Preparing to unpack .../8-python3.13_3.13.5-2_amd64.deb ... Unpacking python3.13 (3.13.5-2) ... Selecting previously unselected package libpython3-stdlib:amd64. Preparing to unpack .../9-libpython3-stdlib_3.13.5-1_amd64.deb ... Unpacking libpython3-stdlib:amd64 (3.13.5-1) ... Setting up python3-minimal (3.13.5-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 21199 files and directories currently installed.) Preparing to unpack .../000-python3_3.13.5-1_amd64.deb ... Unpacking python3 (3.13.5-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.25_all.deb ... Unpacking sensible-utils (0.0.25) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.5.1-1_amd64.deb ... Unpacking openssl (3.5.1-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20250419_all.deb ... Unpacking ca-certificates (20250419) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.46-5_amd64.deb ... Unpacking libmagic-mgc (1:5.46-5) ... Selecting previously unselected package libmagic1t64:amd64. Preparing to unpack .../005-libmagic1t64_1%3a5.46-5_amd64.deb ... Unpacking libmagic1t64:amd64 (1:5.46-5) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.46-5_amd64.deb ... Unpacking file (1:5.46-5) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.23.1-2_amd64.deb ... Unpacking gettext-base (0.23.1-2) ... Selecting previously unselected package libuchardet0:amd64. Preparing to unpack .../008-libuchardet0_0.0.8-1+b2_amd64.deb ... Unpacking libuchardet0:amd64 (0.0.8-1+b2) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-9_amd64.deb ... Unpacking groff-base (1.23.0-9) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.41-5_amd64.deb ... Unpacking bsdextrautils (2.41-5) ... Selecting previously unselected package libpipeline1:amd64. Preparing to unpack .../011-libpipeline1_1.5.8-1_amd64.deb ... Unpacking libpipeline1:amd64 (1.5.8-1) ... Selecting previously unselected package man-db. Preparing to unpack .../012-man-db_2.13.1-1_amd64.deb ... Unpacking man-db (2.13.1-1) ... Selecting previously unselected package m4. Preparing to unpack .../013-m4_1.4.19-8_amd64.deb ... Unpacking m4 (1.4.19-8) ... Selecting previously unselected package autoconf. Preparing to unpack .../014-autoconf_2.72-3.1_all.deb ... Unpacking autoconf (2.72-3.1) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../015-autotools-dev_20240727.1_all.deb ... Unpacking autotools-dev (20240727.1) ... Selecting previously unselected package automake. Preparing to unpack .../016-automake_1%3a1.17-4_all.deb ... Unpacking automake (1:1.17-4) ... Selecting previously unselected package autopoint. Preparing to unpack .../017-autopoint_0.23.1-2_all.deb ... Unpacking autopoint (0.23.1-2) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../018-libdebhelper-perl_13.24.2_all.deb ... Unpacking libdebhelper-perl (13.24.2) ... Selecting previously unselected package libtool. Preparing to unpack .../019-libtool_2.5.4-4_all.deb ... Unpacking libtool (2.5.4-4) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../020-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../021-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../022-libfile-stripnondeterminism-perl_1.14.1-2_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.14.1-2) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../023-dh-strip-nondeterminism_1.14.1-2_all.deb ... Unpacking dh-strip-nondeterminism (1.14.1-2) ... Selecting previously unselected package libelf1t64:amd64. Preparing to unpack .../024-libelf1t64_0.192-4_amd64.deb ... Unpacking libelf1t64:amd64 (0.192-4) ... Selecting previously unselected package dwz. Preparing to unpack .../025-dwz_0.15-1+b1_amd64.deb ... Unpacking dwz (0.15-1+b1) ... Selecting previously unselected package libunistring5:amd64. Preparing to unpack .../026-libunistring5_1.3-2_amd64.deb ... Unpacking libunistring5:amd64 (1.3-2) ... Selecting previously unselected package libxml2:amd64. Preparing to unpack .../027-libxml2_2.12.7+dfsg+really2.9.14-2.1_amd64.deb ... Unpacking libxml2:amd64 (2.12.7+dfsg+really2.9.14-2.1) ... Selecting previously unselected package gettext. Preparing to unpack .../028-gettext_0.23.1-2_amd64.deb ... Unpacking gettext (0.23.1-2) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../029-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../030-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../031-debhelper_13.24.2_all.deb ... Unpacking debhelper (13.24.2) ... Selecting previously unselected package sgml-base. Preparing to unpack .../032-sgml-base_1.31+nmu1_all.deb ... Unpacking sgml-base (1.31+nmu1) ... Selecting previously unselected package xml-core. Preparing to unpack .../033-xml-core_0.19_all.deb ... Unpacking xml-core (0.19) ... Selecting previously unselected package docutils-common. Preparing to unpack .../034-docutils-common_0.21.2+dfsg-2_all.deb ... Unpacking docutils-common (0.21.2+dfsg-2) ... Selecting previously unselected package libbrotli1:amd64. Preparing to unpack .../035-libbrotli1_1.1.0-2+b7_amd64.deb ... Unpacking libbrotli1:amd64 (1.1.0-2+b7) ... Selecting previously unselected package libpng16-16t64:amd64. Preparing to unpack .../036-libpng16-16t64_1.6.48-1_amd64.deb ... Unpacking libpng16-16t64:amd64 (1.6.48-1) ... Selecting previously unselected package libfreetype6:amd64. Preparing to unpack .../037-libfreetype6_2.13.3+dfsg-1_amd64.deb ... Unpacking libfreetype6:amd64 (2.13.3+dfsg-1) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../038-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../039-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../040-fontconfig-config_2.15.0-2.3_amd64.deb ... Unpacking fontconfig-config (2.15.0-2.3) ... Selecting previously unselected package libfontconfig1:amd64. Preparing to unpack .../041-libfontconfig1_2.15.0-2.3_amd64.deb ... Unpacking libfontconfig1:amd64 (2.15.0-2.3) ... Selecting previously unselected package fontconfig. Preparing to unpack .../042-fontconfig_2.15.0-2.3_amd64.deb ... Unpacking fontconfig (2.15.0-2.3) ... Selecting previously unselected package libann0. Preparing to unpack .../043-libann0_1.1.2+doc-9+b1_amd64.deb ... Unpacking libann0 (1.1.2+doc-9+b1) ... Selecting previously unselected package libcdt5:amd64. Preparing to unpack .../044-libcdt5_2.42.4-3_amd64.deb ... Unpacking libcdt5:amd64 (2.42.4-3) ... Selecting previously unselected package libcgraph6:amd64. Preparing to unpack .../045-libcgraph6_2.42.4-3_amd64.deb ... Unpacking libcgraph6:amd64 (2.42.4-3) ... Selecting previously unselected package libaom3:amd64. Preparing to unpack .../046-libaom3_3.12.1-1_amd64.deb ... Unpacking libaom3:amd64 (3.12.1-1) ... Selecting previously unselected package libdav1d7:amd64. Preparing to unpack .../047-libdav1d7_1.5.1-1_amd64.deb ... Unpacking libdav1d7:amd64 (1.5.1-1) ... Selecting previously unselected package libabsl20240722:amd64. Preparing to unpack .../048-libabsl20240722_20240722.0-4_amd64.deb ... Unpacking libabsl20240722:amd64 (20240722.0-4) ... Selecting previously unselected package libgav1-1:amd64. Preparing to unpack .../049-libgav1-1_0.19.0-3+b1_amd64.deb ... Unpacking libgav1-1:amd64 (0.19.0-3+b1) ... Selecting previously unselected package librav1e0.7:amd64. Preparing to unpack .../050-librav1e0.7_0.7.1-9+b2_amd64.deb ... Unpacking librav1e0.7:amd64 (0.7.1-9+b2) ... Selecting previously unselected package libsvtav1enc2:amd64. Preparing to unpack .../051-libsvtav1enc2_2.3.0+dfsg-1_amd64.deb ... Unpacking libsvtav1enc2:amd64 (2.3.0+dfsg-1) ... Selecting previously unselected package libjpeg62-turbo:amd64. Preparing to unpack .../052-libjpeg62-turbo_1%3a2.1.5-4_amd64.deb ... Unpacking libjpeg62-turbo:amd64 (1:2.1.5-4) ... Selecting previously unselected package libyuv0:amd64. Preparing to unpack .../053-libyuv0_0.0.1904.20250204-1_amd64.deb ... Unpacking libyuv0:amd64 (0.0.1904.20250204-1) ... Selecting previously unselected package libavif16:amd64. Preparing to unpack .../054-libavif16_1.2.1-1.2_amd64.deb ... Unpacking libavif16:amd64 (1.2.1-1.2) ... Selecting previously unselected package libsharpyuv0:amd64. Preparing to unpack .../055-libsharpyuv0_1.5.0-0.1_amd64.deb ... Unpacking libsharpyuv0:amd64 (1.5.0-0.1) ... Selecting previously unselected package libheif-plugin-dav1d:amd64. Preparing to unpack .../056-libheif-plugin-dav1d_1.19.8-1_amd64.deb ... Unpacking libheif-plugin-dav1d:amd64 (1.19.8-1) ... Selecting previously unselected package libde265-0:amd64. Preparing to unpack .../057-libde265-0_1.0.16-1_amd64.deb ... Unpacking libde265-0:amd64 (1.0.16-1) ... Selecting previously unselected package libheif-plugin-libde265:amd64. Preparing to unpack .../058-libheif-plugin-libde265_1.19.8-1_amd64.deb ... Unpacking libheif-plugin-libde265:amd64 (1.19.8-1) ... Selecting previously unselected package libheif1:amd64. Preparing to unpack .../059-libheif1_1.19.8-1_amd64.deb ... Unpacking libheif1:amd64 (1.19.8-1) ... Selecting previously unselected package libimagequant0:amd64. Preparing to unpack .../060-libimagequant0_2.18.0-1+b2_amd64.deb ... Unpacking libimagequant0:amd64 (2.18.0-1+b2) ... Selecting previously unselected package libdeflate0:amd64. Preparing to unpack .../061-libdeflate0_1.23-2_amd64.deb ... Unpacking libdeflate0:amd64 (1.23-2) ... Selecting previously unselected package libjbig0:amd64. Preparing to unpack .../062-libjbig0_2.1-6.1+b2_amd64.deb ... Unpacking libjbig0:amd64 (2.1-6.1+b2) ... Selecting previously unselected package liblerc4:amd64. Preparing to unpack .../063-liblerc4_4.0.0+ds-5_amd64.deb ... Unpacking liblerc4:amd64 (4.0.0+ds-5) ... Selecting previously unselected package libwebp7:amd64. Preparing to unpack .../064-libwebp7_1.5.0-0.1_amd64.deb ... Unpacking libwebp7:amd64 (1.5.0-0.1) ... Selecting previously unselected package libtiff6:amd64. Preparing to unpack .../065-libtiff6_4.7.0-3_amd64.deb ... Unpacking libtiff6:amd64 (4.7.0-3) ... Selecting previously unselected package libxau6:amd64. Preparing to unpack .../066-libxau6_1%3a1.0.11-1_amd64.deb ... Unpacking libxau6:amd64 (1:1.0.11-1) ... Selecting previously unselected package libxdmcp6:amd64. Preparing to unpack .../067-libxdmcp6_1%3a1.1.5-1_amd64.deb ... Unpacking libxdmcp6:amd64 (1:1.1.5-1) ... Selecting previously unselected package libxcb1:amd64. Preparing to unpack .../068-libxcb1_1.17.0-2+b1_amd64.deb ... Unpacking libxcb1:amd64 (1.17.0-2+b1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../069-libx11-data_2%3a1.8.12-1_all.deb ... Unpacking libx11-data (2:1.8.12-1) ... Selecting previously unselected package libx11-6:amd64. Preparing to unpack .../070-libx11-6_2%3a1.8.12-1_amd64.deb ... Unpacking libx11-6:amd64 (2:1.8.12-1) ... Selecting previously unselected package libxpm4:amd64. Preparing to unpack .../071-libxpm4_1%3a3.5.17-1+b3_amd64.deb ... Unpacking libxpm4:amd64 (1:3.5.17-1+b3) ... Selecting previously unselected package libgd3:amd64. Preparing to unpack .../072-libgd3_2.3.3-13_amd64.deb ... Unpacking libgd3:amd64 (2.3.3-13) ... Selecting previously unselected package libglib2.0-0t64:amd64. Preparing to unpack .../073-libglib2.0-0t64_2.84.3-1_amd64.deb ... Unpacking libglib2.0-0t64:amd64 (2.84.3-1) ... Selecting previously unselected package libgts-0.7-5t64:amd64. Preparing to unpack .../074-libgts-0.7-5t64_0.7.6+darcs121130-5.2+b1_amd64.deb ... Unpacking libgts-0.7-5t64:amd64 (0.7.6+darcs121130-5.2+b1) ... Selecting previously unselected package libpixman-1-0:amd64. Preparing to unpack .../075-libpixman-1-0_0.44.0-3_amd64.deb ... Unpacking libpixman-1-0:amd64 (0.44.0-3) ... Selecting previously unselected package libxcb-render0:amd64. Preparing to unpack .../076-libxcb-render0_1.17.0-2+b1_amd64.deb ... Unpacking libxcb-render0:amd64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-shm0:amd64. Preparing to unpack .../077-libxcb-shm0_1.17.0-2+b1_amd64.deb ... Unpacking libxcb-shm0:amd64 (1.17.0-2+b1) ... Selecting previously unselected package libxext6:amd64. Preparing to unpack .../078-libxext6_2%3a1.3.4-1+b3_amd64.deb ... Unpacking libxext6:amd64 (2:1.3.4-1+b3) ... Selecting previously unselected package libxrender1:amd64. Preparing to unpack .../079-libxrender1_1%3a0.9.12-1_amd64.deb ... Unpacking libxrender1:amd64 (1:0.9.12-1) ... Selecting previously unselected package libcairo2:amd64. Preparing to unpack .../080-libcairo2_1.18.4-1+b1_amd64.deb ... Unpacking libcairo2:amd64 (1.18.4-1+b1) ... Selecting previously unselected package libltdl7:amd64. Preparing to unpack .../081-libltdl7_2.5.4-4_amd64.deb ... Unpacking libltdl7:amd64 (2.5.4-4) ... Selecting previously unselected package libfribidi0:amd64. Preparing to unpack .../082-libfribidi0_1.0.16-1_amd64.deb ... Unpacking libfribidi0:amd64 (1.0.16-1) ... Selecting previously unselected package libgraphite2-3:amd64. Preparing to unpack .../083-libgraphite2-3_1.3.14-2+b1_amd64.deb ... Unpacking libgraphite2-3:amd64 (1.3.14-2+b1) ... Selecting previously unselected package libharfbuzz0b:amd64. Preparing to unpack .../084-libharfbuzz0b_10.2.0-1+b1_amd64.deb ... Unpacking libharfbuzz0b:amd64 (10.2.0-1+b1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../085-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:amd64. Preparing to unpack .../086-libdatrie1_0.2.13-4_amd64.deb ... Unpacking libdatrie1:amd64 (0.2.13-4) ... Selecting previously unselected package libthai0:amd64. Preparing to unpack .../087-libthai0_0.1.29-2+b1_amd64.deb ... Unpacking libthai0:amd64 (0.1.29-2+b1) ... Selecting previously unselected package libpango-1.0-0:amd64. Preparing to unpack .../088-libpango-1.0-0_1.56.3-1_amd64.deb ... Unpacking libpango-1.0-0:amd64 (1.56.3-1) ... Selecting previously unselected package libpangoft2-1.0-0:amd64. Preparing to unpack .../089-libpangoft2-1.0-0_1.56.3-1_amd64.deb ... Unpacking libpangoft2-1.0-0:amd64 (1.56.3-1) ... Selecting previously unselected package libpangocairo-1.0-0:amd64. Preparing to unpack .../090-libpangocairo-1.0-0_1.56.3-1_amd64.deb ... Unpacking libpangocairo-1.0-0:amd64 (1.56.3-1) ... Selecting previously unselected package libpathplan4:amd64. Preparing to unpack .../091-libpathplan4_2.42.4-3_amd64.deb ... Unpacking libpathplan4:amd64 (2.42.4-3) ... Selecting previously unselected package libgvc6. Preparing to unpack .../092-libgvc6_2.42.4-3_amd64.deb ... Unpacking libgvc6 (2.42.4-3) ... Selecting previously unselected package libgvpr2:amd64. Preparing to unpack .../093-libgvpr2_2.42.4-3_amd64.deb ... Unpacking libgvpr2:amd64 (2.42.4-3) ... Selecting previously unselected package liblab-gamut1:amd64. Preparing to unpack .../094-liblab-gamut1_2.42.4-3_amd64.deb ... Unpacking liblab-gamut1:amd64 (2.42.4-3) ... Selecting previously unselected package x11-common. Preparing to unpack .../095-x11-common_1%3a7.7+24_all.deb ... Unpacking x11-common (1:7.7+24) ... Selecting previously unselected package libice6:amd64. Preparing to unpack .../096-libice6_2%3a1.1.1-1_amd64.deb ... Unpacking libice6:amd64 (2:1.1.1-1) ... Selecting previously unselected package libsm6:amd64. Preparing to unpack .../097-libsm6_2%3a1.2.6-1_amd64.deb ... Unpacking libsm6:amd64 (2:1.2.6-1) ... Selecting previously unselected package libxt6t64:amd64. Preparing to unpack .../098-libxt6t64_1%3a1.2.1-1.2+b2_amd64.deb ... Unpacking libxt6t64:amd64 (1:1.2.1-1.2+b2) ... Selecting previously unselected package libxmu6:amd64. Preparing to unpack .../099-libxmu6_2%3a1.1.3-3+b4_amd64.deb ... Unpacking libxmu6:amd64 (2:1.1.3-3+b4) ... Selecting previously unselected package libxaw7:amd64. Preparing to unpack .../100-libxaw7_2%3a1.0.16-1_amd64.deb ... Unpacking libxaw7:amd64 (2:1.0.16-1) ... Selecting previously unselected package graphviz. Preparing to unpack .../101-graphviz_2.42.4-3_amd64.deb ... Unpacking graphviz (2.42.4-3) ... Selecting previously unselected package libmd-dev:amd64. Preparing to unpack .../102-libmd-dev_1.1.0-2+b1_amd64.deb ... Unpacking libmd-dev:amd64 (1.1.0-2+b1) ... Selecting previously unselected package libbsd-dev:amd64. Preparing to unpack .../103-libbsd-dev_0.12.2-2_amd64.deb ... Unpacking libbsd-dev:amd64 (0.12.2-2) ... Selecting previously unselected package libedit2:amd64. Preparing to unpack .../104-libedit2_3.1-20250104-1_amd64.deb ... Unpacking libedit2:amd64 (3.1-20250104-1) ... Selecting previously unselected package libncurses6:amd64. Preparing to unpack .../105-libncurses6_6.5+20250216-2_amd64.deb ... Unpacking libncurses6:amd64 (6.5+20250216-2) ... Selecting previously unselected package libncurses-dev:amd64. Preparing to unpack .../106-libncurses-dev_6.5+20250216-2_amd64.deb ... Unpacking libncurses-dev:amd64 (6.5+20250216-2) ... Selecting previously unselected package libedit-dev:amd64. Preparing to unpack .../107-libedit-dev_3.1-20250104-1_amd64.deb ... Unpacking libedit-dev:amd64 (3.1-20250104-1) ... Selecting previously unselected package libgpg-error0:amd64. Preparing to unpack .../108-libgpg-error0_1.51-4_amd64.deb ... Unpacking libgpg-error0:amd64 (1.51-4) ... Selecting previously unselected package libgcrypt20:amd64. Preparing to unpack .../109-libgcrypt20_1.11.0-7_amd64.deb ... Unpacking libgcrypt20:amd64 (1.11.0-7) ... Selecting previously unselected package libjemalloc2:amd64. Preparing to unpack .../110-libjemalloc2_5.3.0-3_amd64.deb ... Unpacking libjemalloc2:amd64 (5.3.0-3) ... Selecting previously unselected package libjemalloc-dev. Preparing to unpack .../111-libjemalloc-dev_5.3.0-3_amd64.deb ... Unpacking libjemalloc-dev (5.3.0-3) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../112-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libjs-underscore. Preparing to unpack .../113-libjs-underscore_1.13.4~dfsg+~1.11.4-3_all.deb ... Unpacking libjs-underscore (1.13.4~dfsg+~1.11.4-3) ... Selecting previously unselected package libjs-sphinxdoc. Preparing to unpack .../114-libjs-sphinxdoc_8.1.3-5_all.deb ... Unpacking libjs-sphinxdoc (8.1.3-5) ... Selecting previously unselected package libjson-perl. Preparing to unpack .../115-libjson-perl_4.10000-1_all.deb ... Unpacking libjson-perl (4.10000-1) ... Selecting previously unselected package libpcre2-16-0:amd64. Preparing to unpack .../116-libpcre2-16-0_10.45-1_amd64.deb ... Unpacking libpcre2-16-0:amd64 (10.45-1) ... Selecting previously unselected package libpcre2-32-0:amd64. Preparing to unpack .../117-libpcre2-32-0_10.45-1_amd64.deb ... Unpacking libpcre2-32-0:amd64 (10.45-1) ... Selecting previously unselected package libpcre2-posix3:amd64. Preparing to unpack .../118-libpcre2-posix3_10.45-1_amd64.deb ... Unpacking libpcre2-posix3:amd64 (10.45-1) ... Selecting previously unselected package libpcre2-dev:amd64. Preparing to unpack .../119-libpcre2-dev_10.45-1_amd64.deb ... Unpacking libpcre2-dev:amd64 (10.45-1) ... Selecting previously unselected package libpkgconf3:amd64. Preparing to unpack .../120-libpkgconf3_1.8.1-4_amd64.deb ... Unpacking libpkgconf3:amd64 (1.8.1-4) ... Selecting previously unselected package libxslt1.1:amd64. Preparing to unpack .../121-libxslt1.1_1.1.35-1.2_amd64.deb ... Unpacking libxslt1.1:amd64 (1.1.35-1.2) ... Selecting previously unselected package pkgconf-bin. Preparing to unpack .../122-pkgconf-bin_1.8.1-4_amd64.deb ... Unpacking pkgconf-bin (1.8.1-4) ... Selecting previously unselected package pkgconf:amd64. Preparing to unpack .../123-pkgconf_1.8.1-4_amd64.deb ... Unpacking pkgconf:amd64 (1.8.1-4) ... Selecting previously unselected package python-babel-localedata. Preparing to unpack .../124-python-babel-localedata_2.17.0-1_all.deb ... Unpacking python-babel-localedata (2.17.0-1) ... Selecting previously unselected package python3-alabaster. Preparing to unpack .../125-python3-alabaster_0.7.16-0.1_all.deb ... Unpacking python3-alabaster (0.7.16-0.1) ... Selecting previously unselected package python3-babel. Preparing to unpack .../126-python3-babel_2.17.0-1_all.deb ... Unpacking python3-babel (2.17.0-1) ... Selecting previously unselected package python3-certifi. Preparing to unpack .../127-python3-certifi_2025.1.31+ds-1_all.deb ... Unpacking python3-certifi (2025.1.31+ds-1) ... Selecting previously unselected package python3-chardet. Preparing to unpack .../128-python3-chardet_5.2.0+dfsg-2_all.deb ... Unpacking python3-chardet (5.2.0+dfsg-2) ... Selecting previously unselected package python3-charset-normalizer. Preparing to unpack .../129-python3-charset-normalizer_3.4.2-1_amd64.deb ... Unpacking python3-charset-normalizer (3.4.2-1) ... Selecting previously unselected package python3-defusedxml. Preparing to unpack .../130-python3-defusedxml_0.7.1-3_all.deb ... Unpacking python3-defusedxml (0.7.1-3) ... Selecting previously unselected package python3-roman. Preparing to unpack .../131-python3-roman_5.0-1_all.deb ... Unpacking python3-roman (5.0-1) ... Selecting previously unselected package python3-docutils. Preparing to unpack .../132-python3-docutils_0.21.2+dfsg-2_all.deb ... Unpacking python3-docutils (0.21.2+dfsg-2) ... Selecting previously unselected package python3-idna. Preparing to unpack .../133-python3-idna_3.10-1_all.deb ... Unpacking python3-idna (3.10-1) ... Selecting previously unselected package python3-imagesize. Preparing to unpack .../134-python3-imagesize_1.4.1-1_all.deb ... Unpacking python3-imagesize (1.4.1-1) ... Selecting previously unselected package python3-markupsafe. Preparing to unpack .../135-python3-markupsafe_2.1.5-1+b3_amd64.deb ... Unpacking python3-markupsafe (2.1.5-1+b3) ... Selecting previously unselected package python3-jinja2. Preparing to unpack .../136-python3-jinja2_3.1.6-1_all.deb ... Unpacking python3-jinja2 (3.1.6-1) ... Selecting previously unselected package python3-packaging. Preparing to unpack .../137-python3-packaging_25.0-1_all.deb ... Unpacking python3-packaging (25.0-1) ... Selecting previously unselected package python3-pygments. Preparing to unpack .../138-python3-pygments_2.18.0+dfsg-2_all.deb ... Unpacking python3-pygments (2.18.0+dfsg-2) ... Selecting previously unselected package python3-urllib3. Preparing to unpack .../139-python3-urllib3_2.3.0-3_all.deb ... Unpacking python3-urllib3 (2.3.0-3) ... Selecting previously unselected package python3-requests. Preparing to unpack .../140-python3-requests_2.32.3+dfsg-5_all.deb ... Unpacking python3-requests (2.32.3+dfsg-5) ... Selecting previously unselected package python3-snowballstemmer. Preparing to unpack .../141-python3-snowballstemmer_2.2.0-4_all.deb ... Unpacking python3-snowballstemmer (2.2.0-4) ... Selecting previously unselected package sphinx-common. Preparing to unpack .../142-sphinx-common_8.1.3-5_all.deb ... Unpacking sphinx-common (8.1.3-5) ... Selecting previously unselected package python3-sphinx. Preparing to unpack .../143-python3-sphinx_8.1.3-5_all.deb ... Unpacking python3-sphinx (8.1.3-5) ... Selecting previously unselected package xsltproc. Preparing to unpack .../144-xsltproc_1.1.35-1.2_amd64.deb ... Unpacking xsltproc (1.1.35-1.2) ... Setting up media-types (13.0.0) ... Setting up libpipeline1:amd64 (1.5.8-1) ... Setting up libgraphite2-3:amd64 (1.3.14-2+b1) ... Setting up libpixman-1-0:amd64 (0.44.0-3) ... Setting up libsharpyuv0:amd64 (1.5.0-0.1) ... Setting up libaom3:amd64 (3.12.1-1) ... Setting up libxau6:amd64 (1:1.0.11-1) ... Setting up libxdmcp6:amd64 (1:1.1.5-1) ... Setting up libxcb1:amd64 (1.17.0-2+b1) ... Setting up liblerc4:amd64 (4.0.0+ds-5) ... Setting up bsdextrautils (2.41-5) ... Setting up libgpg-error0:amd64 (1.51-4) ... Setting up libdatrie1:amd64 (0.2.13-4) ... Setting up libmagic-mgc (1:5.46-5) ... Setting up libxcb-render0:amd64 (1.17.0-2+b1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libdebhelper-perl (13.24.2) ... Setting up libbrotli1:amd64 (1.1.0-2+b7) ... Setting up libedit2:amd64 (3.1-20250104-1) ... Setting up liblab-gamut1:amd64 (2.42.4-3) ... Setting up libmagic1t64:amd64 (1:5.46-5) ... Setting up x11-common (1:7.7+24) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libdeflate0:amd64 (1.23-2) ... Setting up gettext-base (0.23.1-2) ... Setting up m4 (1.4.19-8) ... Setting up libgcrypt20:amd64 (1.11.0-7) ... Setting up libxcb-shm0:amd64 (1.17.0-2+b1) ... Setting up file (1:5.46-5) ... Setting up libjemalloc2:amd64 (5.3.0-3) ... Setting up libabsl20240722:amd64 (20240722.0-4) ... Setting up libjbig0:amd64 (2.1-6.1+b2) ... Setting up libpcre2-16-0:amd64 (10.45-1) ... Setting up libelf1t64:amd64 (0.192-4) ... Setting up python-babel-localedata (2.17.0-1) ... Setting up tzdata (2025b-4) ... Current default time zone: 'Etc/UTC' Local time is now: Mon Sep 7 19:50:08 UTC 2026. Universal Time is now: Mon Sep 7 19:50:08 UTC 2026. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libjemalloc-dev (5.3.0-3) ... Setting up autotools-dev (20240727.1) ... Setting up libpcre2-32-0:amd64 (10.45-1) ... Setting up libpkgconf3:amd64 (1.8.1-4) ... Setting up libjpeg62-turbo:amd64 (1:2.1.5-4) ... Setting up libx11-data (2:1.8.12-1) ... Setting up libsvtav1enc2:amd64 (2.3.0+dfsg-1) ... Setting up libpathplan4:amd64 (2.42.4-3) ... Setting up libann0 (1.1.2+doc-9+b1) ... Setting up libncurses6:amd64 (6.5+20250216-2) ... Setting up libfribidi0:amd64 (1.0.16-1) ... Setting up libimagequant0:amd64 (2.18.0-1+b2) ... Setting up libunistring5:amd64 (1.3-2) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16t64:amd64 (1.6.48-1) ... Setting up autopoint (0.23.1-2) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libgav1-1:amd64 (0.19.0-3+b1) ... Setting up pkgconf-bin (1.8.1-4) ... Setting up libltdl7:amd64 (2.5.4-4) ... Setting up autoconf (2.72-3.1) ... Setting up libwebp7:amd64 (1.5.0-0.1) ... Setting up libffi8:amd64 (3.4.8-2) ... Setting up libpcre2-posix3:amd64 (10.45-1) ... Setting up dwz (0.15-1+b1) ... Setting up libdav1d7:amd64 (1.5.1-1) ... Setting up sensible-utils (0.0.25) ... Setting up libtiff6:amd64 (4.7.0-3) ... Setting up librav1e0.7:amd64 (0.7.1-9+b2) ... Setting up libuchardet0:amd64 (0.0.8-1+b2) ... Setting up libjson-perl (4.10000-1) ... Setting up libmd-dev:amd64 (1.1.0-2+b1) ... Setting up libx11-6:amd64 (2:1.8.12-1) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.5) ... Setting up sgml-base (1.31+nmu1) ... Setting up libcdt5:amd64 (2.42.4-3) ... Setting up libcgraph6:amd64 (2.42.4-3) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libde265-0:amd64 (1.0.16-1) ... Setting up openssl (3.5.1-1) ... Setting up libyuv0:amd64 (0.0.1904.20250204-1) ... Setting up readline-common (8.2-6) ... Setting up libxml2:amd64 (2.12.7+dfsg+really2.9.14-2.1) ... Setting up libbsd-dev:amd64 (0.12.2-2) ... Setting up libjs-underscore (1.13.4~dfsg+~1.11.4-3) ... Setting up automake (1:1.17-4) ... update-alternatives: using /usr/bin/automake-1.17 to provide /usr/bin/automake (automake) in auto mode Setting up libfile-stripnondeterminism-perl (1.14.1-2) ... Setting up libice6:amd64 (2:1.1.1-1) ... Setting up libavif16:amd64 (1.2.1-1.2) ... Setting up libncurses-dev:amd64 (6.5+20250216-2) ... Setting up gettext (0.23.1-2) ... Setting up libxpm4:amd64 (1:3.5.17-1+b3) ... Setting up libpcre2-dev:amd64 (10.45-1) ... Setting up libxrender1:amd64 (1:0.9.12-1) ... Setting up libtool (2.5.4-4) ... Setting up fontconfig-config (2.15.0-2.3) ... Setting up libxext6:amd64 (2:1.3.4-1+b3) ... Setting up pkgconf:amd64 (1.8.1-4) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up dh-autoreconf (20) ... Setting up libthai0:amd64 (0.1.29-2+b1) ... Setting up ca-certificates (20250419) ... Updating certificates in /etc/ssl/certs... 150 added, 0 removed; done. Setting up libglib2.0-0t64:amd64 (2.84.3-1) ... No schema files found: doing nothing. Setting up libfreetype6:amd64 (2.13.3+dfsg-1) ... Setting up libedit-dev:amd64 (3.1-20250104-1) ... Setting up libjs-sphinxdoc (8.1.3-5) ... Setting up libreadline8t64:amd64 (8.2-6) ... Setting up dh-strip-nondeterminism (1.14.1-2) ... Setting up libgvpr2:amd64 (2.42.4-3) ... Setting up groff-base (1.23.0-9) ... Setting up xml-core (0.19) ... Setting up libxslt1.1:amd64 (1.1.35-1.2) ... Setting up libharfbuzz0b:amd64 (10.2.0-1+b1) ... Setting up libgts-0.7-5t64:amd64 (0.7.6+darcs121130-5.2+b1) ... Setting up libfontconfig1:amd64 (2.15.0-2.3) ... Setting up libsm6:amd64 (2:1.2.6-1) ... Setting up libpython3.13-stdlib:amd64 (3.13.5-2) ... Setting up libpython3-stdlib:amd64 (3.13.5-1) ... Setting up fontconfig (2.15.0-2.3) ... Regenerating fonts cache... done. Setting up python3.13 (3.13.5-2) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libpango-1.0-0:amd64 (1.56.3-1) ... Setting up xsltproc (1.1.35-1.2) ... Setting up python3 (3.13.5-1) ... Setting up man-db (2.13.1-1) ... Not building database; man-db/auto-update is not 'true'. Setting up python3-markupsafe (2.1.5-1+b3) ... Setting up libcairo2:amd64 (1.18.4-1+b1) ... Setting up python3-roman (5.0-1) ... Setting up python3-jinja2 (3.1.6-1) ... Setting up python3-pygments (2.18.0+dfsg-2) ... Setting up python3-packaging (25.0-1) ... Setting up python3-chardet (5.2.0+dfsg-2) ... Setting up python3-certifi (2025.1.31+ds-1) ... Setting up python3-snowballstemmer (2.2.0-4) ... Setting up sphinx-common (8.1.3-5) ... Setting up libxt6t64:amd64 (1:1.2.1-1.2+b2) ... Setting up python3-idna (3.10-1) ... Setting up python3-urllib3 (2.3.0-3) ... Setting up libpangoft2-1.0-0:amd64 (1.56.3-1) ... Setting up libpangocairo-1.0-0:amd64 (1.56.3-1) ... Setting up python3-imagesize (1.4.1-1) ... Setting up libxmu6:amd64 (2:1.1.3-3+b4) ... Setting up python3-babel (2.17.0-1) ... update-alternatives: using /usr/bin/pybabel-python3 to provide /usr/bin/pybabel (pybabel) in auto mode Setting up python3-defusedxml (0.7.1-3) ... Setting up python3-charset-normalizer (3.4.2-1) ... Setting up python3-alabaster (0.7.16-0.1) ... Setting up debhelper (13.24.2) ... Setting up libxaw7:amd64 (2:1.0.16-1) ... Setting up python3-requests (2.32.3+dfsg-5) ... Setting up libheif-plugin-dav1d:amd64 (1.19.8-1) ... Setting up libheif-plugin-libde265:amd64 (1.19.8-1) ... Setting up libheif1:amd64 (1.19.8-1) ... Setting up libgd3:amd64 (2.3.3-13) ... Setting up libgvc6 (2.42.4-3) ... Setting up graphviz (2.42.4-3) ... Processing triggers for libc-bin (2.41-11) ... Processing triggers for sgml-base (1.31+nmu1) ... Setting up docutils-common (0.21.2+dfsg-2) ... Processing triggers for sgml-base (1.31+nmu1) ... Setting up python3-docutils (0.21.2+dfsg-2) ... Setting up python3-sphinx (8.1.3-5) ... Processing triggers for ca-certificates (20250419) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/reproducible-path/varnish-7.7.0/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../varnish_7.7.0-3_source.changes dpkg-buildpackage: info: source package varnish dpkg-buildpackage: info: source version 7.7.0-3 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Marco d'Itri dpkg-source --before-build . dpkg-buildpackage: info: host architecture amd64 debian/rules clean dh clean dh_clean debian/rules binary dh binary dh_update_autotools_config dh_autoreconf libtoolize: putting auxiliary files in AC_CONFIG_AUX_DIR, 'build-aux'. libtoolize: copying file 'build-aux/ltmain.sh' libtoolize: putting macros in AC_CONFIG_MACRO_DIRS, 'm4'. libtoolize: copying file 'm4/libtool.m4' libtoolize: copying file 'm4/ltoptions.m4' libtoolize: copying file 'm4/ltsugar.m4' libtoolize: copying file 'm4/ltversion.m4' libtoolize: copying file 'm4/lt~obsolete.m4' configure.ac:40: warning: The macro 'AC_PROG_CC_C99' is obsolete. configure.ac:40: You should run autoupdate. ./lib/autoconf/c.m4:1662: AC_PROG_CC_C99 is expanded from... configure.ac:40: the top level configure.ac:337: warning: whitespace-separated list contains macros; configure.ac:337: in a future version of Autoconf they will not be expanded ./lib/autoconf/headers.m4:217: AC_CHECK_HEADERS is expanded from... lib/m4sugar/m4sh.m4:697: AS_IF is expanded from... ./lib/autoconf/libs.m4:47: AC_SEARCH_LIBS is expanded from... configure.ac:337: the top level configure.ac:11: installing 'build-aux/compile' configure.ac:26: installing 'build-aux/config.guess' configure.ac:26: installing 'build-aux/config.sub' configure.ac:30: installing 'build-aux/install-sh' configure.ac:30: installing 'build-aux/missing' parallel-tests: installing 'build-aux/test-driver' bin/varnishadm/Makefile.am: installing 'build-aux/depcomp' debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/varnish-7.7.0' dh_auto_configure -- --localstatedir=/var/lib ./configure --build=x86_64-linux-gnu --prefix=/usr --includedir=\${prefix}/include --mandir=\${prefix}/share/man --infodir=\${prefix}/share/info --sysconfdir=/etc --localstatedir=/var --disable-option-checking --disable-silent-rules --libdir=\${prefix}/lib/x86_64-linux-gnu --runstatedir=/run --disable-maintainer-mode --disable-dependency-tracking --localstatedir=/var/lib checking for gcc... gcc checking whether the C compiler works... yes checking for C compiler default output file name... a.out checking for suffix of executables... checking whether we are cross compiling... no checking for suffix of object files... o checking whether the compiler supports GNU C... yes checking whether gcc accepts -g... yes checking for gcc option to enable C11 features... none needed checking whether gcc understands -c and -o together... yes checking for stdio.h... yes checking for stdlib.h... yes checking for string.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for strings.h... yes checking for sys/stat.h... yes checking for sys/types.h... yes checking for unistd.h... yes checking for wchar.h... yes checking for minix/config.h... no checking whether it is safe to define __EXTENSIONS__... yes checking whether _XOPEN_SOURCE should be defined... no checking build system type... x86_64-pc-linux-gnu checking host system type... x86_64-pc-linux-gnu checking target system type... x86_64-pc-linux-gnu checking whether to enable maintainer-specific portions of Makefiles... no checking for a BSD-compatible install... /usr/bin/install -c checking whether sleep supports fractional seconds... yes checking filesystem timestamp resolution... 0.01 checking whether build environment is sane... yes checking for a race-free mkdir -p... /usr/bin/mkdir -p checking for gawk... no checking for mawk... mawk checking whether make sets $(MAKE)... yes checking whether make supports the include directive... yes (GNU style) checking whether make supports nested variables... yes checking xargs -n works... yes checking dependency style of gcc... none checking how to print strings... printf checking for a sed that does not truncate output... /usr/bin/sed checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for fgrep... /usr/bin/grep -F checking for ld used by gcc... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking for BSD- or MS-compatible name lister (nm)... /usr/bin/nm -B checking the name lister (/usr/bin/nm -B) interface... BSD nm checking whether ln -s works... yes checking the maximum length of command line arguments... 1572864 checking how to convert x86_64-pc-linux-gnu file names to x86_64-pc-linux-gnu format... func_convert_file_noop checking how to convert x86_64-pc-linux-gnu file names to toolchain format... func_convert_file_noop checking for /usr/bin/ld option to reload object files... -r checking for file... file checking for objdump... objdump checking how to recognize dependent libraries... pass_all checking for dlltool... no checking how to associate runtime and link libraries... printf %s\n checking for ranlib... ranlib checking for ar... ar checking for archiver @FILE support... @ checking for strip... strip checking command to parse /usr/bin/nm -B output from gcc object... ok checking for sysroot... no checking for a working dd... /usr/bin/dd checking how to truncate binary pipes... /usr/bin/dd bs=4096 count=1 checking for mt... no checking if : is a manifest tool... no checking for dlfcn.h... yes checking for objdir... .libs checking if gcc supports -fno-rtti -fno-exceptions... no checking for gcc option to produce PIC... -fPIC -DPIC checking if gcc PIC flag -fPIC -DPIC works... yes checking if gcc static flag -static works... yes checking if gcc supports -c -o file.o... yes checking if gcc supports -c -o file.o... (cached) yes checking whether the gcc linker (/usr/bin/ld -m elf_x86_64) supports shared libraries... yes checking whether -lc should be explicitly linked in... no checking dynamic linker characteristics... GNU/Linux ld.so checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... no checking for gcc... (cached) gcc checking whether the compiler supports GNU C... (cached) yes checking whether gcc accepts -g... (cached) yes checking for gcc option to enable C11 features... (cached) none needed checking whether gcc understands -c and -o together... (cached) yes checking how to run the C preprocessor... gcc -E checking for egrep -e... (cached) /usr/bin/grep -E checking whether gcc is Clang... no checking whether pthreads work with "-pthread" and "-lpthread"... yes checking for joinable pthread attribute... PTHREAD_CREATE_JOINABLE checking whether more special flags are required for pthreads... no checking for PTHREAD_PRIO_INHERIT... yes checking for rst2man-3.6... no checking for rst2man-3... no checking for rst2man... rst2man checking for sphinx-build-3.6... no checking for sphinx-build-3... no checking for sphinx-build... sphinx-build checking for rst2html-3.6... no checking for rst2html-3... no checking for rst2html... rst2html checking for dot... ${SHELL} '/build/reproducible-path/varnish-7.7.0/build-aux/missing' dot checking for a Python interpreter with version >= 3.4... python3 checking for python3... /usr/bin/python3 checking for python3 version... 3.13 checking for python3 platform... linux checking for GNU default python3 prefix... ${prefix} checking for GNU default python3 exec_prefix... ${exec_prefix} checking for python3 script directory (pythondir)... ${PYTHON_PREFIX}/lib/python3.13/site-packages checking for python3 extension module directory (pyexecdir)... ${PYTHON_EXEC_PREFIX}/lib/python3.13/site-packages checking for library containing pthread_create... none required checking for dlopen in -ldl... yes checking for socket in -lsocket... no checking for getaddrinfo in -lnsl... no checking for stdatomic.h... yes checking for cos in -lm... yes checking for pkg-config... /usr/bin/pkg-config checking pkg-config is at least version 0.9.0... yes checking for libpcre2-8... yes checking for pcre2_set_depth_limit_8... yes checking for edit/readline/readline.h... no checking for libedit... yes checking for editline/readline.h... yes checking for ncursesw... yes checking for ncursesw/curses.h... yes checking for ncursesw.h... no checking for ncurses/curses.h... no checking for ncurses.h... yes checking for curses.h... yes checking for sys/filio.h... no checking for sys/personality.h... yes checking for pthread_np.h... no checking for priv.h... no checking for fnmatch.h... yes checking for setppriv... no checking for fallocate... yes checking for closefrom... yes checking for getpeereid... no checking for getpeerucred... no checking for fnmatch... yes checking for pthread_setname_np... yes checking for pthread_mutex_isowned_np... no checking for pthread_getattr_np... yes checking for gcc options needed to detect all undeclared functions... none needed checking whether __SUNPRO_C is declared... no checking for malloc_conf in -ljemalloc... yes checking for setproctitle... no checking for library containing backtrace... none required checking for execinfo.h... yes checking for libunwind... no checking for daemon... yes checking for -Wdate-time -D_FORTIFY_SOURCE=2 option for large files... none needed checking for clock_gettime... yes checking for gethrtime... no checking for kqueue... no checking for epoll_ctl... yes checking for port_create... no checking for struct sockaddr.sa_len... no checking whether SO_ACCEPTFILTER is declared... no checking whether SO_RCVTIMEO is declared... yes checking whether SO_SNDTIMEO is declared... yes checking for TCP_KEEP(CNT|IDLE|INTVL) socket options... yes checking for TCP_FASTOPEN socket option... yes checking for close_range... yes checking if close_range is working... yes checking if LD -Wl,--version-script works... yes checking whether C compiler accepts -Wall... yes checking whether C compiler accepts -Werror... yes checking whether C compiler accepts -Werror=unused-result... yes cc cannot -Wstring-plus-int cc: error: unrecognized command-line option '-Wstring-plus-int' cc cannot -Wunused-parameters cc: error: unrecognized command-line option '-Wunused-parameters'; did you mean '-Wunused-parameter'? checking whether we have support for visibility attributes... yes checking whether C compiler accepts -fstack-protector... yes checking whether the linker accepts -fstack-protector... yes checking that generated files are newer than configure... done configure: creating ./config.status config.status: creating Makefile config.status: creating bin/Makefile config.status: creating bin/varnishadm/Makefile config.status: creating bin/varnishd/Makefile config.status: creating bin/varnishlog/Makefile config.status: creating bin/varnishstat/Makefile config.status: creating bin/varnishtop/Makefile config.status: creating bin/varnishhist/Makefile config.status: creating bin/varnishtest/Makefile config.status: creating bin/varnishncsa/Makefile config.status: creating contrib/Makefile config.status: creating doc/Makefile config.status: creating doc/graphviz/Makefile config.status: creating doc/sphinx/Makefile config.status: creating doc/sphinx/conf.py config.status: creating etc/Makefile config.status: creating include/Makefile config.status: creating lib/Makefile config.status: creating lib/libvsc/Makefile config.status: creating lib/libvarnish/Makefile config.status: creating lib/libvarnishapi/Makefile config.status: creating lib/libvcc/Makefile config.status: creating lib/libvgz/Makefile config.status: creating man/Makefile config.status: creating varnishapi.pc config.status: creating varnishapi-uninstalled.pc config.status: creating vmod/Makefile config.status: creating config.h config.status: executing depfiles commands config.status: executing libtool commands config.status: executing mkdir commands make[1]: Leaving directory '/build/reproducible-path/varnish-7.7.0' dh_auto_build make -j42 make[1]: Entering directory '/build/reproducible-path/varnish-7.7.0' make all-recursive make[2]: Entering directory '/build/reproducible-path/varnish-7.7.0' Making all in include make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' mkdir -p ../include/tbl cat ./vdef.h ./vrt.h > vrt_test.c /usr/bin/python3 ../lib/libvcc/generate.py \ .. .. make all-am make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' gcc -DHAVE_CONFIG_H -I. -I.. -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vbm_test.o vbm_test.c gcc -DHAVE_CONFIG_H -I. -I.. -Wdate-time -D_FORTIFY_SOURCE=2 -c -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vrt_test-vrt_test.o `test -f 'vrt_test.c' || echo './'`vrt_test.c echo >vrt_test vrt_test-vrt_test.o -lpthread /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vbm_test vbm_test.o -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vbm_test vbm_test.o -lpthread -pthread make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' Making all in lib make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' Making all in libvsc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_lck.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_main.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_mempool.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_mgt.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_sma.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_smf.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_smu.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_vbe.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -c VSC_waiter.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_lck.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_main.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_mempool.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_mgt.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_sma.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_smf.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_smu.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_vbe.vsc /usr/bin/python3 ../../lib/libvsc/vsctool.py -h VSC_waiter.vsc make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_lck.lo VSC_lck.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_main.lo VSC_main.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_mempool.lo VSC_mempool.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_mgt.lo VSC_mgt.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_sma.lo VSC_sma.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_smf.lo VSC_smf.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_smu.lo VSC_smu.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_vbe.lo VSC_vbe.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o VSC_waiter.lo VSC_waiter.c /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_lck.vsc >VSC_lck.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_main.vsc >VSC_main.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_mempool.vsc >VSC_mempool.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_mgt.vsc >VSC_mgt.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_sma.vsc >VSC_sma.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_smf.vsc >VSC_smf.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_smu.vsc >VSC_smu.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_vbe.vsc >VSC_vbe.rst_ /usr/bin/python3 ../../lib/libvsc/vsctool.py -r VSC_waiter.vsc >VSC_waiter.rst_ libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_lck.c -fPIC -DPIC -o .libs/VSC_lck.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_main.c -fPIC -DPIC -o .libs/VSC_main.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_smf.c -fPIC -DPIC -o .libs/VSC_smf.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_mempool.c -fPIC -DPIC -o .libs/VSC_mempool.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_mgt.c -fPIC -DPIC -o .libs/VSC_mgt.o cat VSC_lck.rst VSC_main.rst VSC_mempool.rst VSC_mgt.rst VSC_sma.rst VSC_smf.rst VSC_smu.rst VSC_vbe.rst VSC_waiter.rst >counters.rst_ libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_sma.c -fPIC -DPIC -o .libs/VSC_sma.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_smu.c -fPIC -DPIC -o .libs/VSC_smu.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_vbe.c -fPIC -DPIC -o .libs/VSC_vbe.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_waiter.c -fPIC -DPIC -o .libs/VSC_waiter.o /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o libvsc.la VSC_lck.lo VSC_main.lo VSC_mempool.lo VSC_mgt.lo VSC_sma.lo VSC_smf.lo VSC_smu.lo VSC_vbe.lo VSC_waiter.lo -lpthread libtool: link: ar cr .libs/libvsc.a .libs/VSC_lck.o .libs/VSC_main.o .libs/VSC_mempool.o .libs/VSC_mgt.o .libs/VSC_sma.o .libs/VSC_smf.o .libs/VSC_smu.o .libs/VSC_vbe.o .libs/VSC_waiter.o libtool: link: ranlib .libs/libvsc.a libtool: link: ( cd ".libs" && rm -f "libvsc.la" && ln -s "../libvsc.la" "libvsc.la" ) make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' Making all in libvarnish make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vav_test-vav.o `test -f 'vav.c' || echo './'`vav.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vbh.lo `test -f 'vbh.c' || echo './'`vbh.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vas.lo `test -f 'vas.c' || echo './'`vas.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vav.lo `test -f 'vav.c' || echo './'`vav.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vbt.lo `test -f 'vbt.c' || echo './'`vbt.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vcli_proto.lo `test -f 'vcli_proto.c' || echo './'`vcli_proto.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vcli_serve.lo `test -f 'vcli_serve.c' || echo './'`vcli_serve.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vct.lo `test -f 'vct.c' || echo './'`vct.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-venc.lo `test -f 'venc.c' || echo './'`venc.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-version.lo `test -f 'version.c' || echo './'`version.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vev.lo `test -f 'vev.c' || echo './'`vev.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vfil.lo `test -f 'vfil.c' || echo './'`vfil.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vfl.lo `test -f 'vfl.c' || echo './'`vfl.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vin.lo `test -f 'vin.c' || echo './'`vin.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vjsn.lo `test -f 'vjsn.c' || echo './'`vjsn.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vlu.lo `test -f 'vlu.c' || echo './'`vlu.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vmb.lo `test -f 'vmb.c' || echo './'`vmb.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vnum.lo `test -f 'vnum.c' || echo './'`vnum.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vpf.lo `test -f 'vpf.c' || echo './'`vpf.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vre.lo `test -f 'vre.c' || echo './'`vre.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vrnd.lo `test -f 'vrnd.c' || echo './'`vrnd.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vsa.lo `test -f 'vsa.c' || echo './'`vsa.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vsb.lo `test -f 'vsb.c' || echo './'`vsb.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vsha256.lo `test -f 'vsha256.c' || echo './'`vsha256.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vss.lo `test -f 'vss.c' || echo './'`vss.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vsub.lo `test -f 'vsub.c' || echo './'`vsub.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vtcp.lo `test -f 'vtcp.c' || echo './'`vtcp.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vte.lo `test -f 'vte.c' || echo './'`vte.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vtim.lo `test -f 'vtim.c' || echo './'`vtim.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnish_la-vus.lo `test -f 'vus.c' || echo './'`vus.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vbh_test-vbh.o `test -f 'vbh.c' || echo './'`vbh.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vct_test-vct.o `test -f 'vct.c' || echo './'`vct.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVJSN_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vjsn_test-vjsn.o `test -f 'vjsn.c' || echo './'`vjsn.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DNUM_C_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vnum_c_test-vnum.o `test -f 'vnum.c' || echo './'`vnum.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVSB_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vsb_test-vsb_test.o `test -f 'vsb_test.c' || echo './'`vsb_test.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vte_test-vte.o `test -f 'vte.c' || echo './'`vte.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vtim_test-vtim.o `test -f 'vtim.c' || echo './'`vtim.c libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vbt.c -fPIC -DPIC -o .libs/libvarnish_la-vbt.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vin.c -fPIC -DPIC -o .libs/libvarnish_la-vin.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcli_serve.c -fPIC -DPIC -o .libs/libvarnish_la-vcli_serve.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vbh.c -fPIC -DPIC -o .libs/libvarnish_la-vbh.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vfl.c -fPIC -DPIC -o .libs/libvarnish_la-vfl.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vct.c -fPIC -DPIC -o .libs/libvarnish_la-vct.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcli_proto.c -fPIC -DPIC -o .libs/libvarnish_la-vcli_proto.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vfil.c -fPIC -DPIC -o .libs/libvarnish_la-vfil.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vav.c -fPIC -DPIC -o .libs/libvarnish_la-vav.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vas.c -fPIC -DPIC -o .libs/libvarnish_la-vas.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c venc.c -fPIC -DPIC -o .libs/libvarnish_la-venc.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c version.c -fPIC -DPIC -o .libs/libvarnish_la-version.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vlu.c -fPIC -DPIC -o .libs/libvarnish_la-vlu.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vev.c -fPIC -DPIC -o .libs/libvarnish_la-vev.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vjsn.c -fPIC -DPIC -o .libs/libvarnish_la-vjsn.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsa.c -fPIC -DPIC -o .libs/libvarnish_la-vsa.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vre.c -fPIC -DPIC -o .libs/libvarnish_la-vre.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsb.c -fPIC -DPIC -o .libs/libvarnish_la-vsb.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsub.c -fPIC -DPIC -o .libs/libvarnish_la-vsub.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vte.c -fPIC -DPIC -o .libs/libvarnish_la-vte.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vrnd.c -fPIC -DPIC -o .libs/libvarnish_la-vrnd.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vtim.c -fPIC -DPIC -o .libs/libvarnish_la-vtim.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vnum.c -fPIC -DPIC -o .libs/libvarnish_la-vnum.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmb.c -fPIC -DPIC -o .libs/libvarnish_la-vmb.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vtcp.c -fPIC -DPIC -o .libs/libvarnish_la-vtcp.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vss.c -fPIC -DPIC -o .libs/libvarnish_la-vss.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vpf.c -fPIC -DPIC -o .libs/libvarnish_la-vpf.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsha256.c -fPIC -DPIC -o .libs/libvarnish_la-vsha256.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vus.c -fPIC -DPIC -o .libs/libvarnish_la-vus.o /bin/bash ../../libtool --tag=CC --mode=link gcc -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o libvarnish.la libvarnish_la-vbh.lo libvarnish_la-vas.lo libvarnish_la-vav.lo libvarnish_la-vbt.lo libvarnish_la-vcli_proto.lo libvarnish_la-vcli_serve.lo libvarnish_la-vct.lo libvarnish_la-venc.lo libvarnish_la-version.lo libvarnish_la-vev.lo libvarnish_la-vfil.lo libvarnish_la-vfl.lo libvarnish_la-vin.lo libvarnish_la-vjsn.lo libvarnish_la-vlu.lo libvarnish_la-vmb.lo libvarnish_la-vnum.lo libvarnish_la-vpf.lo libvarnish_la-vre.lo libvarnish_la-vrnd.lo libvarnish_la-vsa.lo libvarnish_la-vsb.lo libvarnish_la-vsha256.lo libvarnish_la-vss.lo libvarnish_la-vsub.lo libvarnish_la-vtcp.lo libvarnish_la-vte.lo libvarnish_la-vtim.lo libvarnish_la-vus.lo -lpcre2-8 -lm -lpthread libtool: link: ar cr .libs/libvarnish.a .libs/libvarnish_la-vbh.o .libs/libvarnish_la-vas.o .libs/libvarnish_la-vav.o .libs/libvarnish_la-vbt.o .libs/libvarnish_la-vcli_proto.o .libs/libvarnish_la-vcli_serve.o .libs/libvarnish_la-vct.o .libs/libvarnish_la-venc.o .libs/libvarnish_la-version.o .libs/libvarnish_la-vev.o .libs/libvarnish_la-vfil.o .libs/libvarnish_la-vfl.o .libs/libvarnish_la-vin.o .libs/libvarnish_la-vjsn.o .libs/libvarnish_la-vlu.o .libs/libvarnish_la-vmb.o .libs/libvarnish_la-vnum.o .libs/libvarnish_la-vpf.o .libs/libvarnish_la-vre.o .libs/libvarnish_la-vrnd.o .libs/libvarnish_la-vsa.o .libs/libvarnish_la-vsb.o .libs/libvarnish_la-vsha256.o .libs/libvarnish_la-vss.o .libs/libvarnish_la-vsub.o .libs/libvarnish_la-vtcp.o .libs/libvarnish_la-vte.o .libs/libvarnish_la-vtim.o .libs/libvarnish_la-vus.o libtool: link: ranlib .libs/libvarnish.a libtool: link: ( cd ".libs" && rm -f "libvarnish.la" && ln -s "../libvarnish.la" "libvarnish.la" ) /bin/bash ../../libtool --tag=CC --mode=link gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vav_test vav_test-vav.o libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vbh_test vbh_test-vbh.o libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vct_test vct_test-vct.o libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DNUM_C_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vnum_c_test vnum_c_test-vnum.o libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DVJSN_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vjsn_test vjsn_test-vjsn.o libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DVSB_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vsb_test vsb_test-vsb_test.o libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vte_test vte_test-vte.o libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vtim_test vtim_test-vtim.o libvarnish.la -lpthread libtool: link: gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vct_test vct_test-vct.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vav_test vav_test-vav.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DVSB_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vsb_test vsb_test-vsb_test.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vbh_test vbh_test-vbh.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DNUM_C_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vnum_c_test vnum_c_test-vnum.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DVJSN_TEST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vjsn_test vjsn_test-vjsn.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vtim_test vtim_test-vtim.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vte_test vte_test-vte.o ./.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' Making all in libvarnishapi make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' /usr/bin/python3 ./generate.py . ../.. make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vsl2rst.o vsl2rst.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsc.o `test -f 'vsc.c' || echo './'`vsc.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsig.o `test -f 'vsig.c' || echo './'`vsig.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsl.o `test -f 'vsl.c' || echo './'`vsl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsl_arg.o `test -f 'vsl_arg.c' || echo './'`vsl_arg.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsl_cursor.o `test -f 'vsl_cursor.c' || echo './'`vsl_cursor.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsl_dispatch.o `test -f 'vsl_dispatch.c' || echo './'`vsl_dispatch.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsl_query.o `test -f 'vsl_query.c' || echo './'`vsl_query.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vsm.o `test -f 'vsm.c' || echo './'`vsm.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vut.o `test -f 'vut.c' || echo './'`vut.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vxp.o `test -f 'vxp.c' || echo './'`vxp.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vxp_fixed_token.o `test -f 'vxp_fixed_token.c' || echo './'`vxp_fixed_token.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vxp_lexer.o `test -f 'vxp_lexer.c' || echo './'`vxp_lexer.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vxp_parse.o `test -f 'vxp_parse.c' || echo './'`vxp_parse.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vxp_test-vxp_test.o `test -f 'vxp_test.c' || echo './'`vxp_test.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vsl_glob_test.o vsl_glob_test.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsc.lo `test -f 'vsc.c' || echo './'`vsc.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsig.lo `test -f 'vsig.c' || echo './'`vsig.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsl.lo `test -f 'vsl.c' || echo './'`vsl.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsl_arg.lo `test -f 'vsl_arg.c' || echo './'`vsl_arg.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsl_cursor.lo `test -f 'vsl_cursor.c' || echo './'`vsl_cursor.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsl_dispatch.lo `test -f 'vsl_dispatch.c' || echo './'`vsl_dispatch.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsl_query.lo `test -f 'vsl_query.c' || echo './'`vsl_query.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vsm.lo `test -f 'vsm.c' || echo './'`vsm.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vut.lo `test -f 'vut.c' || echo './'`vut.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vxp.lo `test -f 'vxp.c' || echo './'`vxp.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vxp_fixed_token.lo `test -f 'vxp_fixed_token.c' || echo './'`vxp_fixed_token.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vxp_lexer.lo `test -f 'vxp_lexer.c' || echo './'`vxp_lexer.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvarnishapi_la-vxp_parse.lo `test -f 'vxp_parse.c' || echo './'`vxp_parse.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vsl2rst vsl2rst.o -lpthread libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsl_arg.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsl_arg.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsl.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsl.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsl_cursor.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsl_cursor.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsig.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsig.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vxp.c -fPIC -DPIC -o .libs/libvarnishapi_la-vxp.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsl_dispatch.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsl_dispatch.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vxp_parse.c -fPIC -DPIC -o .libs/libvarnishapi_la-vxp_parse.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vut.c -fPIC -DPIC -o .libs/libvarnishapi_la-vut.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsc.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsc.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vxp_fixed_token.c -fPIC -DPIC -o .libs/libvarnishapi_la-vxp_fixed_token.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsl_query.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsl_query.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vxp_lexer.c -fPIC -DPIC -o .libs/libvarnishapi_la-vxp_lexer.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vsm.c -fPIC -DPIC -o .libs/libvarnishapi_la-vsm.o vsm.c: In function ‘VSM_Attach’: vsm.c:813:39: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 813 | (void)write(progress, "\n", 1); | ^~~~~~~~~~~~~~~~~~~~~~~~ vsm.c:819:39: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 819 | (void)write(progress, "\n", 1); | ^~~~~~~~~~~~~~~~~~~~~~~~ vsm.c:824:31: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 824 | (void)write(progress, ".", 1); | ^~~~~~~~~~~~~~~~~~~~~~~ libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vsl2rst vsl2rst.o -lpthread -pthread vsm.c: In function ‘VSM_Attach’: vsm.c:813:39: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 813 | (void)write(progress, "\n", 1); | ^~~~~~~~~~~~~~~~~~~~~~~~ vsm.c:819:39: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 819 | (void)write(progress, "\n", 1); | ^~~~~~~~~~~~~~~~~~~~~~~~ vsm.c:824:31: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 824 | (void)write(progress, ".", 1); | ^~~~~~~~~~~~~~~~~~~~~~~ /bin/bash ../../libtool --tag=CC --mode=link gcc -DVARNISH_STATE_DIR='"/var/lib/varnish"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -version-info 4:0:1 -Wl,--version-script=./libvarnishapi.map -Wl,-z,relro -Wl,-z,now -o libvarnishapi.la -rpath /usr/lib/x86_64-linux-gnu libvarnishapi_la-vsc.lo libvarnishapi_la-vsig.lo libvarnishapi_la-vsl.lo libvarnishapi_la-vsl_arg.lo libvarnishapi_la-vsl_cursor.lo libvarnishapi_la-vsl_dispatch.lo libvarnishapi_la-vsl_query.lo libvarnishapi_la-vsm.lo libvarnishapi_la-vut.lo libvarnishapi_la-vxp.lo libvarnishapi_la-vxp_fixed_token.lo libvarnishapi_la-vxp_lexer.lo libvarnishapi_la-vxp_parse.lo ../../lib/libvarnish/libvarnish.la -lm -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vxp_test vxp_test-vsc.o vxp_test-vsig.o vxp_test-vsl.o vxp_test-vsl_arg.o vxp_test-vsl_cursor.o vxp_test-vsl_dispatch.o vxp_test-vsl_query.o vxp_test-vsm.o vxp_test-vut.o vxp_test-vxp.o vxp_test-vxp_fixed_token.o vxp_test-vxp_lexer.o vxp_test-vxp_parse.o vxp_test-vxp_test.o ../../lib/libvarnish/libvarnish.la -lm -lpthread libtool: link: gcc -shared -fPIC -DPIC .libs/libvarnishapi_la-vsc.o .libs/libvarnishapi_la-vsig.o .libs/libvarnishapi_la-vsl.o .libs/libvarnishapi_la-vsl_arg.o .libs/libvarnishapi_la-vsl_cursor.o .libs/libvarnishapi_la-vsl_dispatch.o .libs/libvarnishapi_la-vsl_query.o .libs/libvarnishapi_la-vsm.o .libs/libvarnishapi_la-vut.o .libs/libvarnishapi_la-vxp.o .libs/libvarnishapi_la-vxp_fixed_token.o .libs/libvarnishapi_la-vxp_lexer.o .libs/libvarnishapi_la-vxp_parse.o -Wl,--whole-archive ../../lib/libvarnish/.libs/libvarnish.a -Wl,--no-whole-archive -lpcre2-8 -lm -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,--version-script=./libvarnishapi.map -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvarnishapi.so.3 -o .libs/libvarnishapi.so.3.1.0 libtool: link: (cd ".libs" && rm -f "libvarnishapi.so.3" && ln -s "libvarnishapi.so.3.1.0" "libvarnishapi.so.3") libtool: link: gcc -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -DVXP_DEBUG -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vxp_test vxp_test-vsc.o vxp_test-vsig.o vxp_test-vsl.o vxp_test-vsl_arg.o vxp_test-vsl_cursor.o vxp_test-vsl_dispatch.o vxp_test-vsl_query.o vxp_test-vsm.o vxp_test-vut.o vxp_test-vxp.o vxp_test-vxp_fixed_token.o vxp_test-vxp_lexer.o vxp_test-vxp_parse.o vxp_test-vxp_test.o ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: (cd ".libs" && rm -f "libvarnishapi.so" && ln -s "libvarnishapi.so.3.1.0" "libvarnishapi.so") libtool: link: ( cd ".libs" && rm -f "libvarnishapi.la" && ln -s "../libvarnishapi.la" "libvarnishapi.la" ) /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vsl_glob_test vsl_glob_test.o libvarnishapi.la -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/vsl_glob_test vsl_glob_test.o ./.libs/libvarnishapi.so -lpthread -pthread make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' Making all in libvcc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_acl.lo vcc_acl.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_action.lo vcc_action.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_backend.lo vcc_backend.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_backend_util.lo vcc_backend_util.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_compile.lo vcc_compile.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_expr.lo vcc_expr.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_fixed_token.lo vcc_fixed_token.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_obj.lo vcc_obj.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_parse.lo vcc_parse.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_source.lo vcc_source.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_storage.lo vcc_storage.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_symb.lo vcc_symb.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_token.lo vcc_token.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_types.lo vcc_types.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_utils.lo vcc_utils.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_var.lo vcc_var.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_vmod.lo vcc_vmod.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_vmod_sym.lo vcc_vmod_sym.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o vcc_xref.lo vcc_xref.c libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_parse.c -fPIC -DPIC -o .libs/vcc_parse.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_backend_util.c -fPIC -DPIC -o .libs/vcc_backend_util.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_action.c -fPIC -DPIC -o .libs/vcc_action.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_acl.c -fPIC -DPIC -o .libs/vcc_acl.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_fixed_token.c -fPIC -DPIC -o .libs/vcc_fixed_token.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_symb.c -fPIC -DPIC -o .libs/vcc_symb.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_types.c -fPIC -DPIC -o .libs/vcc_types.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_var.c -fPIC -DPIC -o .libs/vcc_var.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_backend.c -fPIC -DPIC -o .libs/vcc_backend.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_obj.c -fPIC -DPIC -o .libs/vcc_obj.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_expr.c -fPIC -DPIC -o .libs/vcc_expr.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_token.c -fPIC -DPIC -o .libs/vcc_token.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_vmod_sym.c -fPIC -DPIC -o .libs/vcc_vmod_sym.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_compile.c -fPIC -DPIC -o .libs/vcc_compile.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_storage.c -fPIC -DPIC -o .libs/vcc_storage.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_xref.c -fPIC -DPIC -o .libs/vcc_xref.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_source.c -fPIC -DPIC -o .libs/vcc_source.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_utils.c -fPIC -DPIC -o .libs/vcc_utils.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_vmod.c -fPIC -DPIC -o .libs/vcc_vmod.o /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o libvcc.la vcc_acl.lo vcc_action.lo vcc_backend.lo vcc_backend_util.lo vcc_compile.lo vcc_expr.lo vcc_fixed_token.lo vcc_obj.lo vcc_parse.lo vcc_source.lo vcc_storage.lo vcc_symb.lo vcc_token.lo vcc_types.lo vcc_utils.lo vcc_var.lo vcc_vmod.lo vcc_vmod_sym.lo vcc_xref.lo -lpthread libtool: link: ar cr .libs/libvcc.a .libs/vcc_acl.o .libs/vcc_action.o .libs/vcc_backend.o .libs/vcc_backend_util.o .libs/vcc_compile.o .libs/vcc_expr.o .libs/vcc_fixed_token.o .libs/vcc_obj.o .libs/vcc_parse.o .libs/vcc_source.o .libs/vcc_storage.o .libs/vcc_symb.o .libs/vcc_token.o .libs/vcc_types.o .libs/vcc_utils.o .libs/vcc_var.o .libs/vcc_vmod.o .libs/vcc_vmod_sym.o .libs/vcc_xref.o libtool: link: ranlib .libs/libvcc.a libtool: link: ( cd ".libs" && rm -f "libvcc.la" && ln -s "../libvcc.la" "libvcc.la" ) make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' Making all in libvgz make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o adler32.lo adler32.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o crc32.lo crc32.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o deflate.lo deflate.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o inffast.lo inffast.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o inflate.lo inflate.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o inftrees.lo inftrees.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o trees.lo trees.c /bin/bash ../../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o zutil.lo zutil.c libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c adler32.c -fPIC -DPIC -o .libs/adler32.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c inflate.c -fPIC -DPIC -o .libs/inflate.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c inffast.c -fPIC -DPIC -o .libs/inffast.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c deflate.c -fPIC -DPIC -o .libs/deflate.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c trees.c -fPIC -DPIC -o .libs/trees.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c inftrees.c -fPIC -DPIC -o .libs/inftrees.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c crc32.c -fPIC -DPIC -o .libs/crc32.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I../.. -Wdate-time -D_FORTIFY_SOURCE=2 -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c zutil.c -fPIC -DPIC -o .libs/zutil.o /bin/bash ../../libtool --tag=CC --mode=link gcc -D_LARGEFILE64_SOURCE=1 -DZLIB_CONST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o libvgz.la adler32.lo crc32.lo deflate.lo inffast.lo inflate.lo inftrees.lo trees.lo zutil.lo -lpthread libtool: link: ar cr .libs/libvgz.a .libs/adler32.o .libs/crc32.o .libs/deflate.o .libs/inffast.o .libs/inflate.o .libs/inftrees.o .libs/trees.o .libs/zutil.o libtool: link: ranlib .libs/libvgz.a libtool: link: ( cd ".libs" && rm -f "libvgz.la" && ln -s "../libvgz.la" "libvgz.la" ) make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' make[4]: Nothing to be done for 'all-am'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' Making all in bin make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' Making all in varnishadm make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -I/usr/include/editline -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishadm-varnishadm.o `test -f 'varnishadm.c' || echo './'`varnishadm.c /bin/bash ../../libtool --tag=CC --mode=link gcc -I/usr/include/editline -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishadm varnishadm-varnishadm.o ../../lib/libvarnishapi/libvarnishapi.la ../../lib/libvarnish/libvarnish.la -ledit -lm -lpthread libtool: link: gcc -I/usr/include/editline -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/varnishadm varnishadm-varnishadm.o ../../lib/libvarnishapi/.libs/libvarnishapi.so ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 -ledit -lm -lpthread -pthread make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' Making all in varnishd make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hpack/vhp_gen_hufdec.o hpack/vhp_gen_hufdec.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vhp_gen_hufdec hpack/vhp_gen_hufdec.o ../../lib/libvarnish/libvarnish.la -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vhp_gen_hufdec hpack/vhp_gen_hufdec.o ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread ./vhp_gen_hufdec > vhp_hufdec.h_ mv -f vhp_hufdec.h_ vhp_hufdec.h make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DTABLE_TEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hpack/vhp_table_test-vhp_table.o `test -f 'hpack/vhp_table.c' || echo './'`hpack/vhp_table.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DDECODE_TEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hpack/vhp_decode_test-vhp_decode.o `test -f 'hpack/vhp_decode.c' || echo './'`hpack/vhp_decode.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DDECODE_TEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hpack/vhp_decode_test-vhp_table.o `test -f 'hpack/vhp_table.c' || echo './'`hpack/vhp_table.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_backend.o `test -f 'cache/cache_backend.c' || echo './'`cache/cache_backend.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_backend_probe.o `test -f 'cache/cache_backend_probe.c' || echo './'`cache/cache_backend_probe.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_ban.o `test -f 'cache/cache_ban.c' || echo './'`cache/cache_ban.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_ban_build.o `test -f 'cache/cache_ban_build.c' || echo './'`cache/cache_ban_build.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_ban_lurker.o `test -f 'cache/cache_ban_lurker.c' || echo './'`cache/cache_ban_lurker.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_busyobj.o `test -f 'cache/cache_busyobj.c' || echo './'`cache/cache_busyobj.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_cli.o `test -f 'cache/cache_cli.c' || echo './'`cache/cache_cli.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_conn_pool.o `test -f 'cache/cache_conn_pool.c' || echo './'`cache/cache_conn_pool.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_deliver_proc.o `test -f 'cache/cache_deliver_proc.c' || echo './'`cache/cache_deliver_proc.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_director.o `test -f 'cache/cache_director.c' || echo './'`cache/cache_director.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_esi_deliver.o `test -f 'cache/cache_esi_deliver.c' || echo './'`cache/cache_esi_deliver.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_esi_fetch.o `test -f 'cache/cache_esi_fetch.c' || echo './'`cache/cache_esi_fetch.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_esi_parse.o `test -f 'cache/cache_esi_parse.c' || echo './'`cache/cache_esi_parse.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_expire.o `test -f 'cache/cache_expire.c' || echo './'`cache/cache_expire.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_fetch.o `test -f 'cache/cache_fetch.c' || echo './'`cache/cache_fetch.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_fetch_proc.o `test -f 'cache/cache_fetch_proc.c' || echo './'`cache/cache_fetch_proc.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_gzip.o `test -f 'cache/cache_gzip.c' || echo './'`cache/cache_gzip.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_hash.o `test -f 'cache/cache_hash.c' || echo './'`cache/cache_hash.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_http.o `test -f 'cache/cache_http.c' || echo './'`cache/cache_http.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_lck.o `test -f 'cache/cache_lck.c' || echo './'`cache/cache_lck.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_main.o `test -f 'cache/cache_main.c' || echo './'`cache/cache_main.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_mempool.o `test -f 'cache/cache_mempool.c' || echo './'`cache/cache_mempool.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_obj.o `test -f 'cache/cache_obj.c' || echo './'`cache/cache_obj.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_panic.o `test -f 'cache/cache_panic.c' || echo './'`cache/cache_panic.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_pool.o `test -f 'cache/cache_pool.c' || echo './'`cache/cache_pool.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_range.o `test -f 'cache/cache_range.c' || echo './'`cache/cache_range.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_req.o `test -f 'cache/cache_req.c' || echo './'`cache/cache_req.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_req_body.o `test -f 'cache/cache_req_body.c' || echo './'`cache/cache_req_body.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_req_fsm.o `test -f 'cache/cache_req_fsm.c' || echo './'`cache/cache_req_fsm.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_rfc2616.o `test -f 'cache/cache_rfc2616.c' || echo './'`cache/cache_rfc2616.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_session.o `test -f 'cache/cache_session.c' || echo './'`cache/cache_session.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_shmlog.o `test -f 'cache/cache_shmlog.c' || echo './'`cache/cache_shmlog.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vary.o `test -f 'cache/cache_vary.c' || echo './'`cache/cache_vary.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vcl.o `test -f 'cache/cache_vcl.c' || echo './'`cache/cache_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vpi.o `test -f 'cache/cache_vpi.c' || echo './'`cache/cache_vpi.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vrt.o `test -f 'cache/cache_vrt.c' || echo './'`cache/cache_vrt.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vrt_filter.o `test -f 'cache/cache_vrt_filter.c' || echo './'`cache/cache_vrt_filter.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vrt_priv.o `test -f 'cache/cache_vrt_priv.c' || echo './'`cache/cache_vrt_priv.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vrt_re.o `test -f 'cache/cache_vrt_re.c' || echo './'`cache/cache_vrt_re.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vrt_var.o `test -f 'cache/cache_vrt_var.c' || echo './'`cache/cache_vrt_var.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vrt_vcl.o `test -f 'cache/cache_vrt_vcl.c' || echo './'`cache/cache_vrt_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_vrt_vmod.o `test -f 'cache/cache_vrt_vmod.c' || echo './'`cache/cache_vrt_vmod.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_wrk.o `test -f 'cache/cache_wrk.c' || echo './'`cache/cache_wrk.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_ws_common.o `test -f 'cache/cache_ws_common.c' || echo './'`cache/cache_ws_common.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hpack/varnishd-vhp_decode.o `test -f 'hpack/vhp_decode.c' || echo './'`hpack/vhp_decode.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hpack/varnishd-vhp_table.o `test -f 'hpack/vhp_table.c' || echo './'`hpack/vhp_table.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/varnishd-cache_ws.o `test -f 'cache/cache_ws.c' || echo './'`cache/cache_ws.c echo '/*' > builtin_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DENABLE_WORKSPACE_EMULATOR -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/esi_parse_fuzzer-cache_ws_emu.o `test -f 'cache/cache_ws_emu.c' || echo './'`cache/cache_ws_emu.c echo ' * NB: This file is machine generated, DO NOT EDIT!' >> builtin_vcl.c echo ' *' >> builtin_vcl.c echo ' * Edit builtin.vcl instead and run make' >> builtin_vcl.c echo ' *' >> builtin_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DENABLE_WORKSPACE_EMULATOR -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/esi_parse_fuzzer-cache_ws_common.o `test -f 'cache/cache_ws_common.c' || echo './'`cache/cache_ws_common.c echo ' */' >> builtin_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DENABLE_WORKSPACE_EMULATOR -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o cache/esi_parse_fuzzer-cache_esi_parse.o `test -f 'cache/cache_esi_parse.c' || echo './'`cache/cache_esi_parse.c echo '#include "config.h"' >> builtin_vcl.c echo '#include "mgt/mgt.h"' >> builtin_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DENABLE_WORKSPACE_EMULATOR -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o fuzzers/esi_parse_fuzzer-esi_parse_fuzzer.o `test -f 'fuzzers/esi_parse_fuzzer.c' || echo './'`fuzzers/esi_parse_fuzzer.c echo '' >> builtin_vcl.c echo 'const char * const builtin_vcl =' >> builtin_vcl.c sed -e 's/"/\\"/g' \ -e 's/$/\\n"/' \ -e 's/^/ "/' ./builtin.vcl >> builtin_vcl.c echo ';' >> builtin_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o acceptor/varnishd-cache_acceptor.o `test -f 'acceptor/cache_acceptor.c' || echo './'`acceptor/cache_acceptor.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o acceptor/varnishd-cache_acceptor_tcp.o `test -f 'acceptor/cache_acceptor_tcp.c' || echo './'`acceptor/cache_acceptor_tcp.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o acceptor/varnishd-cache_acceptor_uds.o `test -f 'acceptor/cache_acceptor_uds.c' || echo './'`acceptor/cache_acceptor_uds.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o acceptor/varnishd-mgt_acceptor.o `test -f 'acceptor/mgt_acceptor.c' || echo './'`acceptor/mgt_acceptor.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o acceptor/varnishd-mgt_acceptor_tcp.o `test -f 'acceptor/mgt_acceptor_tcp.c' || echo './'`acceptor/mgt_acceptor_tcp.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o acceptor/varnishd-mgt_acceptor_uds.o `test -f 'acceptor/mgt_acceptor_uds.c' || echo './'`acceptor/mgt_acceptor_uds.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o common/varnishd-common_vsc.o `test -f 'common/common_vsc.c' || echo './'`common/common_vsc.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o common/varnishd-common_vsmw.o `test -f 'common/common_vsmw.c' || echo './'`common/common_vsmw.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o common/varnishd-common_vext.o `test -f 'common/common_vext.c' || echo './'`common/common_vext.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hash/varnishd-hash_classic.o `test -f 'hash/hash_classic.c' || echo './'`hash/hash_classic.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hash/varnishd-hash_critbit.o `test -f 'hash/hash_critbit.c' || echo './'`hash/hash_critbit.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hash/varnishd-hash_simple_list.o `test -f 'hash/hash_simple_list.c' || echo './'`hash/hash_simple_list.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o hash/varnishd-mgt_hash.o `test -f 'hash/mgt_hash.c' || echo './'`hash/mgt_hash.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http1/varnishd-cache_http1_deliver.o `test -f 'http1/cache_http1_deliver.c' || echo './'`http1/cache_http1_deliver.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http1/varnishd-cache_http1_fetch.o `test -f 'http1/cache_http1_fetch.c' || echo './'`http1/cache_http1_fetch.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http1/varnishd-cache_http1_fsm.o `test -f 'http1/cache_http1_fsm.c' || echo './'`http1/cache_http1_fsm.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http1/varnishd-cache_http1_line.o `test -f 'http1/cache_http1_line.c' || echo './'`http1/cache_http1_line.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http1/varnishd-cache_http1_pipe.o `test -f 'http1/cache_http1_pipe.c' || echo './'`http1/cache_http1_pipe.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http1/varnishd-cache_http1_proto.o `test -f 'http1/cache_http1_proto.c' || echo './'`http1/cache_http1_proto.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http1/varnishd-cache_http1_vfp.o `test -f 'http1/cache_http1_vfp.c' || echo './'`http1/cache_http1_vfp.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http2/varnishd-cache_http2_deliver.o `test -f 'http2/cache_http2_deliver.c' || echo './'`http2/cache_http2_deliver.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http2/varnishd-cache_http2_hpack.o `test -f 'http2/cache_http2_hpack.c' || echo './'`http2/cache_http2_hpack.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http2/varnishd-cache_http2_panic.o `test -f 'http2/cache_http2_panic.c' || echo './'`http2/cache_http2_panic.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http2/varnishd-cache_http2_proto.o `test -f 'http2/cache_http2_proto.c' || echo './'`http2/cache_http2_proto.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http2/varnishd-cache_http2_send.o `test -f 'http2/cache_http2_send.c' || echo './'`http2/cache_http2_send.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o http2/varnishd-cache_http2_session.o `test -f 'http2/cache_http2_session.c' || echo './'`http2/cache_http2_session.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_child.o `test -f 'mgt/mgt_child.c' || echo './'`mgt/mgt_child.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_cli.o `test -f 'mgt/mgt_cli.c' || echo './'`mgt/mgt_cli.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_jail.o `test -f 'mgt/mgt_jail.c' || echo './'`mgt/mgt_jail.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_jail_solaris.o `test -f 'mgt/mgt_jail_solaris.c' || echo './'`mgt/mgt_jail_solaris.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_jail_unix.o `test -f 'mgt/mgt_jail_unix.c' || echo './'`mgt/mgt_jail_unix.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_jail_linux.o `test -f 'mgt/mgt_jail_linux.c' || echo './'`mgt/mgt_jail_linux.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_main.o `test -f 'mgt/mgt_main.c' || echo './'`mgt/mgt_main.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_param.o `test -f 'mgt/mgt_param.c' || echo './'`mgt/mgt_param.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_param_tcp.o `test -f 'mgt/mgt_param_tcp.c' || echo './'`mgt/mgt_param_tcp.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_param_tweak.o `test -f 'mgt/mgt_param_tweak.c' || echo './'`mgt/mgt_param_tweak.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_shmem.o `test -f 'mgt/mgt_shmem.c' || echo './'`mgt/mgt_shmem.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_symtab.o `test -f 'mgt/mgt_symtab.c' || echo './'`mgt/mgt_symtab.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_util.o `test -f 'mgt/mgt_util.c' || echo './'`mgt/mgt_util.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_vcc.o `test -f 'mgt/mgt_vcc.c' || echo './'`mgt/mgt_vcc.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o mgt/varnishd-mgt_vcl.o `test -f 'mgt/mgt_vcl.c' || echo './'`mgt/mgt_vcl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o proxy/varnishd-cache_proxy_proto.o `test -f 'proxy/cache_proxy_proto.c' || echo './'`proxy/cache_proxy_proto.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-mgt_stevedore.o `test -f 'storage/mgt_stevedore.c' || echo './'`storage/mgt_stevedore.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-stevedore.o `test -f 'storage/stevedore.c' || echo './'`storage/stevedore.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-stevedore_utils.o `test -f 'storage/stevedore_utils.c' || echo './'`storage/stevedore_utils.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-storage_file.o `test -f 'storage/storage_file.c' || echo './'`storage/storage_file.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-storage_lru.o `test -f 'storage/storage_lru.c' || echo './'`storage/storage_lru.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-storage_malloc.o `test -f 'storage/storage_malloc.c' || echo './'`storage/storage_malloc.c mgt/mgt_main.c: In function ‘mgt_Cflag_atexit’: mgt/mgt_main.c:335:15: warning: ignoring return value of ‘chdir’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 335 | (void)chdir("/"); | ^~~~~~~~~~ gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-storage_debug.o `test -f 'storage/storage_debug.c' || echo './'`storage/storage_debug.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-storage_simple.o `test -f 'storage/storage_simple.c' || echo './'`storage/storage_simple.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o storage/varnishd-storage_umem.o `test -f 'storage/storage_umem.c' || echo './'`storage/storage_umem.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o waiter/varnishd-cache_waiter.o `test -f 'waiter/cache_waiter.c' || echo './'`waiter/cache_waiter.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o waiter/varnishd-cache_waiter_epoll.o `test -f 'waiter/cache_waiter_epoll.c' || echo './'`waiter/cache_waiter_epoll.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o waiter/varnishd-cache_waiter_kqueue.o `test -f 'waiter/cache_waiter_kqueue.c' || echo './'`waiter/cache_waiter_kqueue.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o waiter/varnishd-cache_waiter_poll.o `test -f 'waiter/cache_waiter_poll.c' || echo './'`waiter/cache_waiter_poll.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o waiter/varnishd-cache_waiter_ports.o `test -f 'waiter/cache_waiter_ports.c' || echo './'`waiter/cache_waiter_ports.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o waiter/varnishd-mgt_waiter.o `test -f 'waiter/mgt_waiter.c' || echo './'`waiter/mgt_waiter.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../lib/libvgz -I../../bin/varnishd -I../../include -I../../lib/libvsc -Wdate-time -D_FORTIFY_SOURCE=2 -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishd-builtin_vcl.o `test -f 'builtin_vcl.c' || echo './'`builtin_vcl.c /bin/bash ../../libtool --tag=CC --mode=link gcc -DTABLE_TEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vhp_table_test hpack/vhp_table_test-vhp_table.o ../../lib/libvarnish/libvarnish.la -lpthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DDECODE_TEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o vhp_decode_test hpack/vhp_decode_test-vhp_decode.o hpack/vhp_decode_test-vhp_table.o ../../lib/libvarnish/libvarnish.la -lpthread libtool: link: gcc -DTABLE_TEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vhp_table_test hpack/vhp_table_test-vhp_table.o ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread libtool: link: gcc -DDECODE_TEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o vhp_decode_test hpack/vhp_decode_test-vhp_decode.o hpack/vhp_decode_test-vhp_table.o ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DNOT_IN_A_VMOD -DENABLE_WORKSPACE_EMULATOR -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o esi_parse_fuzzer cache/esi_parse_fuzzer-cache_ws_emu.o cache/esi_parse_fuzzer-cache_ws_common.o cache/esi_parse_fuzzer-cache_esi_parse.o fuzzers/esi_parse_fuzzer-esi_parse_fuzzer.o ../../lib/libvarnish/libvarnish.la ../../lib/libvgz/libvgz.la -lpthread libtool: link: gcc -DNOT_IN_A_VMOD -DENABLE_WORKSPACE_EMULATOR -DTEST_DRIVER -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o esi_parse_fuzzer cache/esi_parse_fuzzer-cache_ws_emu.o cache/esi_parse_fuzzer-cache_ws_common.o cache/esi_parse_fuzzer-cache_esi_parse.o fuzzers/esi_parse_fuzzer-esi_parse_fuzzer.o ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 -lm ../../lib/libvgz/.libs/libvgz.a -lpthread -pthread /bin/bash ../../libtool --tag=CC --mode=link gcc -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR='"/var/lib/varnish"' -DVARNISH_VMOD_DIR='"/usr/lib/x86_64-linux-gnu/varnish/vmods"' -DVARNISH_VCL_DIR='"/etc/varnish:/usr/share/varnish/vcl"' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-dynamic -Wl,-z,relro -Wl,-z,now -o varnishd acceptor/varnishd-cache_acceptor.o acceptor/varnishd-cache_acceptor_tcp.o acceptor/varnishd-cache_acceptor_uds.o acceptor/varnishd-mgt_acceptor.o acceptor/varnishd-mgt_acceptor_tcp.o acceptor/varnishd-mgt_acceptor_uds.o cache/varnishd-cache_backend.o cache/varnishd-cache_backend_probe.o cache/varnishd-cache_ban.o cache/varnishd-cache_ban_build.o cache/varnishd-cache_ban_lurker.o cache/varnishd-cache_busyobj.o cache/varnishd-cache_cli.o cache/varnishd-cache_conn_pool.o cache/varnishd-cache_deliver_proc.o cache/varnishd-cache_director.o cache/varnishd-cache_esi_deliver.o cache/varnishd-cache_esi_fetch.o cache/varnishd-cache_esi_parse.o cache/varnishd-cache_expire.o cache/varnishd-cache_fetch.o cache/varnishd-cache_fetch_proc.o cache/varnishd-cache_gzip.o cache/varnishd-cache_hash.o cache/varnishd-cache_http.o cache/varnishd-cache_lck.o cache/varnishd-cache_main.o cache/varnishd-cache_mempool.o cache/varnishd-cache_obj.o cache/varnishd-cache_panic.o cache/varnishd-cache_pool.o cache/varnishd-cache_range.o cache/varnishd-cache_req.o cache/varnishd-cache_req_body.o cache/varnishd-cache_req_fsm.o cache/varnishd-cache_rfc2616.o cache/varnishd-cache_session.o cache/varnishd-cache_shmlog.o cache/varnishd-cache_vary.o cache/varnishd-cache_vcl.o cache/varnishd-cache_vpi.o cache/varnishd-cache_vrt.o cache/varnishd-cache_vrt_filter.o cache/varnishd-cache_vrt_priv.o cache/varnishd-cache_vrt_re.o cache/varnishd-cache_vrt_var.o cache/varnishd-cache_vrt_vcl.o cache/varnishd-cache_vrt_vmod.o cache/varnishd-cache_wrk.o cache/varnishd-cache_ws_common.o common/varnishd-common_vsc.o common/varnishd-common_vsmw.o common/varnishd-common_vext.o hash/varnishd-hash_classic.o hash/varnishd-hash_critbit.o hash/varnishd-hash_simple_list.o hash/varnishd-mgt_hash.o hpack/varnishd-vhp_decode.o hpack/varnishd-vhp_table.o http1/varnishd-cache_http1_deliver.o http1/varnishd-cache_http1_fetch.o http1/varnishd-cache_http1_fsm.o http1/varnishd-cache_http1_line.o http1/varnishd-cache_http1_pipe.o http1/varnishd-cache_http1_proto.o http1/varnishd-cache_http1_vfp.o http2/varnishd-cache_http2_deliver.o http2/varnishd-cache_http2_hpack.o http2/varnishd-cache_http2_panic.o http2/varnishd-cache_http2_proto.o http2/varnishd-cache_http2_send.o http2/varnishd-cache_http2_session.o mgt/varnishd-mgt_child.o mgt/varnishd-mgt_cli.o mgt/varnishd-mgt_jail.o mgt/varnishd-mgt_jail_solaris.o mgt/varnishd-mgt_jail_unix.o mgt/varnishd-mgt_jail_linux.o mgt/varnishd-mgt_main.o mgt/varnishd-mgt_param.o mgt/varnishd-mgt_param_tcp.o mgt/varnishd-mgt_param_tweak.o mgt/varnishd-mgt_shmem.o mgt/varnishd-mgt_symtab.o mgt/varnishd-mgt_util.o mgt/varnishd-mgt_vcc.o mgt/varnishd-mgt_vcl.o proxy/varnishd-cache_proxy_proto.o storage/varnishd-mgt_stevedore.o storage/varnishd-stevedore.o storage/varnishd-stevedore_utils.o storage/varnishd-storage_file.o storage/varnishd-storage_lru.o storage/varnishd-storage_malloc.o storage/varnishd-storage_debug.o storage/varnishd-storage_simple.o storage/varnishd-storage_umem.o waiter/varnishd-cache_waiter.o waiter/varnishd-cache_waiter_epoll.o waiter/varnishd-cache_waiter_kqueue.o waiter/varnishd-cache_waiter_poll.o waiter/varnishd-cache_waiter_ports.o waiter/varnishd-mgt_waiter.o cache/varnishd-cache_ws.o varnishd-builtin_vcl.o ../../lib/libvcc/libvcc.la ../../lib/libvarnish/libvarnish.la ../../lib/libvsc/libvsc.la ../../lib/libvgz/libvgz.la -ljemalloc -ldl -lm -lpthread libtool: link: gcc -DNOT_IN_A_VMOD -DVARNISH_STATE_DIR=\"/var/lib/varnish\" -DVARNISH_VMOD_DIR=\"/usr/lib/x86_64-linux-gnu/varnish/vmods\" -DVARNISH_VCL_DIR=\"/etc/varnish:/usr/share/varnish/vcl\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o varnishd acceptor/varnishd-cache_acceptor.o acceptor/varnishd-cache_acceptor_tcp.o acceptor/varnishd-cache_acceptor_uds.o acceptor/varnishd-mgt_acceptor.o acceptor/varnishd-mgt_acceptor_tcp.o acceptor/varnishd-mgt_acceptor_uds.o cache/varnishd-cache_backend.o cache/varnishd-cache_backend_probe.o cache/varnishd-cache_ban.o cache/varnishd-cache_ban_build.o cache/varnishd-cache_ban_lurker.o cache/varnishd-cache_busyobj.o cache/varnishd-cache_cli.o cache/varnishd-cache_conn_pool.o cache/varnishd-cache_deliver_proc.o cache/varnishd-cache_director.o cache/varnishd-cache_esi_deliver.o cache/varnishd-cache_esi_fetch.o cache/varnishd-cache_esi_parse.o cache/varnishd-cache_expire.o cache/varnishd-cache_fetch.o cache/varnishd-cache_fetch_proc.o cache/varnishd-cache_gzip.o cache/varnishd-cache_hash.o cache/varnishd-cache_http.o cache/varnishd-cache_lck.o cache/varnishd-cache_main.o cache/varnishd-cache_mempool.o cache/varnishd-cache_obj.o cache/varnishd-cache_panic.o cache/varnishd-cache_pool.o cache/varnishd-cache_range.o cache/varnishd-cache_req.o cache/varnishd-cache_req_body.o cache/varnishd-cache_req_fsm.o cache/varnishd-cache_rfc2616.o cache/varnishd-cache_session.o cache/varnishd-cache_shmlog.o cache/varnishd-cache_vary.o cache/varnishd-cache_vcl.o cache/varnishd-cache_vpi.o cache/varnishd-cache_vrt.o cache/varnishd-cache_vrt_filter.o cache/varnishd-cache_vrt_priv.o cache/varnishd-cache_vrt_re.o cache/varnishd-cache_vrt_var.o cache/varnishd-cache_vrt_vcl.o cache/varnishd-cache_vrt_vmod.o cache/varnishd-cache_wrk.o cache/varnishd-cache_ws_common.o common/varnishd-common_vsc.o common/varnishd-common_vsmw.o common/varnishd-common_vext.o hash/varnishd-hash_classic.o hash/varnishd-hash_critbit.o hash/varnishd-hash_simple_list.o hash/varnishd-mgt_hash.o hpack/varnishd-vhp_decode.o hpack/varnishd-vhp_table.o http1/varnishd-cache_http1_deliver.o http1/varnishd-cache_http1_fetch.o http1/varnishd-cache_http1_fsm.o http1/varnishd-cache_http1_line.o http1/varnishd-cache_http1_pipe.o http1/varnishd-cache_http1_proto.o http1/varnishd-cache_http1_vfp.o http2/varnishd-cache_http2_deliver.o http2/varnishd-cache_http2_hpack.o http2/varnishd-cache_http2_panic.o http2/varnishd-cache_http2_proto.o http2/varnishd-cache_http2_send.o http2/varnishd-cache_http2_session.o mgt/varnishd-mgt_child.o mgt/varnishd-mgt_cli.o mgt/varnishd-mgt_jail.o mgt/varnishd-mgt_jail_solaris.o mgt/varnishd-mgt_jail_unix.o mgt/varnishd-mgt_jail_linux.o mgt/varnishd-mgt_main.o mgt/varnishd-mgt_param.o mgt/varnishd-mgt_param_tcp.o mgt/varnishd-mgt_param_tweak.o mgt/varnishd-mgt_shmem.o mgt/varnishd-mgt_symtab.o mgt/varnishd-mgt_util.o mgt/varnishd-mgt_vcc.o mgt/varnishd-mgt_vcl.o proxy/varnishd-cache_proxy_proto.o storage/varnishd-mgt_stevedore.o storage/varnishd-stevedore.o storage/varnishd-stevedore_utils.o storage/varnishd-storage_file.o storage/varnishd-storage_lru.o storage/varnishd-storage_malloc.o storage/varnishd-storage_debug.o storage/varnishd-storage_simple.o storage/varnishd-storage_umem.o waiter/varnishd-cache_waiter.o waiter/varnishd-cache_waiter_epoll.o waiter/varnishd-cache_waiter_kqueue.o waiter/varnishd-cache_waiter_poll.o waiter/varnishd-cache_waiter_ports.o waiter/varnishd-mgt_waiter.o cache/varnishd-cache_ws.o varnishd-builtin_vcl.o -Wl,--export-dynamic ../../lib/libvcc/.libs/libvcc.a ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 ../../lib/libvsc/.libs/libvsc.a ../../lib/libvgz/.libs/libvgz.a -ljemalloc -ldl -lm -lpthread -pthread make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' Making all in varnishhist make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -D_DEFAULT_SOURCE -D_XOPEN_SOURCE=600 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishhist.o varnishhist.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishhist varnishhist.o ../../lib/libvarnishapi/libvarnishapi.la -lm -lncursesw -ltinfo -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/varnishhist varnishhist.o ../../lib/libvarnishapi/.libs/libvarnishapi.so -lm -lncursesw -ltinfo -lpthread -pthread make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' Making all in varnishlog make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishlog.o varnishlog.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishlog varnishlog.o ../../lib/libvarnishapi/libvarnishapi.la -lm -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/varnishlog varnishlog.o ../../lib/libvarnishapi/.libs/libvarnishapi.so -lm -lpthread -pthread make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' Making all in varnishncsa make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishncsa.o varnishncsa.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishncsa varnishncsa.o ../../lib/libvarnishapi/libvarnishapi.la -lm -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/varnishncsa varnishncsa.o ../../lib/libvarnishapi/.libs/libvarnishapi.so -lm -lpthread -pthread make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' Making all in varnishstat make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -D_DEFAULT_SOURCE -D_XOPEN_SOURCE=600 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishstat_help_gen.o varnishstat_help_gen.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishstat_help_gen varnishstat_help_gen.o ../../lib/libvarnish/libvarnish.la -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o varnishstat_help_gen varnishstat_help_gen.o ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 -lm -lpthread -pthread ./varnishstat_help_gen >varnishstat_curses_help.c_ make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -D_DEFAULT_SOURCE -D_XOPEN_SOURCE=600 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishstat.o varnishstat.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -D_DEFAULT_SOURCE -D_XOPEN_SOURCE=600 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishstat_curses.o varnishstat_curses.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -D_DEFAULT_SOURCE -D_XOPEN_SOURCE=600 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishstat_curses_help.o varnishstat_curses_help.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishstat varnishstat.o varnishstat_curses.o varnishstat_curses_help.o ../../lib/libvarnishapi/libvarnishapi.la -lncursesw -ltinfo -lm -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/varnishstat varnishstat.o varnishstat_curses.o varnishstat_curses_help.o ../../lib/libvarnishapi/.libs/libvarnishapi.so -lncursesw -ltinfo -lm -lpthread -pthread make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' Making all in varnishtop make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -D_DEFAULT_SOURCE -D_XOPEN_SOURCE=600 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtop.o varnishtop.c /bin/bash ../../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishtop varnishtop.o ../../lib/libvarnishapi/libvarnishapi.la -lncursesw -ltinfo -lm -lpthread libtool: link: gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/varnishtop varnishtop.o ../../lib/libvarnishapi/.libs/libvarnishapi.so -lncursesw -ltinfo -lm -lpthread -pthread make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' Making all in varnishtest make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' /usr/bin/python3 ./huffman_gen.py \ ../../include/tbl/vhp_huffman.h > vtc_h2_dectbl.h_ mv vtc_h2_dectbl.h_ vtc_h2_dectbl.h make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' awk -f ./gensequences ./sequences \ > ./teken_state.h gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc.o `test -f 'vtc.c' || echo './'`vtc.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_barrier.o `test -f 'vtc_barrier.c' || echo './'`vtc_barrier.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_client.o `test -f 'vtc_client.c' || echo './'`vtc_client.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_gzip.o `test -f 'vtc_gzip.c' || echo './'`vtc_gzip.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_haproxy.o `test -f 'vtc_haproxy.c' || echo './'`vtc_haproxy.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_h2_hpack.o `test -f 'vtc_h2_hpack.c' || echo './'`vtc_h2_hpack.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_h2_tbl.o `test -f 'vtc_h2_tbl.c' || echo './'`vtc_h2_tbl.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_http.o `test -f 'vtc_http.c' || echo './'`vtc_http.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_http2.o `test -f 'vtc_http2.c' || echo './'`vtc_http2.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_log.o `test -f 'vtc_log.c' || echo './'`vtc_log.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_logexp.o `test -f 'vtc_logexp.c' || echo './'`vtc_logexp.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_misc.o `test -f 'vtc_misc.c' || echo './'`vtc_misc.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_main.o `test -f 'vtc_main.c' || echo './'`vtc_main.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_process.o `test -f 'vtc_process.c' || echo './'`vtc_process.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_proxy.o `test -f 'vtc_proxy.c' || echo './'`vtc_proxy.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_server.o `test -f 'vtc_server.c' || echo './'`vtc_server.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_sess.o `test -f 'vtc_sess.c' || echo './'`vtc_sess.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_subr.o `test -f 'vtc_subr.c' || echo './'`vtc_subr.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_syslog.o `test -f 'vtc_syslog.c' || echo './'`vtc_syslog.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_tunnel.o `test -f 'vtc_tunnel.c' || echo './'`vtc_tunnel.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_varnish.o `test -f 'vtc_varnish.c' || echo './'`vtc_varnish.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-vtc_vsm.o `test -f 'vtc_vsm.c' || echo './'`vtc_vsm.c gcc -DHAVE_CONFIG_H -I. -I../.. -I../../include -I../../include -I../../lib/libvgz -Wdate-time -D_FORTIFY_SOURCE=2 -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o varnishtest-teken.o `test -f 'teken.c' || echo './'`teken.c vtc_main.c: In function ‘cleaner_setup’: vtc_main.c:237:23: warning: ignoring return value of ‘nice’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 237 | (void)nice(1); /* Not important */ | ^~~~~~~ /bin/bash ../../libtool --tag=CC --mode=link gcc -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR='"../.."' -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -Wl,-z,relro -Wl,-z,now -o varnishtest varnishtest-teken.o varnishtest-vtc.o varnishtest-vtc_barrier.o varnishtest-vtc_client.o varnishtest-vtc_gzip.o varnishtest-vtc_haproxy.o varnishtest-vtc_h2_hpack.o varnishtest-vtc_h2_tbl.o varnishtest-vtc_http.o varnishtest-vtc_http2.o varnishtest-vtc_log.o varnishtest-vtc_logexp.o varnishtest-vtc_misc.o varnishtest-vtc_main.o varnishtest-vtc_process.o varnishtest-vtc_proxy.o varnishtest-vtc_server.o varnishtest-vtc_sess.o varnishtest-vtc_subr.o varnishtest-vtc_syslog.o varnishtest-vtc_tunnel.o varnishtest-vtc_varnish.o varnishtest-vtc_vsm.o ../../lib/libvarnishapi/libvarnishapi.la ../../lib/libvarnish/libvarnish.la ../../lib/libvgz/libvgz.la -lm -lpthread libtool: link: gcc -DVTEST_WITH_VTC_LOGEXPECT -DVTEST_WITH_VTC_VARNISH -DVTEST_WITH_VTC_VSM -DTOP_BUILDDIR=\"../..\" -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -Wall -Werror -Wno-error=unused-result -Wl,-z -Wl,relro -Wl,-z -Wl,now -o .libs/varnishtest varnishtest-teken.o varnishtest-vtc.o varnishtest-vtc_barrier.o varnishtest-vtc_client.o varnishtest-vtc_gzip.o varnishtest-vtc_haproxy.o varnishtest-vtc_h2_hpack.o varnishtest-vtc_h2_tbl.o varnishtest-vtc_http.o varnishtest-vtc_http2.o varnishtest-vtc_log.o varnishtest-vtc_logexp.o varnishtest-vtc_misc.o varnishtest-vtc_main.o varnishtest-vtc_process.o varnishtest-vtc_proxy.o varnishtest-vtc_server.o varnishtest-vtc_sess.o varnishtest-vtc_subr.o varnishtest-vtc_syslog.o varnishtest-vtc_tunnel.o varnishtest-vtc_varnish.o varnishtest-vtc_vsm.o ../../lib/libvarnishapi/.libs/libvarnishapi.so ../../lib/libvarnish/.libs/libvarnish.a -lpcre2-8 ../../lib/libvgz/.libs/libvgz.a -lm -lpthread -pthread make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' make[4]: Nothing to be done for 'all-am'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' Making all in vmod make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/vmod' /usr/bin/python3 ../lib/libvsc/vsctool.py -c VSC_debug.vsc /usr/bin/python3 ../lib/libvsc/vsctool.py -h VSC_debug.vsc make all-am make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/vmod' /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_blob_if ./vmod_blob.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_h2_if ./vmod_h2.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_cookie_if ./vmod_cookie.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --boilerplate -o vcc_debug_if ./vmod_debug.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_directors_if ./vmod_directors.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_proxy_if ./vmod_proxy.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_purge_if ./vmod_purge.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_std_if ./vmod_std.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_unix_if ./vmod_unix.vcc /usr/bin/python3 ../lib/libvcc/vmodtool.py --strict --boilerplate -o vcc_vtc_if ./vmod_vtc.vcc touch vcc_purge_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_purge_la-vmod_purge.lo `test -f 'vmod_purge.c' || echo './'`vmod_purge.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_purge_la-vcc_purge_if.lo `test -f 'vcc_purge_if.c' || echo './'`vcc_purge_if.c touch vcc_cookie_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_cookie_la-vmod_cookie.lo `test -f 'vmod_cookie.c' || echo './'`vmod_cookie.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_cookie_la-vcc_cookie_if.lo `test -f 'vcc_cookie_if.c' || echo './'`vcc_cookie_if.c WARNING: Not emitting .RST for $Event event_function WARNING: Not emitting .RST for $Event event_function touch vcc_blob_if.c touch vcc_vtc_if.c touch vcc_proxy_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_blob_la-vmod_blob.lo `test -f 'vmod_blob.c' || echo './'`vmod_blob.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_blob_la-vmod_blob_base64.lo `test -f 'vmod_blob_base64.c' || echo './'`vmod_blob_base64.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_blob_la-vmod_blob_hex.lo `test -f 'vmod_blob_hex.c' || echo './'`vmod_blob_hex.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_blob_la-vmod_blob_id.lo `test -f 'vmod_blob_id.c' || echo './'`vmod_blob_id.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_blob_la-vmod_blob_url.lo `test -f 'vmod_blob_url.c' || echo './'`vmod_blob_url.c touch vcc_h2_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_blob_la-vcc_blob_if.lo `test -f 'vcc_blob_if.c' || echo './'`vcc_blob_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_proxy_la-vmod_proxy.lo `test -f 'vmod_proxy.c' || echo './'`vmod_proxy.c touch vcc_unix_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_proxy_la-vcc_proxy_if.lo `test -f 'vcc_proxy_if.c' || echo './'`vcc_proxy_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_vtc_la-vmod_vtc.lo `test -f 'vmod_vtc.c' || echo './'`vmod_vtc.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_vtc_la-vcc_vtc_if.lo `test -f 'vcc_vtc_if.c' || echo './'`vcc_vtc_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_h2_la-vmod_h2.lo `test -f 'vmod_h2.c' || echo './'`vmod_h2.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_h2_la-vcc_h2_if.lo `test -f 'vcc_h2_if.c' || echo './'`vcc_h2_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_unix_la-vmod_unix.lo `test -f 'vmod_unix.c' || echo './'`vmod_unix.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_unix_la-vcc_unix_if.lo `test -f 'vcc_unix_if.c' || echo './'`vcc_unix_if.c touch vcc_directors_if.c touch vcc_debug_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors.lo `test -f 'vmod_directors.c' || echo './'`vmod_directors.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors_fall_back.lo `test -f 'vmod_directors_fall_back.c' || echo './'`vmod_directors_fall_back.c touch vcc_std_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors_hash.lo `test -f 'vmod_directors_hash.c' || echo './'`vmod_directors_hash.c libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_purge.c -fPIC -DPIC -o .libs/libvmod_purge_la-vmod_purge.o /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors_random.lo `test -f 'vmod_directors_random.c' || echo './'`vmod_directors_random.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors_round_robin.lo `test -f 'vmod_directors_round_robin.c' || echo './'`vmod_directors_round_robin.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors_shard.lo `test -f 'vmod_directors_shard.c' || echo './'`vmod_directors_shard.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors_shard_cfg.lo `test -f 'vmod_directors_shard_cfg.c' || echo './'`vmod_directors_shard_cfg.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vmod_directors_shard_dir.lo `test -f 'vmod_directors_shard_dir.c' || echo './'`vmod_directors_shard_dir.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_directors_la-vcc_directors_if.lo `test -f 'vcc_directors_if.c' || echo './'`vcc_directors_if.c libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_purge_if.c -fPIC -DPIC -o .libs/libvmod_purge_la-vcc_purge_if.o /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_std_la-vmod_std.lo `test -f 'vmod_std.c' || echo './'`vmod_std.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_std_la-vmod_std_conversions.lo `test -f 'vmod_std_conversions.c' || echo './'`vmod_std_conversions.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_std_la-vmod_std_fileread.lo `test -f 'vmod_std_fileread.c' || echo './'`vmod_std_fileread.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_std_la-vmod_std_querysort.lo `test -f 'vmod_std_querysort.c' || echo './'`vmod_std_querysort.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_std_la-vcc_std_if.lo `test -f 'vcc_std_if.c' || echo './'`vcc_std_if.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-vmod_debug.lo `test -f 'vmod_debug.c' || echo './'`vmod_debug.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-vmod_debug_acl.lo `test -f 'vmod_debug_acl.c' || echo './'`vmod_debug_acl.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-vmod_debug_dyn.lo `test -f 'vmod_debug_dyn.c' || echo './'`vmod_debug_dyn.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-vmod_debug_filters.lo `test -f 'vmod_debug_filters.c' || echo './'`vmod_debug_filters.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-vmod_debug_obj.lo `test -f 'vmod_debug_obj.c' || echo './'`vmod_debug_obj.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-vmod_debug_transport_reembarking_http1.lo `test -f 'vmod_debug_transport_reembarking_http1.c' || echo './'`vmod_debug_transport_reembarking_http1.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-VSC_debug.lo `test -f 'VSC_debug.c' || echo './'`VSC_debug.c /bin/bash ../libtool --tag=CC --mode=compile gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c -o libvmod_debug_la-vcc_debug_if.lo `test -f 'vcc_debug_if.c' || echo './'`vcc_debug_if.c libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_cookie.c -fPIC -DPIC -o .libs/libvmod_cookie_la-vmod_cookie.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_cookie_if.c -fPIC -DPIC -o .libs/libvmod_cookie_la-vcc_cookie_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_blob_url.c -fPIC -DPIC -o .libs/libvmod_blob_la-vmod_blob_url.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_blob_hex.c -fPIC -DPIC -o .libs/libvmod_blob_la-vmod_blob_hex.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_blob_id.c -fPIC -DPIC -o .libs/libvmod_blob_la-vmod_blob_id.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_blob.c -fPIC -DPIC -o .libs/libvmod_blob_la-vmod_blob.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_blob_base64.c -fPIC -DPIC -o .libs/libvmod_blob_la-vmod_blob_base64.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_proxy_if.c -fPIC -DPIC -o .libs/libvmod_proxy_la-vcc_proxy_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_h2_if.c -fPIC -DPIC -o .libs/libvmod_h2_la-vcc_h2_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_proxy.c -fPIC -DPIC -o .libs/libvmod_proxy_la-vmod_proxy.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_h2.c -fPIC -DPIC -o .libs/libvmod_h2_la-vmod_h2.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_vtc.c -fPIC -DPIC -o .libs/libvmod_vtc_la-vmod_vtc.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_unix_if.c -fPIC -DPIC -o .libs/libvmod_unix_la-vcc_unix_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_blob_if.c -fPIC -DPIC -o .libs/libvmod_blob_la-vcc_blob_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_vtc_if.c -fPIC -DPIC -o .libs/libvmod_vtc_la-vcc_vtc_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_unix.c -fPIC -DPIC -o .libs/libvmod_unix_la-vmod_unix.o /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_purge_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_purge.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_purge_la-vmod_purge.lo libvmod_purge_la-vcc_purge_if.lo -lpthread libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_debug_transport_reembarking_http1.c -fPIC -DPIC -o .libs/libvmod_debug_la-vmod_debug_transport_reembarking_http1.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_debug_dyn.c -fPIC -DPIC -o .libs/libvmod_debug_la-vmod_debug_dyn.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_std_fileread.c -fPIC -DPIC -o .libs/libvmod_std_la-vmod_std_fileread.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors_fall_back.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors_fall_back.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors_round_robin.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors_round_robin.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_directors_if.c -fPIC -DPIC -o .libs/libvmod_directors_la-vcc_directors_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_std_if.c -fPIC -DPIC -o .libs/libvmod_std_la-vcc_std_if.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors_shard_cfg.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors_shard_cfg.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_std.c -fPIC -DPIC -o .libs/libvmod_std_la-vmod_std.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_debug.c -fPIC -DPIC -o .libs/libvmod_debug_la-vmod_debug.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors_shard.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors_shard.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_std_querysort.c -fPIC -DPIC -o .libs/libvmod_std_la-vmod_std_querysort.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_debug_filters.c -fPIC -DPIC -o .libs/libvmod_debug_la-vmod_debug_filters.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors_random.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors_random.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors_hash.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors_hash.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_std_conversions.c -fPIC -DPIC -o .libs/libvmod_std_la-vmod_std_conversions.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_directors_shard_dir.c -fPIC -DPIC -o .libs/libvmod_directors_la-vmod_directors_shard_dir.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_debug_obj.c -fPIC -DPIC -o .libs/libvmod_debug_la-vmod_debug_obj.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c VSC_debug.c -fPIC -DPIC -o .libs/libvmod_debug_la-VSC_debug.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vmod_debug_acl.c -fPIC -DPIC -o .libs/libvmod_debug_la-vmod_debug_acl.o libtool: compile: gcc -DHAVE_CONFIG_H -I. -I.. -I../include -I../bin/varnishd -I../include -Wdate-time -D_FORTIFY_SOURCE=2 -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -c vcc_debug_if.c -fPIC -DPIC -o .libs/libvmod_debug_la-vcc_debug_if.o libtool: link: /usr/bin/nm -B .libs/libvmod_purge_la-vmod_purge.o .libs/libvmod_purge_la-vcc_purge_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_purge.exp libtool: link: /usr/bin/grep -E -e "Vmod_purge_Data" ".libs/libvmod_purge.exp" > ".libs/libvmod_purge.expT" libtool: link: mv -f ".libs/libvmod_purge.expT" ".libs/libvmod_purge.exp" libtool: link: echo "{ global:" > .libs/libvmod_purge.ver libtool: link: cat .libs/libvmod_purge.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_purge.ver /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_unix_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_unix.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_unix_la-vmod_unix.lo libvmod_unix_la-vcc_unix_if.lo -lpthread /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_proxy_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_proxy.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_proxy_la-vmod_proxy.lo libvmod_proxy_la-vcc_proxy_if.lo -lpthread libtool: link: echo "local: *; };" >> .libs/libvmod_purge.ver /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_h2_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_h2.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_h2_la-vmod_h2.lo libvmod_h2_la-vcc_h2_if.lo -lpthread libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_purge_la-vmod_purge.o .libs/libvmod_purge_la-vcc_purge_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_purge.so -Wl,-version-script -Wl,.libs/libvmod_purge.ver -o .libs/libvmod_purge.so libtool: link: ( cd ".libs" && rm -f "libvmod_purge.la" && ln -s "../libvmod_purge.la" "libvmod_purge.la" ) libtool: link: /usr/bin/nm -B .libs/libvmod_unix_la-vmod_unix.o .libs/libvmod_unix_la-vcc_unix_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_unix.exp libtool: link: /usr/bin/nm -B .libs/libvmod_h2_la-vmod_h2.o .libs/libvmod_h2_la-vcc_h2_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_h2.exp libtool: link: /usr/bin/grep -E -e "Vmod_unix_Data" ".libs/libvmod_unix.exp" > ".libs/libvmod_unix.expT" libtool: link: /usr/bin/grep -E -e "Vmod_h2_Data" ".libs/libvmod_h2.exp" > ".libs/libvmod_h2.expT" libtool: link: /usr/bin/nm -B .libs/libvmod_proxy_la-vmod_proxy.o .libs/libvmod_proxy_la-vcc_proxy_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_proxy.exp libtool: link: mv -f ".libs/libvmod_unix.expT" ".libs/libvmod_unix.exp" libtool: link: mv -f ".libs/libvmod_h2.expT" ".libs/libvmod_h2.exp" libtool: link: echo "{ global:" > .libs/libvmod_unix.ver libtool: link: echo "{ global:" > .libs/libvmod_h2.ver libtool: link: cat .libs/libvmod_unix.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_unix.ver libtool: link: /usr/bin/grep -E -e "Vmod_proxy_Data" ".libs/libvmod_proxy.exp" > ".libs/libvmod_proxy.expT" libtool: link: cat .libs/libvmod_h2.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_h2.ver /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_blob_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_blob.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_blob_la-vmod_blob.lo libvmod_blob_la-vmod_blob_base64.lo libvmod_blob_la-vmod_blob_hex.lo libvmod_blob_la-vmod_blob_id.lo libvmod_blob_la-vmod_blob_url.lo libvmod_blob_la-vcc_blob_if.lo -lpthread libtool: link: mv -f ".libs/libvmod_proxy.expT" ".libs/libvmod_proxy.exp" libtool: link: echo "local: *; };" >> .libs/libvmod_h2.ver libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_h2_la-vmod_h2.o .libs/libvmod_h2_la-vcc_h2_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_h2.so -Wl,-version-script -Wl,.libs/libvmod_h2.ver -o .libs/libvmod_h2.so libtool: link: echo "{ global:" > .libs/libvmod_proxy.ver libtool: link: echo "local: *; };" >> .libs/libvmod_unix.ver libtool: link: cat .libs/libvmod_proxy.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_proxy.ver libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_unix_la-vmod_unix.o .libs/libvmod_unix_la-vcc_unix_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_unix.so -Wl,-version-script -Wl,.libs/libvmod_unix.ver -o .libs/libvmod_unix.so libtool: link: echo "local: *; };" >> .libs/libvmod_proxy.ver /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_std_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_std.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_std_la-vmod_std.lo libvmod_std_la-vmod_std_conversions.lo libvmod_std_la-vmod_std_fileread.lo libvmod_std_la-vmod_std_querysort.lo libvmod_std_la-vcc_std_if.lo -lpthread libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_proxy_la-vmod_proxy.o .libs/libvmod_proxy_la-vcc_proxy_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_proxy.so -Wl,-version-script -Wl,.libs/libvmod_proxy.ver -o .libs/libvmod_proxy.so /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_cookie_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_cookie.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_cookie_la-vmod_cookie.lo libvmod_cookie_la-vcc_cookie_if.lo -lpthread libtool: link: ( cd ".libs" && rm -f "libvmod_h2.la" && ln -s "../libvmod_h2.la" "libvmod_h2.la" ) libtool: link: ( cd ".libs" && rm -f "libvmod_unix.la" && ln -s "../libvmod_unix.la" "libvmod_unix.la" ) /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_vtc_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_vtc.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_vtc_la-vmod_vtc.lo libvmod_vtc_la-vcc_vtc_if.lo -lpthread libtool: link: ( cd ".libs" && rm -f "libvmod_proxy.la" && ln -s "../libvmod_proxy.la" "libvmod_proxy.la" ) libtool: link: /usr/bin/nm -B .libs/libvmod_blob_la-vmod_blob.o .libs/libvmod_blob_la-vmod_blob_base64.o .libs/libvmod_blob_la-vmod_blob_hex.o .libs/libvmod_blob_la-vmod_blob_id.o .libs/libvmod_blob_la-vmod_blob_url.o .libs/libvmod_blob_la-vcc_blob_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_blob.exp libtool: link: /usr/bin/grep -E -e "Vmod_blob_Data" ".libs/libvmod_blob.exp" > ".libs/libvmod_blob.expT" libtool: link: mv -f ".libs/libvmod_blob.expT" ".libs/libvmod_blob.exp" libtool: link: echo "{ global:" > .libs/libvmod_blob.ver libtool: link: /usr/bin/nm -B .libs/libvmod_cookie_la-vmod_cookie.o .libs/libvmod_cookie_la-vcc_cookie_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_cookie.exp libtool: link: cat .libs/libvmod_blob.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_blob.ver libtool: link: echo "local: *; };" >> .libs/libvmod_blob.ver libtool: link: /usr/bin/grep -E -e "Vmod_cookie_Data" ".libs/libvmod_cookie.exp" > ".libs/libvmod_cookie.expT" libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_blob_la-vmod_blob.o .libs/libvmod_blob_la-vmod_blob_base64.o .libs/libvmod_blob_la-vmod_blob_hex.o .libs/libvmod_blob_la-vmod_blob_id.o .libs/libvmod_blob_la-vmod_blob_url.o .libs/libvmod_blob_la-vcc_blob_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_blob.so -Wl,-version-script -Wl,.libs/libvmod_blob.ver -o .libs/libvmod_blob.so libtool: link: mv -f ".libs/libvmod_cookie.expT" ".libs/libvmod_cookie.exp" libtool: link: echo "{ global:" > .libs/libvmod_cookie.ver libtool: link: cat .libs/libvmod_cookie.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_cookie.ver libtool: link: /usr/bin/nm -B .libs/libvmod_std_la-vmod_std.o .libs/libvmod_std_la-vmod_std_conversions.o .libs/libvmod_std_la-vmod_std_fileread.o .libs/libvmod_std_la-vmod_std_querysort.o .libs/libvmod_std_la-vcc_std_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_std.exp libtool: link: echo "local: *; };" >> .libs/libvmod_cookie.ver libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_cookie_la-vmod_cookie.o .libs/libvmod_cookie_la-vcc_cookie_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_cookie.so -Wl,-version-script -Wl,.libs/libvmod_cookie.ver -o .libs/libvmod_cookie.so libtool: link: /usr/bin/grep -E -e "Vmod_std_Data" ".libs/libvmod_std.exp" > ".libs/libvmod_std.expT" libtool: link: mv -f ".libs/libvmod_std.expT" ".libs/libvmod_std.exp" libtool: link: echo "{ global:" > .libs/libvmod_std.ver libtool: link: cat .libs/libvmod_std.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_std.ver libtool: link: /usr/bin/nm -B .libs/libvmod_vtc_la-vmod_vtc.o .libs/libvmod_vtc_la-vcc_vtc_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_vtc.exp libtool: link: ( cd ".libs" && rm -f "libvmod_blob.la" && ln -s "../libvmod_blob.la" "libvmod_blob.la" ) libtool: link: echo "local: *; };" >> .libs/libvmod_std.ver libtool: link: /usr/bin/grep -E -e "Vmod_vtc_Data" ".libs/libvmod_vtc.exp" > ".libs/libvmod_vtc.expT" libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_std_la-vmod_std.o .libs/libvmod_std_la-vmod_std_conversions.o .libs/libvmod_std_la-vmod_std_fileread.o .libs/libvmod_std_la-vmod_std_querysort.o .libs/libvmod_std_la-vcc_std_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_std.so -Wl,-version-script -Wl,.libs/libvmod_std.ver -o .libs/libvmod_std.so libtool: link: mv -f ".libs/libvmod_vtc.expT" ".libs/libvmod_vtc.exp" libtool: link: ( cd ".libs" && rm -f "libvmod_cookie.la" && ln -s "../libvmod_cookie.la" "libvmod_cookie.la" ) libtool: link: echo "{ global:" > .libs/libvmod_vtc.ver libtool: link: cat .libs/libvmod_vtc.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_vtc.ver libtool: link: echo "local: *; };" >> .libs/libvmod_vtc.ver libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_vtc_la-vmod_vtc.o .libs/libvmod_vtc_la-vcc_vtc_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_vtc.so -Wl,-version-script -Wl,.libs/libvmod_vtc.ver -o .libs/libvmod_vtc.so libtool: link: ( cd ".libs" && rm -f "libvmod_vtc.la" && ln -s "../libvmod_vtc.la" "libvmod_vtc.la" ) libtool: link: ( cd ".libs" && rm -f "libvmod_std.la" && ln -s "../libvmod_std.la" "libvmod_std.la" ) /bin/bash ../libtool --tag=CC --mode=link gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex Vmod_directors_Data -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_directors.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_directors_la-vmod_directors.lo libvmod_directors_la-vmod_directors_fall_back.lo libvmod_directors_la-vmod_directors_hash.lo libvmod_directors_la-vmod_directors_random.lo libvmod_directors_la-vmod_directors_round_robin.lo libvmod_directors_la-vmod_directors_shard.lo libvmod_directors_la-vmod_directors_shard_cfg.lo libvmod_directors_la-vmod_directors_shard_dir.lo libvmod_directors_la-vcc_directors_if.lo -lpthread libtool: link: /usr/bin/nm -B .libs/libvmod_directors_la-vmod_directors.o .libs/libvmod_directors_la-vmod_directors_fall_back.o .libs/libvmod_directors_la-vmod_directors_hash.o .libs/libvmod_directors_la-vmod_directors_random.o .libs/libvmod_directors_la-vmod_directors_round_robin.o .libs/libvmod_directors_la-vmod_directors_shard.o .libs/libvmod_directors_la-vmod_directors_shard_cfg.o .libs/libvmod_directors_la-vmod_directors_shard_dir.o .libs/libvmod_directors_la-vcc_directors_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_directors.exp libtool: link: /usr/bin/grep -E -e "Vmod_directors_Data" ".libs/libvmod_directors.exp" > ".libs/libvmod_directors.expT" libtool: link: mv -f ".libs/libvmod_directors.expT" ".libs/libvmod_directors.exp" libtool: link: echo "{ global:" > .libs/libvmod_directors.ver libtool: link: cat .libs/libvmod_directors.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_directors.ver libtool: link: echo "local: *; };" >> .libs/libvmod_directors.ver libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_directors_la-vmod_directors.o .libs/libvmod_directors_la-vmod_directors_fall_back.o .libs/libvmod_directors_la-vmod_directors_hash.o .libs/libvmod_directors_la-vmod_directors_random.o .libs/libvmod_directors_la-vmod_directors_round_robin.o .libs/libvmod_directors_la-vmod_directors_shard.o .libs/libvmod_directors_la-vmod_directors_shard_cfg.o .libs/libvmod_directors_la-vmod_directors_shard_dir.o .libs/libvmod_directors_la-vcc_directors_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_directors.so -Wl,-version-script -Wl,.libs/libvmod_directors.ver -o .libs/libvmod_directors.so libtool: link: ( cd ".libs" && rm -f "libvmod_directors.la" && ln -s "../libvmod_directors.la" "libvmod_directors.la" ) /bin/bash ../libtool --tag=CC --mode=link gcc -I../lib/libvgz -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -fexcess-precision=standard -DZ_PREFIX -pthread -Wall -Werror -Wno-error=unused-result -export-symbols-regex 'Vmod_.*_Data' -module -export-dynamic -avoid-version -shared -Wl,-z,relro -Wl,-z,now -o libvmod_debug.la -rpath /usr/lib/x86_64-linux-gnu/varnish/vmods libvmod_debug_la-vmod_debug.lo libvmod_debug_la-vmod_debug_acl.lo libvmod_debug_la-vmod_debug_dyn.lo libvmod_debug_la-vmod_debug_filters.lo libvmod_debug_la-vmod_debug_obj.lo libvmod_debug_la-vmod_debug_transport_reembarking_http1.lo libvmod_debug_la-VSC_debug.lo libvmod_debug_la-vcc_debug_if.lo -lpthread libtool: link: /usr/bin/nm -B .libs/libvmod_debug_la-vmod_debug.o .libs/libvmod_debug_la-vmod_debug_acl.o .libs/libvmod_debug_la-vmod_debug_dyn.o .libs/libvmod_debug_la-vmod_debug_filters.o .libs/libvmod_debug_la-vmod_debug_obj.o .libs/libvmod_debug_la-vmod_debug_transport_reembarking_http1.o .libs/libvmod_debug_la-VSC_debug.o .libs/libvmod_debug_la-vcc_debug_if.o | /usr/bin/sed -n -e 's/^.*[ ]\([ABCDGIRSTW][ABCDGIRSTW]*\)[ ][ ]*\([_A-Za-z][_A-Za-z0-9]*\)$/\1 \2 \2/p' | /usr/bin/sed '/ __gnu_lto/d' | /usr/bin/sed 's/.* //' | sort | uniq > .libs/libvmod_debug.exp libtool: link: /usr/bin/grep -E -e "Vmod_.*_Data" ".libs/libvmod_debug.exp" > ".libs/libvmod_debug.expT" libtool: link: mv -f ".libs/libvmod_debug.expT" ".libs/libvmod_debug.exp" libtool: link: echo "{ global:" > .libs/libvmod_debug.ver libtool: link: cat .libs/libvmod_debug.exp | /usr/bin/sed -e "s/\(.*\)/\1;/" >> .libs/libvmod_debug.ver libtool: link: echo "local: *; };" >> .libs/libvmod_debug.ver libtool: link: gcc -shared -fPIC -DPIC .libs/libvmod_debug_la-vmod_debug.o .libs/libvmod_debug_la-vmod_debug_acl.o .libs/libvmod_debug_la-vmod_debug_dyn.o .libs/libvmod_debug_la-vmod_debug_filters.o .libs/libvmod_debug_la-vmod_debug_obj.o .libs/libvmod_debug_la-vmod_debug_transport_reembarking_http1.o .libs/libvmod_debug_la-VSC_debug.o .libs/libvmod_debug_la-vcc_debug_if.o -lpthread -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/varnish-7.7.0=. -fstack-protector-strong -Werror=format-security -Werror -Wl,-z -Wl,relro -Wl,-z -Wl,now -pthread -Wl,-soname -Wl,libvmod_debug.so -Wl,-version-script -Wl,.libs/libvmod_debug.ver -o .libs/libvmod_debug.so libtool: link: ( cd ".libs" && rm -f "libvmod_debug.la" && ln -s "../libvmod_debug.la" "libvmod_debug.la" ) make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/vmod' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/vmod' Making all in etc make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/etc' ( printf "This is the VCL configuration Varnish will automatically append to your VCL\nfile during compilation/loading. See the vcl(7) man page for details on syntax\nand semantics.\n\ New users is recommended to use the example.vcl file as a starting point.\n\n";\ sed -n '/vcl_recv/,$p' ../bin/varnishd/builtin.vcl ) | \ sed 's/^\(.*\)$/# \1/' > builtin.vcl make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/etc' Making all in doc make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' Making all in graphviz make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' make[4]: Nothing to be done for 'all'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' Making all in sphinx make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' ../../bin/varnishd/varnishd -x cli > include/cli.rst_ ../../bin/varnishd/varnishd -x parameter > include/params.rst_ ../../bin/varnishd/varnishd -x options > include/options.rst_ ln -s /build/reproducible-path/varnish-7.7.0/lib/libvsc/counters.rst include/counters.rst ../../bin/varnishncsa/varnishncsa --options > include/varnishncsa_options.rst_ ../../bin/varnishncsa/varnishncsa --synopsis > include/varnishncsa_synopsis.rst_ ../../bin/varnishlog/varnishlog --options > include/varnishlog_options.rst_ ../../bin/varnishlog/varnishlog --synopsis > include/varnishlog_synopsis.rst_ ../../bin/varnishtop/varnishtop --options > include/varnishtop_options.rst_ mv -f include/cli.rst_ include/cli.rst ../../bin/varnishtop/varnishtop --synopsis > include/varnishtop_synopsis.rst_ mv -f include/options.rst_ include/options.rst mv -f include/params.rst_ include/params.rst ../../bin/varnishhist/varnishhist --options > include/varnishhist_options.rst_ ../../bin/varnishhist/varnishhist --synopsis > include/varnishhist_synopsis.rst_ ../../bin/varnishstat/varnishstat --options > include/varnishstat_options.rst_ ../../bin/varnishstat/varnishstat --synopsis > include/varnishstat_synopsis.rst_ ../../bin/varnishstat/varnishstat --bindings > include/varnishstat_bindings.rst_ ../../lib/libvarnishapi/vsl2rst > include/vsl-tags.rst_ /usr/bin/python3 ./vtc-syntax.py ../../bin/varnishtest/vtc.c ../../bin/varnishtest/vtc_barrier.c ../../bin/varnishtest/vtc_haproxy.c ../../bin/varnishtest/vtc_http.c ../../bin/varnishtest/vtc_http2.c ../../bin/varnishtest/vtc_logexp.c ../../bin/varnishtest/vtc_misc.c ../../bin/varnishtest/vtc_process.c ../../bin/varnishtest/vtc_syslog.c ../../bin/varnishtest/vtc_tunnel.c ../../bin/varnishtest/vtc_varnish.c ../../bin/varnishtest/vtc_vsm.c > include/vtc-syntax.rst_ mv -f include/vsl-tags.rst_ include/vsl-tags.rst cp ../../vmod/vmod_std.rst include/vmod_std.generated.rst cp ../../vmod/vmod_directors.rst include/vmod_directors.generated.rst mv -f include/varnishncsa_synopsis.rst_ include/varnishncsa_synopsis.rst cp ../../vmod/vmod_purge.rst include/vmod_purge.generated.rst mv -f include/varnishncsa_options.rst_ include/varnishncsa_options.rst mv -f include/varnishlog_options.rst_ include/varnishlog_options.rst cp ../../vmod/vmod_vtc.rst include/vmod_vtc.generated.rst cp ../../vmod/vmod_blob.rst include/vmod_blob.generated.rst mv -f include/varnishlog_synopsis.rst_ include/varnishlog_synopsis.rst cp ../../vmod/vmod_cookie.rst include/vmod_cookie.generated.rst cp ../../vmod/vmod_h2.rst include/vmod_h2.generated.rst cp ../../vmod/vmod_unix.rst include/vmod_unix.generated.rst cp ../../vmod/vmod_proxy.rst include/vmod_proxy.generated.rst mv -f include/varnishtop_options.rst_ include/varnishtop_options.rst mv -f include/varnishhist_synopsis.rst_ include/varnishhist_synopsis.rst mv -f include/varnishtop_synopsis.rst_ include/varnishtop_synopsis.rst mv -f include/varnishhist_options.rst_ include/varnishhist_options.rst mv -f include/varnishstat_options.rst_ include/varnishstat_options.rst mv -f include/varnishstat_bindings.rst_ include/varnishstat_bindings.rst cd ../graphviz && make html mv -f include/varnishstat_synopsis.rst_ include/varnishstat_synopsis.rst make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && \ test ! -f ./cache_http1_fsm.svg ; then \ d=`pwd`/. ; \ cd . && find . -name \*.svg -type f | \ cpio -dmp ${d} || true ; \ fi make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && test ! -f index.rst; then \ s=`cd . && pwd`; \ for f in `cd $s && find . -type f`; do \ d=`dirname $f`; \ test -d $d || mkdir -p $d; \ test -f $f || ln -s $s/$f $f; \ done \ fi make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' make[4]: Nothing to be done for 'all-am'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' Making all in man make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/man' rst2man --halt=2 ../doc/sphinx/reference/varnish-cli.rst varnish-cli.7 rst2man --halt=2 ../doc/sphinx/reference/varnish-counters.rst varnish-counters.7 rst2man --halt=2 ../doc/sphinx/reference/vcl.rst vcl.7 rst2man --halt=2 ../doc/sphinx/reference/vcl-backend.rst vcl-backend.7 rst2man --halt=2 ../doc/sphinx/reference/vcl-probe.rst vcl-probe.7 rst2man --halt=2 ../doc/sphinx/reference/vcl-var.rst vcl-var.7 rst2man --halt=2 ../doc/sphinx/reference/vcl-step.rst vcl-step.7 rst2man --halt=2 ../doc/sphinx/reference/vsl.rst vsl.7 rst2man --halt=2 ../doc/sphinx/reference/vsl-query.rst vsl-query.7 rst2man --halt=2 ../doc/sphinx/reference/varnishadm.rst varnishadm.1 rst2man --halt=2 ../doc/sphinx/reference/varnishd.rst varnishd.1 rst2man --halt=2 ../doc/sphinx/reference/varnishhist.rst varnishhist.1 rst2man --halt=2 ../doc/sphinx/reference/varnishlog.rst varnishlog.1 rst2man --halt=2 ../doc/sphinx/reference/varnishncsa.rst varnishncsa.1 rst2man --halt=2 ../doc/sphinx/reference/varnishstat.rst varnishstat.1 rst2man --halt=2 ../doc/sphinx/reference/varnishtest.rst varnishtest.1 rst2man --halt=2 ../doc/sphinx/reference/vtc.rst vtc.7 rst2man --halt=2 ../doc/sphinx/reference/varnishtop.rst varnishtop.1 rst2man --halt=2 ../vmod/vmod_cookie.man.rst vmod_cookie.3 rst2man --halt=2 ../vmod/vmod_directors.man.rst vmod_directors.3 rst2man --halt=2 ../vmod/vmod_purge.man.rst vmod_purge.3 rst2man --halt=2 ../vmod/vmod_std.man.rst vmod_std.3 rst2man --halt=2 ../vmod/vmod_vtc.man.rst vmod_vtc.3 rst2man --halt=2 ../vmod/vmod_blob.man.rst vmod_blob.3 rst2man --halt=2 ../vmod/vmod_unix.man.rst vmod_unix.3 rst2man --halt=2 ../vmod/vmod_proxy.man.rst vmod_proxy.3 rst2man --halt=2 ../vmod/vmod_h2.man.rst vmod_h2.3 make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/man' Making all in contrib make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/contrib' make[3]: Nothing to be done for 'all'. make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/contrib' make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0' make[2]: Leaving directory '/build/reproducible-path/varnish-7.7.0' make[1]: Leaving directory '/build/reproducible-path/varnish-7.7.0' debian/rules execute_after_dh_auto_build make[1]: Entering directory '/build/reproducible-path/varnish-7.7.0' /usr/bin/make html make[2]: Entering directory '/build/reproducible-path/varnish-7.7.0' /usr/bin/make all-recursive make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0' Making all in include make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' /usr/bin/make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' Making all in lib make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' Making all in libvsc make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' /usr/bin/make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' Making all in libvarnish make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' Making all in libvarnishapi make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' /usr/bin/make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' Making all in libvcc make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' /usr/bin/make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' Making all in libvgz make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' Making all in bin make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' Making all in varnishadm make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' Making all in varnishd make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' /usr/bin/make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' Making all in varnishhist make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' Making all in varnishlog make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' Making all in varnishncsa make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' Making all in varnishstat make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' /usr/bin/make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' Making all in varnishtop make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' Making all in varnishtest make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' /usr/bin/make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' Making all in vmod make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/vmod' /usr/bin/make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/vmod' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/vmod' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/vmod' Making all in etc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/etc' make[4]: Nothing to be done for 'all'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/etc' Making all in doc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' Making all in graphviz make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' Making all in sphinx make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' cd ../graphviz && /usr/bin/make html make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && \ test ! -f ./cache_http1_fsm.svg ; then \ d=`pwd`/. ; \ cd . && find . -name \*.svg -type f | \ cpio -dmp ${d} || true ; \ fi make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && test ! -f index.rst; then \ s=`cd . && pwd`; \ for f in `cd $s && find . -type f`; do \ d=`dirname $f`; \ test -d $d || mkdir -p $d; \ test -f $f || ln -s $s/$f $f; \ done \ fi /usr/bin/make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' Making all in man make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/man' make[4]: Nothing to be done for 'all'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/man' Making all in contrib make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/contrib' make[4]: Nothing to be done for 'all'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/contrib' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0' Making html in include make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' make[3]: Nothing to be done for 'html'. make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' Making html in lib make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' Making html in libvsc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' Making html in libvarnish make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' Making html in libvarnishapi make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' Making html in libvcc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' Making html in libvgz make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' make[4]: Nothing to be done for 'html-am'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' Making html in bin make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' Making html in varnishadm make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' Making html in varnishd make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' Making html in varnishhist make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' Making html in varnishlog make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' Making html in varnishncsa make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' Making html in varnishstat make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' Making html in varnishtop make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' Making html in varnishtest make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[4]: Nothing to be done for 'html'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' make[4]: Nothing to be done for 'html-am'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' Making html in vmod make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/vmod' make[3]: Nothing to be done for 'html'. make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/vmod' Making html in etc make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/etc' make[3]: Nothing to be done for 'html'. make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/etc' Making html in doc make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' Making html in graphviz make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && \ test ! -f ./cache_http1_fsm.svg ; then \ d=`pwd`/. ; \ cd . && find . -name \*.svg -type f | \ cpio -dmp ${d} || true ; \ fi make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' Making html in sphinx make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' cd ../graphviz && /usr/bin/make html make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && \ test ! -f ./cache_http1_fsm.svg ; then \ d=`pwd`/. ; \ cd . && find . -name \*.svg -type f | \ cpio -dmp ${d} || true ; \ fi make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && test ! -f index.rst; then \ s=`cd . && pwd`; \ for f in `cd $s && find . -type f`; do \ d=`dirname $f`; \ test -d $d || mkdir -p $d; \ test -f $f || ln -s $s/$f $f; \ done \ fi sphinx-build -W -q -N -b html -d build/doctrees . build/html Build finished. The HTML pages are in doc/sphinx/build/html. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' make[4]: Nothing to be done for 'html-am'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' Making html in man make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/man' make[3]: Nothing to be done for 'html'. make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/man' Making html in contrib make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/contrib' make[3]: Nothing to be done for 'html'. make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/contrib' make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0' make[3]: Nothing to be done for 'html-am'. make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0' make[2]: Leaving directory '/build/reproducible-path/varnish-7.7.0' cd doc && /usr/bin/make changes.html make[2]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' rst2html --halt=2 changes.rst changes.html make[2]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' make[1]: Leaving directory '/build/reproducible-path/varnish-7.7.0' debian/rules override_dh_auto_test make[1]: Entering directory '/build/reproducible-path/varnish-7.7.0' # ignore the blhc false positives (see CC_CC) blhc: ignore-line-regexp: .+"exec .+-gcc .+ -o %o %s" .+ dh_auto_test make -j42 check "TESTSUITEFLAGS=-j42 --verbose" VERBOSE=1 make[2]: Entering directory '/build/reproducible-path/varnish-7.7.0' make all-recursive make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0' Making all in include make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' Making all in lib make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' Making all in libvsc make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' Making all in libvarnish make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' Making all in libvarnishapi make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' Making all in libvcc make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' Making all in libvgz make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' Making all in bin make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' Making all in varnishadm make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' Making all in varnishd make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' Making all in varnishhist make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' Making all in varnishlog make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' Making all in varnishncsa make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' Making all in varnishstat make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' Making all in varnishtop make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' Making all in varnishtest make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' Making all in vmod make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/vmod' make all-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/vmod' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/vmod' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/vmod' Making all in etc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/etc' make[4]: Nothing to be done for 'all'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/etc' Making all in doc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' Making all in graphviz make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' make[5]: Nothing to be done for 'all'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' Making all in sphinx make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' cd ../graphviz && make html make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && \ test ! -f ./cache_http1_fsm.svg ; then \ d=`pwd`/. ; \ cd . && find . -name \*.svg -type f | \ cpio -dmp ${d} || true ; \ fi make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/graphviz' if test "x." != "x." && test ! -f index.rst; then \ s=`cd . && pwd`; \ for f in `cd $s && find . -type f`; do \ d=`dirname $f`; \ test -d $d || mkdir -p $d; \ test -f $f || ln -s $s/$f $f; \ done \ fi make all-am make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[6]: Nothing to be done for 'all-am'. make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc/sphinx' make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/doc' make[5]: Nothing to be done for 'all-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/doc' Making all in man make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/man' make[4]: Nothing to be done for 'all'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/man' Making all in contrib make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/contrib' make[4]: Nothing to be done for 'all'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/contrib' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0' Making check in include make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' make check-am make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' make check-TESTS make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/include' PASS: vbm_test ============================================================================ Testsuite summary for Varnish 7.7.0 ============================================================================ # TOTAL: 1 # PASS: 1 # SKIP: 0 # XFAIL: 0 # FAIL: 0 # XPASS: 0 # ERROR: 0 ============================================================================ make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/include' Making check in lib make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' Making check in libvsc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make check-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[5]: Nothing to be done for 'check-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvsc' Making check in libvarnish make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' make check-TESTS make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' PASS: vav_test PASS: vct_test PASS: vjsn_test PASS: vsb_test PASS: vnum_c_test PASS: vte_test PASS: vbh_test PASS: vtim_test ============================================================================ Testsuite summary for Varnish 7.7.0 ============================================================================ # TOTAL: 8 # PASS: 8 # SKIP: 0 # XFAIL: 0 # FAIL: 0 # XPASS: 0 # ERROR: 0 ============================================================================ make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnish' Making check in libvarnishapi make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make check-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make check-TESTS make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[7]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' PASS: vxp_test_coverage.sh PASS: vsl_glob_test_coverage.sh ============================================================================ Testsuite summary for Varnish 7.7.0 ============================================================================ # TOTAL: 2 # PASS: 2 # SKIP: 0 # XFAIL: 0 # FAIL: 0 # XPASS: 0 # ERROR: 0 ============================================================================ make[7]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvarnishapi' Making check in libvcc make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make check-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[5]: Nothing to be done for 'check-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvcc' Making check in libvgz make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[4]: Nothing to be done for 'check'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib/libvgz' make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/lib' make[4]: Nothing to be done for 'check-am'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/lib' Making check in bin make[3]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin' Making check in varnishadm make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' make[4]: Nothing to be done for 'check'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishadm' Making check in varnishd make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make check-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make check-TESTS make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[7]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' PASS: vhp_table_test PASS: vhp_decode_test ============================================================================ Testsuite summary for Varnish 7.7.0 ============================================================================ # TOTAL: 2 # PASS: 2 # SKIP: 0 # XFAIL: 0 # FAIL: 0 # XPASS: 0 # ERROR: 0 ============================================================================ make[7]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishd' Making check in varnishhist make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' make[4]: Nothing to be done for 'check'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishhist' Making check in varnishlog make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' make[4]: Nothing to be done for 'check'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishlog' Making check in varnishncsa make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' make[4]: Nothing to be done for 'check'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishncsa' Making check in varnishstat make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make check-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[5]: Nothing to be done for 'check-am'. make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishstat' Making check in varnishtop make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' make[4]: Nothing to be done for 'check'. make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtop' Making check in varnishtest make[4]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make check-am make[5]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make check-TESTS make[6]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[7]: Entering directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' PASS: tests/a00002.vtc PASS: tests/a00022.vtc PASS: tests/a00004.vtc PASS: tests/a00020.vtc SKIP: tests/a00001.vtc PASS: tests/a00018.vtc PASS: tests/a00003.vtc PASS: tests/a00012.vtc PASS: tests/a00007.vtc PASS: tests/a00010.vtc PASS: tests/a00009.vtc PASS: tests/a00015.vtc PASS: tests/a00006.vtc PASS: tests/a00011.vtc PASS: tests/a00005.vtc PASS: tests/a02001.vtc SKIP: tests/a00014.vtc PASS: tests/a02016.vtc PASS: tests/a00016.vtc PASS: tests/a02011.vtc PASS: tests/a02002.vtc PASS: tests/a02004.vtc PASS: tests/a02005.vtc PASS: tests/a02017.vtc PASS: tests/a02000.vtc PASS: tests/a02003.vtc PASS: tests/a02010.vtc PASS: tests/a00023.vtc PASS: tests/a02013.vtc PASS: tests/a02025.vtc PASS: tests/a02009.vtc PASS: tests/a02007.vtc PASS: tests/a02019.vtc PASS: tests/a02006.vtc PASS: tests/a02012.vtc PASS: tests/a02020.vtc PASS: tests/a02018.vtc PASS: tests/a02024.vtc PASS: tests/a02026.vtc PASS: tests/a00021.vtc PASS: tests/a02014.vtc PASS: tests/a02008.vtc SKIP: tests/a02022.vtc PASS: tests/a02021.vtc PASS: tests/a02023.vtc PASS: tests/a02015.vtc PASS: tests/a02028.vtc PASS: tests/a00019.vtc PASS: tests/a00008.vtc PASS: tests/a00000.vtc PASS: tests/b00034.vtc PASS: tests/a00013.vtc PASS: tests/b00024.vtc PASS: tests/b00017.vtc PASS: tests/b00025.vtc PASS: tests/b00009.vtc PASS: tests/b00012.vtc PASS: tests/b00027.vtc PASS: tests/a00024.vtc PASS: tests/b00028.vtc PASS: tests/b00035.vtc PASS: tests/b00010.vtc PASS: tests/b00005.vtc PASS: tests/b00011.vtc PASS: tests/b00006.vtc PASS: tests/b00003.vtc PASS: tests/b00007.vtc PASS: tests/b00031.vtc PASS: tests/b00013.vtc PASS: tests/b00033.vtc PASS: tests/b00019.vtc PASS: tests/b00032.vtc PASS: tests/b00002.vtc PASS: tests/b00036.vtc PASS: tests/b00000.vtc PASS: tests/b00001.vtc PASS: tests/b00016.vtc PASS: tests/a02027.vtc PASS: tests/b00008.vtc PASS: tests/b00004.vtc PASS: tests/b00038.vtc PASS: tests/b00037.vtc PASS: tests/b00049.vtc PASS: tests/b00020.vtc PASS: tests/b00029.vtc PASS: tests/b00014.vtc PASS: tests/b00047.vtc PASS: tests/b00044.vtc PASS: tests/b00058.vtc PASS: tests/b00022.vtc PASS: tests/b00026.vtc PASS: tests/b00055.vtc PASS: tests/b00043.vtc PASS: tests/b00048.vtc PASS: tests/b00050.vtc PASS: tests/b00051.vtc PASS: tests/b00054.vtc PASS: tests/b00056.vtc PASS: tests/b00060.vtc PASS: tests/b00061.vtc PASS: tests/b00069.vtc PASS: tests/b00040.vtc SKIP: tests/b00089.vtc SKIP: tests/b00091.vtc SKIP: tests/b00090.vtc PASS: tests/b00015.vtc PASS: tests/b00065.vtc PASS: tests/b00066.vtc PASS: tests/a00025.vtc PASS: tests/b00059.vtc PASS: tests/b00063.vtc PASS: tests/b00070.vtc PASS: tests/b00071.vtc PASS: tests/c00003.vtc PASS: tests/b00064.vtc PASS: tests/b00072.vtc PASS: tests/b00018.vtc PASS: tests/b00042.vtc PASS: tests/b00057.vtc PASS: tests/b00062.vtc PASS: tests/b00075.vtc PASS: tests/b00073.vtc PASS: tests/b00080.vtc PASS: tests/b00074.vtc PASS: tests/b00076.vtc PASS: tests/b00068.vtc PASS: tests/b00085.vtc PASS: tests/b00077.vtc PASS: tests/b00078.vtc PASS: tests/b00052.vtc PASS: tests/b00046.vtc PASS: tests/c00004.vtc PASS: tests/c00000.vtc PASS: tests/b00079.vtc PASS: tests/c00002.vtc PASS: tests/b00041.vtc PASS: tests/b00092.vtc PASS: tests/b00082.vtc PASS: tests/c00007.vtc PASS: tests/c00012.vtc PASS: tests/b00083.vtc PASS: tests/c00008.vtc PASS: tests/c00011.vtc PASS: tests/c00001.vtc PASS: tests/b00084.vtc PASS: tests/b00023.vtc PASS: tests/c00014.vtc PASS: tests/c00006.vtc PASS: tests/b00088.vtc PASS: tests/c00010.vtc PASS: tests/c00009.vtc PASS: tests/c00026.vtc PASS: tests/b00021.vtc PASS: tests/c00024.vtc PASS: tests/c00018.vtc PASS: tests/b00039.vtc PASS: tests/c00027.vtc PASS: tests/b00087.vtc PASS: tests/c00013.vtc PASS: tests/c00023.vtc PASS: tests/c00019.vtc PASS: tests/c00022.vtc PASS: tests/c00051.vtc PASS: tests/c00028.vtc PASS: tests/c00025.vtc PASS: tests/c00020.vtc PASS: tests/c00016.vtc PASS: tests/c00029.vtc PASS: tests/c00031.vtc PASS: tests/c00036.vtc PASS: tests/c00037.vtc PASS: tests/c00043.vtc PASS: tests/c00039.vtc PASS: tests/c00046.vtc PASS: tests/c00054.vtc PASS: tests/c00040.vtc PASS: tests/c00017.vtc PASS: tests/c00044.vtc PASS: tests/b00053.vtc PASS: tests/b00045.vtc PASS: tests/c00021.vtc PASS: tests/c00047.vtc PASS: tests/b00030.vtc PASS: tests/c00015.vtc PASS: tests/c00045.vtc PASS: tests/c00038.vtc PASS: tests/c00056.vtc PASS: tests/c00062.vtc PASS: tests/c00055.vtc SKIP: tests/c00086.vtc PASS: tests/c00061.vtc PASS: tests/c00068.vtc PASS: tests/c00064.vtc PASS: tests/c00066.vtc PASS: tests/c00069.vtc PASS: tests/c00041.vtc PASS: tests/c00072.vtc PASS: tests/c00073.vtc PASS: tests/b00067.vtc PASS: tests/c00070.vtc PASS: tests/c00060.vtc FAIL: tests/c00063.vtc PASS: tests/c00058.vtc PASS: tests/c00048.vtc PASS: tests/c00005.vtc PASS: tests/c00065.vtc PASS: tests/c00074.vtc PASS: tests/c00089.vtc PASS: tests/c00085.vtc PASS: tests/c00071.vtc PASS: tests/c00078.vtc PASS: tests/c00082.vtc SKIP: tests/c00109.vtc PASS: tests/c00059.vtc PASS: tests/c00075.vtc PASS: tests/c00079.vtc SKIP: tests/c00114.vtc PASS: tests/c00035.vtc PASS: tests/c00076.vtc PASS: tests/c00052.vtc PASS: tests/c00084.vtc PASS: tests/c00092.vtc PASS: tests/c00067.vtc PASS: tests/c00096.vtc PASS: tests/c00101.vtc PASS: tests/c00097.vtc PASS: tests/c00093.vtc PASS: tests/c00091.vtc PASS: tests/c00098.vtc PASS: tests/c00100.vtc PASS: tests/c00099.vtc PASS: tests/c00108.vtc PASS: tests/c00110.vtc PASS: tests/c00081.vtc PASS: tests/c00103.vtc PASS: tests/c00107.vtc PASS: tests/c00111.vtc PASS: tests/c00105.vtc PASS: tests/c00112.vtc PASS: tests/c00053.vtc PASS: tests/c00106.vtc PASS: tests/c00090.vtc PASS: tests/c00120.vtc PASS: tests/c00087.vtc PASS: tests/b00081.vtc PASS: tests/d00009.vtc PASS: tests/c00128.vtc PASS: tests/c00126.vtc PASS: tests/c00050.vtc PASS: tests/c00132.vtc PASS: tests/c00133.vtc FAIL: tests/c00049.vtc PASS: tests/d00014.vtc PASS: tests/c00104.vtc PASS: tests/d00008.vtc PASS: tests/c00057.vtc PASS: tests/d00034.vtc PASS: tests/d00035.vtc PASS: tests/d00010.vtc PASS: tests/e00000.vtc PASS: tests/d00033.vtc PASS: tests/d00036.vtc PASS: tests/e00002.vtc PASS: tests/c00102.vtc PASS: tests/c00134.vtc PASS: tests/e00001.vtc PASS: tests/d00040.vtc PASS: tests/c00123.vtc PASS: tests/e00005.vtc PASS: tests/c00113.vtc PASS: tests/e00004.vtc PASS: tests/e00007.vtc PASS: tests/e00008.vtc PASS: tests/c00088.vtc PASS: tests/e00009.vtc PASS: tests/d00013.vtc PASS: tests/e00010.vtc PASS: tests/e00014.vtc PASS: tests/e00013.vtc PASS: tests/e00003.vtc PASS: tests/c00042.vtc PASS: tests/e00011.vtc PASS: tests/d00011.vtc PASS: tests/e00012.vtc PASS: tests/d00038.vtc PASS: tests/e00016.vtc PASS: tests/c00094.vtc PASS: tests/e00018.vtc PASS: tests/e00017.vtc PASS: tests/e00022.vtc PASS: tests/e00020.vtc PASS: tests/d00012.vtc PASS: tests/e00021.vtc PASS: tests/d00037.vtc PASS: tests/e00019.vtc PASS: tests/e00024.vtc PASS: tests/e00023.vtc PASS: tests/e00025.vtc PASS: tests/c00034.vtc PASS: tests/e00026.vtc PASS: tests/e00006.vtc SKIP: tests/h00001.vtc PASS: tests/e00028.vtc PASS: tests/e00027.vtc SKIP: tests/h00002.vtc SKIP: tests/h00003.vtc PASS: tests/d00007.vtc SKIP: tests/h00004.vtc PASS: tests/e00030.vtc PASS: tests/e00029.vtc SKIP: tests/h00005.vtc SKIP: tests/h00006.vtc SKIP: tests/h00007.vtc SKIP: tests/j00004.vtc PASS: tests/e00032.vtc SKIP: tests/j00001.vtc PASS: tests/c00083.vtc PASS: tests/e00036.vtc SKIP: tests/j00003.vtc SKIP: tests/j00000.vtc PASS: tests/e00031.vtc PASS: tests/c00121.vtc PASS: tests/e00037.vtc PASS: tests/e00034.vtc PASS: tests/c00095.vtc PASS: tests/c00080.vtc PASS: tests/f00010.vtc PASS: tests/e00015.vtc PASS: tests/g00000.vtc PASS: tests/f00007.vtc PASS: tests/e00035.vtc PASS: tests/i00000.vtc PASS: tests/f00017.vtc PASS: tests/e00033.vtc PASS: tests/f00011.vtc PASS: tests/f00001.vtc PASS: tests/g00001.vtc PASS: tests/c00122.vtc PASS: tests/g00008.vtc PASS: tests/g00007.vtc PASS: tests/g00004.vtc PASS: tests/g00002.vtc PASS: tests/f00004.vtc PASS: tests/f00015.vtc PASS: tests/d00032.vtc PASS: tests/g00003.vtc PASS: tests/l00000.vtc PASS: tests/l00002.vtc PASS: tests/m00025.vtc PASS: tests/l00001.vtc SKIP: tests/p00002.vtc SKIP: tests/p00003.vtc PASS: tests/c00077.vtc SKIP: tests/p00000.vtc SKIP: tests/p00004.vtc SKIP: tests/p00007.vtc SKIP: tests/p00005.vtc SKIP: tests/p00006.vtc PASS: tests/l00004.vtc SKIP: tests/p00008.vtc PASS: tests/i00001.vtc SKIP: tests/p00009.vtc PASS: tests/l00003.vtc PASS: tests/l00005.vtc PASS: tests/l00007.vtc PASS: tests/m00019.vtc PASS: tests/m00055.vtc PASS: tests/m00052.vtc PASS: tests/m00023.vtc PASS: tests/l00006.vtc PASS: tests/m00024.vtc PASS: tests/r00310.vtc PASS: tests/g00006.vtc PASS: tests/m00060.vtc PASS: tests/m00051.vtc PASS: tests/o00003.vtc PASS: tests/r00409.vtc PASS: tests/f00008.vtc PASS: tests/o00006.vtc PASS: tests/m00027.vtc PASS: tests/m00054.vtc PASS: tests/o00001.vtc PASS: tests/m00058.vtc PASS: tests/o02001.vtc PASS: tests/r00325.vtc PASS: tests/r00251.vtc PASS: tests/f00005.vtc PASS: tests/p00010.vtc PASS: tests/r00262.vtc PASS: tests/r00255.vtc PASS: tests/r00102.vtc PASS: tests/r00318.vtc PASS: tests/r00326.vtc PASS: tests/r00306.vtc PASS: tests/r00292.vtc PASS: tests/m00008.vtc PASS: tests/r00387.vtc PASS: tests/r00386.vtc PASS: tests/m00059.vtc PASS: tests/r00411.vtc PASS: tests/m00022.vtc PASS: tests/r00400.vtc PASS: tests/r00416.vtc PASS: tests/o00005.vtc PASS: tests/m00053.vtc PASS: tests/r00655.vtc PASS: tests/r00345.vtc PASS: tests/m00057.vtc PASS: tests/r00412.vtc PASS: tests/g00005.vtc PASS: tests/m00049.vtc PASS: tests/m00021.vtc PASS: tests/r00425.vtc PASS: tests/r00427.vtc PASS: tests/r00433.vtc PASS: tests/o00002.vtc PASS: tests/r00498.vtc PASS: tests/r00495.vtc PASS: tests/r00494.vtc PASS: tests/r00476.vtc PASS: tests/r00466.vtc PASS: tests/r00445.vtc PASS: tests/r00502.vtc SKIP: tests/r00915.vtc PASS: tests/r00612.vtc PASS: tests/r00506.vtc PASS: tests/r00679.vtc PASS: tests/r00524.vtc PASS: tests/r00545.vtc PASS: tests/r00549.vtc PASS: tests/r00916.vtc PASS: tests/r00667.vtc PASS: tests/r00561.vtc PASS: tests/r00702.vtc PASS: tests/r00763.vtc PASS: tests/r00641.vtc SKIP: tests/r00962.vtc PASS: tests/r00789.vtc PASS: tests/r00558.vtc PASS: tests/o00000.vtc PASS: tests/r00590.vtc PASS: tests/r00733.vtc PASS: tests/m00003.vtc PASS: tests/r00776.vtc PASS: tests/r00686.vtc PASS: tests/r00769.vtc PASS: tests/r00700.vtc PASS: tests/o00004.vtc PASS: tests/r00694.vtc PASS: tests/r00742.vtc PASS: tests/r00832.vtc PASS: tests/r00803.vtc PASS: tests/r00704.vtc PASS: tests/r00861.vtc PASS: tests/r00873.vtc PASS: tests/r00894.vtc PASS: tests/r00913.vtc PASS: tests/r00902.vtc PASS: tests/r00781.vtc PASS: tests/r00896.vtc PASS: tests/r00911.vtc PASS: tests/r00921.vtc PASS: tests/r00795.vtc PASS: tests/r01002.vtc PASS: tests/r00722.vtc PASS: tests/r00961.vtc PASS: tests/r00917.vtc PASS: tests/r00972.vtc PASS: tests/r00942.vtc PASS: tests/r00965.vtc PASS: tests/r00979.vtc PASS: tests/r00980.vtc PASS: tests/r01212.vtc SKIP: tests/r01225.vtc PASS: tests/r01014.vtc SKIP: tests/r01266.vtc PASS: tests/r00963.vtc PASS: tests/r01038.vtc PASS: tests/r01029.vtc PASS: tests/r01037.vtc PASS: tests/r01109.vtc PASS: tests/r01134.vtc PASS: tests/r01068.vtc PASS: tests/r01092.vtc PASS: tests/r01086.vtc PASS: tests/r00984.vtc PASS: tests/r00940.vtc PASS: tests/r01123.vtc PASS: tests/r01036.vtc PASS: tests/r01120.vtc PASS: tests/r00941.vtc PASS: tests/r00806.vtc PASS: tests/r01168.vtc PASS: tests/r01157.vtc PASS: tests/r01030.vtc PASS: tests/r01169.vtc PASS: tests/r01113.vtc PASS: tests/r01145.vtc PASS: tests/r01140.vtc PASS: tests/r01144.vtc PASS: tests/r01156.vtc PASS: tests/r01175.vtc PASS: tests/r01073.vtc PASS: tests/r01176.vtc PASS: tests/r01211.vtc PASS: tests/r01255.vtc PASS: tests/r01287.vtc PASS: tests/r01349.vtc PASS: tests/r01274.vtc PASS: tests/r01275.vtc PASS: tests/r01320.vtc PASS: tests/r01296.vtc PASS: tests/r01218.vtc PASS: tests/r01333.vtc PASS: tests/r01510.vtc PASS: tests/r01164.vtc PASS: tests/r00956.vtc PASS: tests/r01337.vtc PASS: tests/r00878.vtc PASS: tests/r01395.vtc PASS: tests/r01355.vtc PASS: tests/r01398.vtc PASS: tests/r01332.vtc PASS: tests/r01569.vtc PASS: tests/r01356.vtc PASS: tests/r01417.vtc PASS: tests/r01401.vtc PASS: tests/r01404.vtc PASS: tests/m00048.vtc PASS: tests/r01367.vtc PASS: tests/r01498.vtc PASS: tests/r01406.vtc PASS: tests/r01493.vtc PASS: tests/r01494.vtc PASS: tests/m00000.vtc PASS: tests/r01284.vtc PASS: tests/r01506.vtc PASS: tests/r01441.vtc PASS: tests/r01501.vtc PASS: tests/r01504.vtc PASS: tests/r01391.vtc PASS: tests/r01485.vtc PASS: tests/r01468.vtc PASS: tests/r01524.vtc PASS: tests/r01399.vtc PASS: tests/r01532.vtc PASS: tests/r01442.vtc PASS: tests/r01419.vtc PASS: tests/r01499.vtc PASS: tests/r01350.vtc PASS: tests/r01566.vtc PASS: tests/r01576.vtc SKIP: tests/r01762.vtc PASS: tests/r01557.vtc PASS: tests/r01518.vtc PASS: tests/r01575.vtc PASS: tests/r01184.vtc PASS: tests/r01581.vtc PASS: tests/r01602.vtc PASS: tests/r01562.vtc PASS: tests/r01637.vtc PASS: tests/r01598.vtc PASS: tests/r01612.vtc PASS: tests/r01644.vtc PASS: tests/r01627.vtc PASS: tests/r01624.vtc PASS: tests/r01577.vtc PASS: tests/r01650.vtc PASS: tests/r01641.vtc PASS: tests/r01662.vtc PASS: tests/r01512.vtc PASS: tests/r01660.vtc PASS: tests/r01608.vtc PASS: tests/r01638.vtc PASS: tests/r01672.vtc PASS: tests/r01688.vtc PASS: tests/r01746.vtc PASS: tests/r01837.vtc PASS: tests/r01684.vtc PASS: tests/r01729.vtc PASS: tests/r01691.vtc PASS: tests/r01739.vtc PASS: tests/r01312.vtc PASS: tests/r01755.vtc PASS: tests/r01761.vtc PASS: tests/r01693.vtc PASS: tests/r01783.vtc PASS: tests/r01768.vtc PASS: tests/r01781.vtc PASS: tests/r01730.vtc PASS: tests/r01801.vtc PASS: tests/r01764.vtc PASS: tests/r01732.vtc PASS: tests/r01478.vtc PASS: tests/r01804.vtc PASS: tests/r01806.vtc PASS: tests/r01777.vtc PASS: tests/r01807.vtc PASS: tests/r01826.vtc PASS: tests/r01838.vtc PASS: tests/r01613.vtc PASS: tests/r01818.vtc PASS: tests/r01834.vtc PASS: tests/r01765.vtc PASS: tests/r01821.vtc PASS: tests/r01847.vtc PASS: tests/r01775.vtc PASS: tests/r01843.vtc PASS: tests/r01856.vtc PASS: tests/r01878.vtc PASS: tests/r02262.vtc PASS: tests/r01810.vtc SKIP: tests/r02275.vtc PASS: tests/r01665.vtc PASS: tests/r01737.vtc PASS: tests/r01918.vtc PASS: tests/r01881.vtc PASS: tests/r01890.vtc PASS: tests/r01578.vtc PASS: tests/r01772.vtc PASS: tests/r01858.vtc PASS: tests/r01648.vtc PASS: tests/r01941.vtc PASS: tests/r02321.vtc PASS: tests/r02325.vtc PASS: tests/r01857.vtc PASS: tests/r01955.vtc PASS: tests/r01914.vtc PASS: tests/r02142.vtc PASS: tests/r01990.vtc PASS: tests/r02084.vtc PASS: tests/r02135.vtc PASS: tests/r01953.vtc PASS: tests/r01956.vtc PASS: tests/r01879.vtc PASS: tests/r02219.vtc PASS: tests/r02035.vtc PASS: tests/r02233.vtc PASS: tests/r01924.vtc PASS: tests/r02069.vtc PASS: tests/r01927.vtc PASS: tests/r02036.vtc PASS: tests/r02105.vtc PASS: tests/r02300.vtc PASS: tests/r02148.vtc PASS: tests/r02291.vtc PASS: tests/r02175.vtc PASS: tests/r02429.vtc PASS: tests/r02342.vtc PASS: tests/r02310.vtc PASS: tests/r02319.vtc PASS: tests/r02339.vtc PASS: tests/r02351.vtc PASS: tests/r02387.vtc PASS: tests/r02305.vtc PASS: tests/r02406.vtc PASS: tests/r02266.vtc PASS: tests/r02451.vtc PASS: tests/r02488.vtc PASS: tests/r02372.vtc PASS: tests/r02422.vtc PASS: tests/r02494.vtc PASS: tests/r02530.vtc PASS: tests/r02413.vtc PASS: tests/r02554.vtc PASS: tests/r02617.vtc PASS: tests/r02367.vtc PASS: tests/r02589.vtc PASS: tests/r02539.vtc PASS: tests/r02157.vtc PASS: tests/r02647.vtc PASS: tests/r02395.vtc PASS: tests/r02633.vtc PASS: tests/r02555.vtc PASS: tests/r02700.vtc PASS: tests/r02618.vtc PASS: tests/r02471.vtc PASS: tests/r02705.vtc PASS: tests/r02527.vtc PASS: tests/r02775.vtc PASS: tests/r02645.vtc PASS: tests/r02177.vtc PASS: tests/r02763.vtc PASS: tests/r02679.vtc PASS: tests/r02880.vtc PASS: tests/r02258.vtc PASS: tests/r02934.vtc PASS: tests/r02887.vtc PASS: tests/r02646.vtc PASS: tests/r03098.vtc PASS: tests/r02690.vtc PASS: tests/r02937.vtc PASS: tests/r02042.vtc PASS: tests/r02872.vtc PASS: tests/r03003.vtc PASS: tests/r02964.vtc PASS: tests/r02686.vtc PASS: tests/r03360.vtc PASS: tests/r02831.vtc PASS: tests/r03221.vtc PASS: tests/r03093.vtc PASS: tests/r03109.vtc PASS: tests/r02649.vtc PASS: tests/r03308.vtc PASS: tests/r03131.vtc PASS: tests/r03301.vtc PASS: tests/r03329.vtc PASS: tests/r02433.vtc PASS: tests/r03241.vtc PASS: tests/r03266.vtc PASS: tests/r03353.vtc PASS: tests/r03019.vtc PASS: tests/r02432.vtc PASS: tests/r03079.vtc PASS: tests/r02849.vtc PASS: tests/r03253.vtc PASS: tests/r03319.vtc PASS: tests/r03354.vtc PASS: tests/r03410.vtc PASS: tests/r03960.vtc PASS: tests/r03417.vtc PASS: tests/r02839.vtc PASS: tests/r03416.vtc PASS: tests/r03385.vtc PASS: tests/r03189.vtc PASS: tests/r03089.vtc PASS: tests/r02946.vtc PASS: tests/r02270.vtc PASS: tests/r03006.vtc PASS: tests/r02990.vtc PASS: tests/r03546.vtc PASS: tests/r02702.vtc PASS: tests/r02722.vtc PASS: tests/r03502.vtc PASS: tests/r03706.vtc PASS: tests/r03159.vtc PASS: tests/r03556.vtc PASS: tests/r03560.vtc PASS: tests/r03525.vtc PASS: tests/r03394.vtc PASS: tests/r03169.vtc PASS: tests/r02976.vtc PASS: tests/r03402.vtc PASS: tests/r03463.vtc PASS: tests/r03830.vtc PASS: tests/r03709.vtc FAIL: tests/r02923.vtc PASS: tests/r03865.vtc PASS: tests/r03962.vtc PASS: tests/r03433.vtc PASS: tests/r04276.vtc PASS: tests/r04053.vtc PASS: tests/r03856.vtc PASS: tests/r03984.vtc PASS: tests/r04036.vtc PASS: tests/r03794.vtc PASS: tests/r04164.vtc PASS: tests/t02002.vtc PASS: tests/r01490.vtc PASS: tests/t02008.vtc PASS: tests/s00006.vtc PASS: tests/r03564.vtc PASS: tests/t02001.vtc PASS: tests/t02012.vtc PASS: tests/t02010.vtc PASS: tests/t02005.vtc PASS: tests/s00000.vtc PASS: tests/t02004.vtc PASS: tests/t02013.vtc PASS: tests/t02017.vtc PASS: tests/s00011.vtc PASS: tests/s00008.vtc PASS: tests/s00007.vtc PASS: tests/t02009.vtc PASS: tests/t02015.vtc PASS: tests/t02007.vtc PASS: tests/r03734.vtc PASS: tests/s00001.vtc PASS: tests/r03895.vtc FAIL: tests/s00009.vtc PASS: tests/t02006.vtc PASS: tests/t02018.vtc PASS: tests/t02024.vtc PASS: tests/r03996.vtc PASS: tests/t02019.vtc PASS: tests/t02011.vtc PASS: tests/t02021.vtc PASS: tests/u00018.vtc PASS: tests/t02026.vtc FAIL: tests/s00004.vtc PASS: tests/s00010.vtc PASS: tests/t02023.vtc PASS: tests/t02022.vtc PASS: tests/t02020.vtc PASS: tests/u00002.vtc PASS: tests/t02027.vtc PASS: tests/u00012.vtc PASS: tests/u00013.vtc PASS: tests/s00002.vtc PASS: tests/u00001.vtc PASS: tests/u00019.vtc PASS: tests/u00011.vtc PASS: tests/u00017.vtc PASS: tests/t02014.vtc PASS: tests/v00000.vtc PASS: tests/u00007.vtc PASS: tests/t02016.vtc PASS: tests/v00001.vtc PASS: tests/v00009.vtc PASS: tests/u00004.vtc SKIP: tests/v00022.vtc PASS: tests/u00016.vtc PASS: tests/v00004.vtc PASS: tests/v00015.vtc PASS: tests/v00012.vtc PASS: tests/t02000.vtc PASS: tests/v00011.vtc PASS: tests/u00015.vtc PASS: tests/v00013.vtc PASS: tests/v00016.vtc PASS: tests/u00014.vtc PASS: tests/s00003.vtc PASS: tests/t02025.vtc PASS: tests/v00008.vtc PASS: tests/r03038.vtc PASS: tests/v00024.vtc PASS: tests/s00005.vtc PASS: tests/u00005.vtc PASS: tests/v00027.vtc PASS: tests/u00008.vtc PASS: tests/v00032.vtc PASS: tests/v00010.vtc PASS: tests/v00033.vtc PASS: tests/v00031.vtc PASS: tests/u00021.vtc FAIL: tests/v00014.vtc PASS: tests/v00037.vtc PASS: tests/v00042.vtc PASS: tests/u00010.vtc PASS: tests/t02003.vtc PASS: tests/v00002.vtc PASS: tests/v00005.vtc PASS: tests/v00021.vtc PASS: tests/v00017.vtc PASS: tests/v00039.vtc PASS: tests/v00049.vtc PASS: tests/v00047.vtc PASS: tests/v00034.vtc PASS: tests/v00043.vtc PASS: tests/v00019.vtc PASS: tests/v00052.vtc PASS: tests/u00006.vtc PASS: tests/v00055.vtc PASS: tests/v00062.vtc PASS: tests/v00059.vtc PASS: tests/v00040.vtc PASS: tests/v00065.vtc PASS: tests/u00020.vtc PASS: tests/u00009.vtc PASS: tests/u00003.vtc PASS: tests/v00050.vtc PASS: tests/v00066.vtc PASS: tests/v00068.vtc PASS: tests/v00064.vtc PASS: tests/v00056.vtc PASS: tests/v00038.vtc PASS: tests/v00071.vtc PASS: tests/v00045.vtc PASS: tests/v00041.vtc PASS: tests/v00060.vtc PASS: tests/v00057.vtc PASS: tests/u00000.vtc PASS: tests/x00000.vtc PASS: tests/v00070.vtc PASS: tests/v00069.vtc PASS: tests/v00058.vtc PASS: tests/v00073.vtc PASS: tests/v00067.vtc PASS: tests/r03940.vtc PASS: tests/v00054.vtc PASS: tests/v00020.vtc PASS: tests/v00018.vtc PASS: tests/v00006.vtc PASS: tests/v00025.vtc FAIL: tests/v00072.vtc PASS: tests/v00063.vtc PASS: tests/v00046.vtc PASS: tests/v00074.vtc PASS: tests/v00051.vtc FAIL: tests/s00012.vtc FAIL: tests/s00013.vtc PASS: tests/v00003.vtc =================================================== Varnish 7.7.0: bin/varnishtest/test-suite.log =================================================== # TOTAL: 892 # PASS: 847 # SKIP: 36 # XFAIL: 0 # FAIL: 9 # XPASS: 0 # ERROR: 0 System information (uname -a): Linux 6.12.33+deb12-amd64 #1 SMP PREEMPT_DYNAMIC Debian 6.12.33-1~bpo12+1 (2025-07-09) x86_64 Distribution information (/etc/os-release): PRETTY_NAME="Debian GNU/Linux 13 (trixie)" NAME="Debian GNU/Linux" VERSION_ID="13" VERSION="13 (trixie)" VERSION_CODENAME=trixie DEBIAN_VERSION_FULL=13.0 ID=debian HOME_URL="https://www.debian.org/" .. contents:: :depth: 2 SKIP: tests/a00001 ================== **** dT 0.000 * top TEST ./tests/a00001.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:45839 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3626428.762d34fe **** top macro def vtcid=vtc.3626428.762d34fe **** dT 0.001 ** top === vtest "Test Teken terminal emulator" * top VTEST Test Teken terminal emulator ** top === feature cmd "vttest --version 2>&1 | grep -q Usage" **** dT 0.011 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/a00001.vtc * top TEST ./tests/a00001.vtc completed # top TEST ./tests/a00001.vtc skipped (0.042) SKIP tests/a00001.vtc (exit status: 77) SKIP: tests/a00014 ================== **** dT 0.000 * top TEST ./tests/a00014.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:42831 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3626556.2d2a4188 **** top macro def vtcid=vtc.3626556.2d2a4188 ** top === varnishtest "Custom feature verification" * top VTEST Custom feature verification ** top === feature cmd true **** dT 0.008 ** top === feature cmd false **** dT 0.015 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/a00014.vtc * top TEST ./tests/a00014.vtc completed # top TEST ./tests/a00014.vtc skipped (0.056) SKIP tests/a00014.vtc (exit status: 77) SKIP: tests/a02022 ================== **** dT 0.000 * top TEST ./tests/a02022.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:45447 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3627693.639702f6 **** top macro def vtcid=vtc.3627693.639702f6 ** top === varnishtest "H/1 -> H/2 upgrade" * top VTEST H/1 -> H/2 upgrade ** top === feature cmd "nghttp --version | grep -q 'nghttp2/[1-9]'" **** dT 0.011 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/a02022.vtc * top TEST ./tests/a02022.vtc completed * diag 0.0 sh: 1: nghttp: not found # top TEST ./tests/a02022.vtc skipped (0.090) SKIP tests/a02022.vtc (exit status: 77) SKIP: tests/b00089 ================== **** dT 0.000 * top TEST ./tests/b00089.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:44203 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3635593.2c2c5c60 **** top macro def vtcid=vtc.3635593.2c2c5c60 ** top === varnishtest "connect: blackhole" * top VTEST connect: blackhole ** top === feature cmd false **** dT 0.002 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/b00089.vtc * top TEST ./tests/b00089.vtc completed # top TEST ./tests/b00089.vtc skipped (0.085) SKIP tests/b00089.vtc (exit status: 77) SKIP: tests/b00090 ================== **** dT 0.000 * top TEST ./tests/b00090.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:38337 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3635778.41cbaf07 **** top macro def vtcid=vtc.3635778.41cbaf07 ** top === varnishtest "connect: blackhole with queueing" * top VTEST connect: blackhole with queueing ** top === feature cmd false **** dT 0.005 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/b00090.vtc * top TEST ./tests/b00090.vtc completed # top TEST ./tests/b00090.vtc skipped (0.084) SKIP tests/b00090.vtc (exit status: 77) SKIP: tests/b00091 ================== **** dT 0.000 * top TEST ./tests/b00091.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:43205 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3635812.3516fde5 **** top macro def vtcid=vtc.3635812.3516fde5 ** top === varnishtest "IPs/port in varnishadm backend.list -j" * top VTEST IPs/port in varnishadm backend.list -j ** top === feature cmd "jq -V" **** dT 0.003 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/b00091.vtc * top TEST ./tests/b00091.vtc completed * diag 0.0 sh: 1: jq: not found # top TEST ./tests/b00091.vtc skipped (0.014) SKIP tests/b00091.vtc (exit status: 77) FAIL: tests/c00049 ================== **** dT 0.000 * top TEST ./tests/c00049.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:35037 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3640258.015fd938 **** top macro def vtcid=vtc.3640258.015fd938 ** top === varnishtest "New ban-lurker test" * top VTEST New ban-lurker test ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=38753 **** s1 macro def s1_sock=127.0.0.1:38753 * s1 Listen on 127.0.0.1:38753 ** top === varnish v1 -vcl+backend {} -start **** dT 0.001 ** s1 Started on 127.0.0.1:38753 (1 iterations) **** dT 0.012 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3640258.015fd938/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 41107' -P /tmp/vtc.3640258.015fd938/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3640258.015fd938/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 41107' -P /tmp/vtc.3640258.015fd938/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 PID: 3640353 **** v1 macro def v1_pid=3640353 **** v1 macro def v1_name=/tmp/vtc.3640258.015fd938/v1 **** dT 0.041 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.142 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 6 *** v1 CLI RX 107 **** v1 CLI RX|fblgxdrohgegnzcmghjygrzpzwkdhskm **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** v1 CLI TX|auth 3583ce2fb558879b8a5b3dc249364272c75cc93e316a190906b34714eed88156 **** dT 0.146 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX|backend s1 { .host = "127.0.0.1"; .port = "38753"; } **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.250 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.354 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.454 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.558 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.658 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.758 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.858 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.958 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.058 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.158 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.259 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.362 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.462 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.562 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.662 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.762 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.862 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.962 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 2.005 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 2.058 *** v1 debug|Debug: Child (3642720) Started **** dT 2.089 *** v1 debug|Child launched OK **** dT 2.096 *** v1 debug|Info: Child (3642720) said Child starts *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** dT 2.138 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 43111 **** v1 CLI TX|debug.xid 1000 **** dT 2.163 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811014.443710/vgc.so 1auto **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811014.443710/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:43111 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:43111 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:43111 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:43111 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:43111 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:43111 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:43111 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:43111 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 43111 **** dT 2.182 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 2.234 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 43111 ** v1 Listen on 127.0.0.1 43111 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=43111 **** v1 macro def v1_sock=127.0.0.1:43111 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=43111 **** v1 macro def v1_a0_sock=127.0.0.1:43111 ** top === varnish v1 -cliok "param.set ban_lurker_age 0" **** v1 CLI TX|param.set ban_lurker_age 0 **** dT 2.263 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 43111 **** dT 2.278 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set ban_lurker_sleep 0" **** v1 CLI TX|param.set ban_lurker_sleep 0 **** dT 2.322 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set debug +lurker" **** v1 CLI TX|param.set debug +lurker **** dT 2.366 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set debug +syncvsl" **** v1 CLI TX|param.set debug +syncvsl **** dT 2.410 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 2.414 ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 *** c1 connected fd 16 from 127.0.0.1 37424 to 127.0.0.1:43111 ** c1 === txreq -url /1 **** c1 txreq|GET /1 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 2.417 *** s1 accepted fd 4 127.0.0.1 47738 ** s1 === rxreq **** dT 2.418 **** s1 rxhdr|GET /1 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1002\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/1 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1002 **** s1 bodylen = 0 ** s1 === expect req.url == /1 **** s1 EXPECT req.url (/1) == "/1" match ** s1 === txresp -hdr "Foo: bar1" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar1\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 2.433 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar1\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1001\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 196 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar1 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:56 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1001 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar1 **** c1 EXPECT resp.http.foo (bar1) == "bar1" match ** c1 === txreq -url /2 **** c1 txreq|GET /2 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** s1 rxhdr|GET /2 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1004\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/2 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1004 **** s1 bodylen = 0 ** s1 === expect req.url == /2 **** s1 EXPECT req.url (/2) == "/2" match ** s1 === txresp -hdr "Foo: bar2" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar2\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 2.446 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar2\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1003\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 196 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar2 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:56 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1003 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar2 **** c1 EXPECT resp.http.foo (bar2) == "bar2" match *** c1 closing fd 16 ** c1 Ending **** dT 2.447 ** top === varnish v1 -cliok "ban obj.http.foo == bar1" **** v1 CLI TX|ban obj.http.foo == bar1 **** dT 2.463 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 37424 a0 127.0.0.1 43111 1788811016.670850 19 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1000 Link c req 1001 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811016.670927 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811016.670927 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 37424 a0 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c /1 **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c hash **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 VCL_call c MISS **** v1 vsl| 1001 VCL_return c fetch **** v1 vsl| 1002 Begin b bereq 1001 fetch **** v1 vsl| 1002 VCL_use b vcl1 **** v1 vsl| 1001 Link c bereq 1002 fetch **** v1 vsl| 1002 Timestamp b Start: 1788811016.671114 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b GET **** v1 vsl| 1002 BereqURL b /1 **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b User-Agent: c1 **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1002 BereqHeader b X-Varnish: 1002 **** v1 vsl| 1002 VCL_call b BACKEND_FETCH **** v1 vsl| 1002 VCL_return b fetch **** v1 vsl| 1002 Timestamp b Fetch: 1788811016.671139 0.000025 0.000025 **** v1 vsl| 1002 Timestamp b Connected: 1788811016.671398 0.000283 0.000258 **** v1 vsl| 1002 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 connect **** v1 vsl| 1002 Timestamp b Bereq: 1788811016.671447 0.000333 0.000049 **** v1 vsl| 1002 BerespProtocol b HTTP/1.1 **** v1 vsl| 1002 BerespStatus b 200 **** v1 vsl| 1002 BerespReason b OK **** v1 vsl| 1002 BerespHeader b Foo: bar1 **** v1 vsl| 1002 BerespHeader b Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1002 BerespHeader b Server: s1 **** v1 vsl| 1002 BerespHeader b Content-Length: 0 **** v1 vsl| 1002 Timestamp b Beresp: 1788811016.675674 0.004560 0.004226 **** v1 vsl| 1002 TTL b RFC 120 10 0 1788811017 1788811017 1788811016 0 0 cacheable **** v1 vsl| 1002 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1002 VCL_return b deliver **** v1 vsl| 1002 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1002 Timestamp b Process: 1788811016.675774 0.004660 0.000100 **** v1 vsl| 1002 Filters b **** v1 vsl| 1002 Storage b malloc s0 **** v1 vsl| 1002 Fetch_Body b 0 none - **** v1 vsl| 1002 BackendClose b 22 s1 recycle **** v1 vsl| 1002 Timestamp b BerespBody: 1788811016.685989 0.014874 0.010214 **** v1 vsl| 1002 Length b 0 **** v1 vsl| 1002 BereqAcct b 147 0 147 98 0 98 **** v1 vsl| 1002 End b **** v1 vsl| 1001 Timestamp c Fetch: 1788811016.686113 0.015185 0.015185 **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 200 **** v1 vsl| 1001 RespReason c OK **** v1 vsl| 1001 RespHeader c Foo: bar1 **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1001 RespHeader c Server: s1 **** v1 vsl| 1001 RespHeader c Content-Length: 0 **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 RespHeader c Age: 0 **** v1 vsl| 1001 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1001 VCL_call c DELIVER **** v1 vsl| 1001 VCL_return c deliver **** v1 vsl| 1001 Timestamp c Process: 1788811016.686146 0.015218 0.000032 **** v1 vsl| 1001 Filters c **** v1 vsl| 1001 RespHeader c Connection: keep-alive **** v1 vsl| 1001 Timestamp c Resp: 1788811016.686221 0.015294 0.000075 **** v1 vsl| 1001 ReqAcct c 52 0 52 196 0 196 **** v1 vsl| 1001 End c **** v1 vsl| 1003 Begin c req 1000 rxreq **** v1 vsl| 1000 Link c req 1003 rxreq **** v1 vsl| 1003 Timestamp c Start: 1788811016.686802 0.000000 0.000000 **** v1 vsl| 1003 Timestamp c Req: 1788811016.686802 0.000000 0.000000 **** v1 vsl| 1003 VCL_use c vcl1 **** v1 vsl| 1003 ReqStart c 127.0.0.1 37424 a0 **** v1 vsl| 1003 ReqMethod c GET **** v1 vsl| 1003 ReqURL c /2 **** v1 vsl| 1003 ReqProtocol c HTTP/1.1 **** v1 vsl| 1003 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c User-Agent: c1 **** v1 vsl| 1003 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 VCL_call c RECV **** v1 vsl| 1003 VCL_return c hash **** v1 vsl| 1003 VCL_call c HASH **** v1 vsl| 1003 VCL_return c lookup **** v1 vsl| 1003 VCL_call c MISS **** v1 vsl| 1003 VCL_return c fetch **** v1 vsl| 1004 Begin b bereq 1003 fetch **** v1 vsl| 1004 VCL_use b vcl1 **** v1 vsl| 1003 Link c bereq 1004 fetch **** v1 vsl| 1004 Timestamp b Start: 1788811016.686876 0.000000 0.000000 **** v1 vsl| 1004 BereqMethod b GET **** v1 vsl| 1004 BereqURL b /2 **** v1 vsl| 1004 BereqProtocol b HTTP/1.1 **** v1 vsl| 1004 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1004 BereqHeader b User-Agent: c1 **** v1 vsl| 1004 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1004 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1004 BereqHeader b X-Varnish: 1004 **** v1 vsl| 1004 VCL_call b BACKEND_FETCH **** v1 vsl| 1004 VCL_return b fetch **** v1 vsl| 1004 Timestamp b Fetch: 1788811016.686893 0.000016 0.000016 **** v1 vsl| 1004 Timestamp b Connected: 1788811016.686898 0.000022 0.000005 **** v1 vsl| 1004 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 reuse **** v1 vsl| 1004 Timestamp b Bereq: 1788811016.686957 0.000081 0.000058 **** v1 vsl| 1004 BerespProtocol b HTTP/1.1 **** v1 vsl| 1004 BerespStatus b 200 **** v1 vsl| 1004 BerespReason b OK **** v1 vsl| 1004 BerespHeader b Foo: bar2 **** v1 vsl| 1004 BerespHeader b Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1004 BerespHeader b Server: s1 **** v1 vsl| 1004 BerespHeader b Content-Length: 0 **** v1 vsl| 1004 Timestamp b Beresp: 1788811016.687491 0.000615 0.000534 **** v1 vsl| 1004 TTL b RFC 120 10 0 1788811017 1788811017 1788811016 0 0 cacheable **** v1 vsl| 1004 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1004 VCL_return b deliver **** v1 vsl| 1004 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1004 Timestamp b Process: 1788811016.687521 0.000645 0.000030 **** v1 vsl| 1004 Filters b **** v1 vsl| 1004 Storage b malloc s0 **** v1 vsl| 1004 Fetch_Body b 0 none - **** v1 vsl| 1004 BackendClose b 22 s1 recycle **** v1 vsl| 1004 Timestamp b BerespBody: 1788811016.697691 0.010814 0.010169 **** v1 vsl| 1004 Length b 0 **** v1 vsl| 1004 BereqAcct b 147 0 147 98 0 98 **** v1 vsl| 1004 End b **** v1 vsl| 1003 Timestamp c Fetch: 1788811016.697746 0.010944 0.010944 **** v1 vsl| 1003 RespProtocol c HTTP/1.1 **** v1 vsl| 1003 RespStatus c 200 **** v1 vsl| 1003 RespReason c OK **** v1 vsl| 1003 RespHeader c Foo: bar2 **** v1 vsl| 1003 RespHeader c Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1003 RespHeader c Server: s1 **** v1 vsl| 1003 RespHeader c Content-Length: 0 **** v1 vsl| 1003 RespHeader c X-Varnish: 1003 **** v1 vsl| 1003 RespHeader c Age: 0 **** v1 vsl| 1003 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1003 VCL_call c DELIVER **** v1 vsl| 1003 VCL_return c deliver **** v1 vsl| 1003 Timestamp c Process: 1788811016.699813 0.013010 0.002066 **** v1 vsl| 1003 Filters c **** v1 vsl| 1003 RespHeader c Connection: keep-alive **** v1 vsl| 1003 Timestamp c Resp: 1788811016.699911 0.013109 0.000098 **** v1 vsl| 1003 ReqAcct c 52 0 52 196 0 196 **** v1 vsl| 1003 End c **** v1 vsl| 1000 SessClose c REM_CLOSE 0.030 **** v1 vsl| 1000 End c **** dT 2.490 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 2.494 ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 *** c1 connected fd 16 from 127.0.0.1 37430 to 127.0.0.1:43111 ** c1 === txreq -url /3 **** c1 txreq|GET /3 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 2.495 **** s1 rxhdr|GET /3 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1007\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/3 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1007 **** s1 bodylen = 0 ** s1 === expect req.url == /3 **** s1 EXPECT req.url (/3) == "/3" match ** s1 === txresp -hdr "Foo: bar3" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar3\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r **** dT 2.506 ** s1 === rxreq **** dT 2.510 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar3\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1006\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 196 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar3 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:56 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1006 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar3 **** c1 EXPECT resp.http.foo (bar3) == "bar3" match *** c1 closing fd 16 ** c1 Ending **** dT 2.512 ** top === varnish v1 -cliok "ban obj.http.foo == bar2 && obj.http.foo ... **** v1 CLI TX|ban obj.http.foo == bar2 && obj.http.foo != foof **** dT 2.554 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 2.558 ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 *** c1 connected fd 16 from 127.0.0.1 37444 to 127.0.0.1:43111 ** c1 === txreq -url /4 **** c1 txreq|GET /4 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** s1 rxhdr|GET /4 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1010\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/4 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1010 **** s1 bodylen = 0 ** s1 === expect req.url == /4 **** s1 EXPECT req.url (/4) == "/4" match ** s1 === txresp -hdr "Foo: bar4" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar4\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 2.564 **** v1 vsl| 0 CLI - Rd ban obj.http.foo == bar1 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 1005 Begin c sess 0 HTTP/1 **** v1 vsl| 1005 SessOpen c 127.0.0.1 37430 a0 127.0.0.1 43111 1788811016.748135 20 **** v1 vsl| 1005 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1005 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1005 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1005 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1005 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1005 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1005 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1005 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1006 Begin c req 1005 rxreq **** v1 vsl| 1005 Link c req 1006 rxreq **** v1 vsl| 1006 Timestamp c Start: 1788811016.748197 0.000000 0.000000 **** v1 vsl| 1006 Timestamp c Req: 1788811016.748197 0.000000 0.000000 **** v1 vsl| 1006 VCL_use c vcl1 **** v1 vsl| 1006 ReqStart c 127.0.0.1 37430 a0 **** v1 vsl| 1006 ReqMethod c GET **** v1 vsl| 1006 ReqURL c /3 **** v1 vsl| 1006 ReqProtocol c HTTP/1.1 **** v1 vsl| 1006 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1006 ReqHeader c User-Agent: c1 **** v1 vsl| 1006 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1006 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1006 VCL_call c RECV **** v1 vsl| 1006 VCL_return c hash **** v1 vsl| 1006 VCL_call c HASH **** v1 vsl| 1006 VCL_return c lookup **** v1 vsl| 1006 VCL_call c MISS **** v1 vsl| 1006 VCL_return c fetch **** v1 vsl| 1007 Begin b bereq 1006 fetch **** v1 vsl| 1007 VCL_use b vcl1 **** v1 vsl| 1006 Link c bereq 1007 fetch **** v1 vsl| 1007 Timestamp b Start: 1788811016.748381 0.000000 0.000000 **** v1 vsl| 1007 BereqMethod b GET **** v1 vsl| 1007 BereqURL b /3 **** v1 vsl| 1007 BereqProtocol b HTTP/1.1 **** v1 vsl| 1007 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1007 BereqHeader b User-Agent: c1 **** v1 vsl| 1007 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1007 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1007 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1007 BereqHeader b X-Varnish: 1007 **** v1 vsl| 1007 VCL_call b BACKEND_FETCH **** v1 vsl| 1007 VCL_return b fetch **** v1 vsl| 1007 Timestamp b Fetch: 1788811016.748437 0.000055 0.000055 **** v1 vsl| 1007 Timestamp b Connected: 1788811016.748445 0.000063 0.000008 **** v1 vsl| 1007 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 reuse **** v1 vsl| 1007 Timestamp b Bereq: 1788811016.748551 0.000169 0.000105 **** v1 vsl| 1007 BerespProtocol b HTTP/1.1 **** v1 vsl| 1007 BerespStatus b 200 **** v1 vsl| 1007 BerespReason b OK **** v1 vsl| 1007 BerespHeader b Foo: bar3 **** v1 vsl| 1007 BerespHeader b Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1007 BerespHeader b Server: s1 **** v1 vsl| 1007 BerespHeader b Content-Length: 0 **** v1 vsl| 1007 Timestamp b Beresp: 1788811016.749081 0.000699 0.000530 **** v1 vsl| 1007 TTL b RFC 120 10 0 1788811017 1788811017 1788811016 0 0 cacheable **** v1 vsl| 1007 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1007 VCL_return b deliver **** v1 vsl| 1007 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1007 Timestamp b Process: 1788811016.749306 0.000924 0.000225 **** v1 vsl| 1007 Filters b **** v1 vsl| 1007 Storage b malloc s0 **** v1 vsl| 1007 Fetch_Body b 0 none - **** v1 vsl| 1007 BackendClose b 22 s1 recycle **** v1 vsl| 1007 Timestamp b BerespBody: 1788811016.763668 0.015286 0.014361 **** v1 vsl| 1007 Length b 0 **** v1 vsl| 1007 BereqAcct b 147 0 147 98 0 98 **** v1 vsl| 1007 End b **** v1 vsl| 1006 Timestamp c Fetch: 1788811016.763678 0.015481 0.015481 **** v1 vsl| 1006 RespProtocol c HTTP/1.1 **** v1 vsl| 1006 RespStatus c 200 **** v1 vsl| 1006 RespReason c OK **** v1 vsl| 1006 RespHeader c Foo: bar3 **** v1 vsl| 1006 RespHeader c Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1006 RespHeader c Server: s1 **** v1 vsl| 1006 RespHeader c Content-Length: 0 **** v1 vsl| 1006 RespHeader c X-Varnish: 1006 **** v1 vsl| 1006 RespHeader c Age: 0 **** v1 vsl| 1006 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1006 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1006 VCL_call c DELIVER **** v1 vsl| 1006 VCL_return c deliver **** v1 vsl| 1006 Timestamp c Process: 1788811016.763751 0.015554 0.000072 **** v1 vsl| 1006 Filters c **** v1 vsl| 1006 RespHeader c Connection: keep-alive **** v1 vsl| 1006 Timestamp c Resp: 1788811016.763843 0.015646 0.000092 **** v1 vsl| 1006 ReqAcct c 52 0 52 196 0 196 **** v1 vsl| 1006 End c **** v1 vsl| 1005 SessClose c REM_CLOSE 0.016 **** v1 vsl| 1005 End c **** v1 vsl| 0 CLI - Rd ban obj.http.foo == bar2 && obj.http.foo != foof **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 1008 Begin c sess 0 HTTP/1 **** v1 vsl| 1008 SessOpen c 127.0.0.1 37444 a0 127.0.0.1 43111 1788811016.811911 21 **** v1 vsl| 1008 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1008 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1008 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1008 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1008 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1008 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1008 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1008 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1009 Begin c req 1008 rxreq **** v1 vsl| 1008 Link c req 1009 rxreq **** v1 vsl| 1009 Timestamp c Start: 1788811016.811957 0.000000 0.000000 **** v1 vsl| 1009 Timestamp c Req: 1788811016.811957 0.000000 0.000000 **** v1 vsl| 1009 VCL_use c vcl1 **** v1 vsl| 1009 ReqStart c 127.0.0.1 37444 a0 **** v1 vsl| 1009 ReqMethod c GET **** v1 vsl| 1009 ReqURL c /4 **** v1 vsl| 1009 ReqProtocol c HTTP/1.1 **** v1 vsl| 1009 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1009 ReqHeader c User-Agent: c1 **** v1 vsl| 1009 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1009 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1009 VCL_call c RECV **** v1 vsl| 1009 VCL_return c hash **** v1 vsl| 1009 VCL_call c HASH **** v1 vsl| 1009 VCL_return c lookup **** v1 vsl| 1009 VCL_call c MISS **** v1 vsl| 1009 VCL_return c fetch **** v1 vsl| 1010 Begin b bereq 1009 fetch **** v1 vsl| 1010 VCL_use b vcl1 **** v1 vsl| 1009 Link c bereq 1010 fetch **** v1 vsl| 1010 Timestamp b Start: 1788811016.812040 0.000000 0.000000 **** v1 vsl| 1010 BereqMethod b GET **** v1 vsl| 1010 BereqURL b /4 **** v1 vsl| 1010 BereqProtocol b HTTP/1.1 **** v1 vsl| 1010 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1010 BereqHeader b User-Agent: c1 **** v1 vsl| 1010 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1010 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1010 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1010 BereqHeader b X-Varnish: 1010 **** v1 vsl| 1010 VCL_call b BACKEND_FETCH **** v1 vsl| 1010 VCL_return b fetch **** v1 vsl| 1010 Timestamp b Fetch: 1788811016.812058 0.000018 0.000018 **** v1 vsl| 1010 Timestamp b Connected: 1788811016.812062 0.000022 0.000004 **** v1 vsl| 1010 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 reuse **** v1 vsl| 1010 Timestamp b Bereq: 1788811016.812113 0.000073 0.000051 **** dT 2.578 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar4\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1009\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 196 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar4 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:56 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1009 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar4 **** c1 EXPECT resp.http.foo (bar4) == "bar4" match *** c1 closing fd 16 ** c1 Ending ** top === varnish v1 -cliok "ban req.http.kill == yes" **** v1 CLI TX|ban req.http.kill == yes **** dT 2.622 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 **** dT 2.626 *** c1 connected fd 16 from 127.0.0.1 37448 to 127.0.0.1:43111 ** c1 === txreq -url /5 **** c1 txreq|GET /5 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 2.630 **** s1 rxhdr|GET /5 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1013\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/5 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1013 **** s1 bodylen = 0 ** s1 === expect req.url == /5 **** s1 EXPECT req.url (/5) == "/5" match ** s1 === txresp -hdr "Foo: bar5" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar5\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 2.646 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar5\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1012\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 196 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar5 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:56 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1012 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar5 **** c1 EXPECT resp.http.foo (bar5) == "bar5" match *** c1 closing fd 16 ** c1 Ending ** top === varnish v1 -cliok "ban obj.http.foo == bar5" **** v1 CLI TX|ban obj.http.foo == bar5 **** dT 2.664 **** v1 vsl| 1010 BerespProtocol b HTTP/1.1 **** v1 vsl| 1010 BerespStatus b 200 **** v1 vsl| 1010 BerespReason b OK **** v1 vsl| 1010 BerespHeader b Foo: bar4 **** v1 vsl| 1010 BerespHeader b Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1010 BerespHeader b Server: s1 **** v1 vsl| 1010 BerespHeader b Content-Length: 0 **** v1 vsl| 1010 Timestamp b Beresp: 1788811016.819727 0.007687 0.007613 **** v1 vsl| 1010 TTL b RFC 120 10 0 1788811017 1788811017 1788811016 0 0 cacheable **** v1 vsl| 1010 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1010 VCL_return b deliver **** v1 vsl| 1010 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1010 Timestamp b Process: 1788811016.819762 0.007721 0.000034 **** v1 vsl| 1010 Filters b **** v1 vsl| 1010 Storage b malloc s0 **** v1 vsl| 1010 Fetch_Body b 0 none - **** v1 vsl| 1010 BackendClose b 22 s1 recycle **** v1 vsl| 1010 Timestamp b BerespBody: 1788811016.829931 0.017890 0.010169 **** v1 vsl| 1010 Length b 0 **** v1 vsl| 1010 BereqAcct b 147 0 147 98 0 98 **** v1 vsl| 1010 End b **** v1 vsl| 1009 Timestamp c Fetch: 1788811016.829979 0.018021 0.018021 **** v1 vsl| 1009 RespProtocol c HTTP/1.1 **** v1 vsl| 1009 RespStatus c 200 **** v1 vsl| 1009 RespReason c OK **** v1 vsl| 1009 RespHeader c Foo: bar4 **** v1 vsl| 1009 RespHeader c Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1009 RespHeader c Server: s1 **** v1 vsl| 1009 RespHeader c Content-Length: 0 **** v1 vsl| 1009 RespHeader c X-Varnish: 1009 **** v1 vsl| 1009 RespHeader c Age: 0 **** v1 vsl| 1009 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1009 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1009 VCL_call c DELIVER **** v1 vsl| 1009 VCL_return c deliver **** v1 vsl| 1009 Timestamp c Process: 1788811016.830008 0.018050 0.000029 **** v1 vsl| 1009 Filters c **** v1 vsl| 1009 RespHeader c Connection: keep-alive **** v1 vsl| 1009 Timestamp c Resp: 1788811016.830066 0.018108 0.000057 **** v1 vsl| 1009 ReqAcct c 52 0 52 196 0 196 **** v1 vsl| 1009 End c **** v1 vsl| 1008 SessClose c REM_CLOSE 0.020 **** v1 vsl| 1008 End c **** v1 vsl| 0 CLI - Rd ban req.http.kill == yes **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 1011 Begin c sess 0 HTTP/1 **** v1 vsl| 1011 SessOpen c 127.0.0.1 37448 a0 127.0.0.1 43111 1788811016.876248 19 **** v1 vsl| 1011 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1011 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1011 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1011 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1011 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1011 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1011 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1011 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1012 Begin c req 1011 rxreq **** v1 vsl| 1011 Link c req 1012 rxreq **** v1 vsl| 1012 Timestamp c Start: 1788811016.879770 0.000000 0.000000 **** v1 vsl| 1012 Timestamp c Req: 1788811016.879770 0.000000 0.000000 **** v1 vsl| 1012 VCL_use c vcl1 **** v1 vsl| 1012 ReqStart c 127.0.0.1 37448 a0 **** v1 vsl| 1012 ReqMethod c GET **** v1 vsl| 1012 ReqURL c /5 **** v1 vsl| 1012 ReqProtocol c HTTP/1.1 **** v1 vsl| 1012 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1012 ReqHeader c User-Agent: c1 **** v1 vsl| 1012 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1012 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1012 VCL_call c RECV **** v1 vsl| 1012 VCL_return c hash **** v1 vsl| 1012 VCL_call c HASH **** v1 vsl| 1012 VCL_return c lookup **** v1 vsl| 1012 VCL_call c MISS **** v1 vsl| 1012 VCL_return c fetch **** v1 vsl| 1013 Begin b bereq 1012 fetch **** v1 vsl| 1013 VCL_use b vcl1 **** v1 vsl| 1012 Link c bereq 1013 fetch **** v1 vsl| 1013 Timestamp b Start: 1788811016.879874 0.000000 0.000000 **** v1 vsl| 1013 BereqMethod b GET **** v1 vsl| 1013 BereqURL b /5 **** v1 vsl| 1013 BereqProtocol b HTTP/1.1 **** v1 vsl| 1013 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1013 BereqHeader b User-Agent: c1 **** v1 vsl| 1013 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1013 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1013 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1013 BereqHeader b X-Varnish: 1013 **** v1 vsl| 1013 VCL_call b BACKEND_FETCH **** v1 vsl| 1013 VCL_return b fetch **** v1 vsl| 1013 Timestamp b Fetch: 1788811016.879896 0.000022 0.000022 **** v1 vsl| 1013 Timestamp b Connected: 1788811016.879902 0.000028 0.000006 **** v1 vsl| 1013 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 reuse **** v1 vsl| 1013 Timestamp b Bereq: 1788811016.879960 0.000086 0.000057 **** v1 vsl| 1013 BerespProtocol b HTTP/1.1 **** v1 vsl| 1013 BerespStatus b 200 **** v1 vsl| 1013 BerespReason b OK **** v1 vsl| 1013 BerespHeader b Foo: bar5 **** v1 vsl| 1013 BerespHeader b Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1013 BerespHeader b Server: s1 **** v1 vsl| 1013 BerespHeader b Content-Length: 0 **** v1 vsl| 1013 Timestamp b Beresp: 1788811016.884206 0.004332 0.004245 **** v1 vsl| 1013 TTL b RFC 120 10 0 1788811017 1788811017 1788811016 0 0 cacheable **** v1 vsl| 1013 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1013 VCL_return b deliver **** v1 vsl| 1013 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1013 Timestamp b Process: 1788811016.884259 0.004385 0.000053 **** v1 vsl| 1013 Filters b **** v1 vsl| 1013 Storage b malloc s0 **** v1 vsl| 1013 Fetch_Body b 0 none - **** v1 vsl| 1013 BackendClose b 22 s1 recycle **** v1 vsl| 1013 Timestamp b BerespBody: 1788811016.899648 0.019774 0.015389 **** v1 vsl| 1013 Length b 0 **** v1 vsl| 1013 BereqAcct b 147 0 147 98 0 98 **** v1 vsl| 1013 End b **** v1 vsl| 1012 Timestamp c Fetch: 1788811016.899706 0.019935 0.019935 **** v1 vsl| 1012 RespProtocol c HTTP/1.1 **** v1 vsl| 1012 RespStatus c 200 **** v1 vsl| 1012 RespReason c OK **** v1 vsl| 1012 RespHeader c Foo: bar5 **** v1 vsl| 1012 RespHeader c Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1012 RespHeader c Server: s1 **** v1 vsl| 1012 RespHeader c Content-Length: 0 **** v1 vsl| 1012 RespHeader c X-Varnish: 1012 **** v1 vsl| 1012 RespHeader c Age: 0 **** v1 vsl| 1012 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1012 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1012 VCL_call c DELIVER **** v1 vsl| 1012 VCL_return c deliver **** v1 vsl| 1012 Timestamp c Process: 1788811016.899735 0.019964 0.000029 **** v1 vsl| 1012 Filters c **** v1 vsl| 1012 RespHeader c Connection: keep-alive **** v1 vsl| 1012 Timestamp c Resp: 1788811016.899807 0.020036 0.000071 **** v1 vsl| 1012 ReqAcct c 52 0 52 196 0 196 **** v1 vsl| 1012 End c **** v1 vsl| 1011 SessClose c REM_CLOSE 0.024 **** v1 vsl| 1011 End c **** dT 2.690 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 **** dT 2.694 *** c1 connected fd 16 from 127.0.0.1 37456 to 127.0.0.1:43111 ** c1 === txreq -url /6 **** c1 txreq|GET /6 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** s1 rxhdr|GET /6 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1016\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/6 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1016 **** s1 bodylen = 0 ** s1 === expect req.url == /6 **** s1 EXPECT req.url (/6) == "/6" match ** s1 === txresp -hdr "Foo: bar6" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar6\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 2.710 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar6\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1015\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 196 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar6 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:56 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1015 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar6 **** c1 EXPECT resp.http.foo (bar6) == "bar6" match *** c1 closing fd 16 ** c1 Ending ** top === varnish v1 -cliok "ban obj.http.foo == bar6" **** v1 CLI TX|ban obj.http.foo == bar6 **** dT 2.754 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 2.758 ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 *** c1 connected fd 16 from 127.0.0.1 37458 to 127.0.0.1:43111 ** c1 === txreq -url /7 **** c1 txreq|GET /7 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** s1 rxhdr|GET /7 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1019\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/7 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1019 **** s1 bodylen = 0 ** s1 === expect req.url == /7 **** s1 EXPECT req.url (/7) == "/7" match ** s1 === txresp -hdr "Foo: bar7" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar7\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:56:57 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r **** dT 2.759 ** s1 === rxreq **** dT 2.764 **** v1 vsl| 0 CLI - Rd ban obj.http.foo == bar5 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 1014 Begin c sess 0 HTTP/1 **** v1 vsl| 1014 SessOpen c 127.0.0.1 37456 a0 127.0.0.1 43111 1788811016.944278 20 **** v1 vsl| 1014 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1014 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1014 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1014 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1014 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1014 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1014 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1014 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1015 Begin c req 1014 rxreq **** v1 vsl| 1014 Link c req 1015 rxreq **** v1 vsl| 1015 Timestamp c Start: 1788811016.947771 0.000000 0.000000 **** v1 vsl| 1015 Timestamp c Req: 1788811016.947771 0.000000 0.000000 **** v1 vsl| 1015 VCL_use c vcl1 **** v1 vsl| 1015 ReqStart c 127.0.0.1 37456 a0 **** v1 vsl| 1015 ReqMethod c GET **** v1 vsl| 1015 ReqURL c /6 **** v1 vsl| 1015 ReqProtocol c HTTP/1.1 **** v1 vsl| 1015 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1015 ReqHeader c User-Agent: c1 **** v1 vsl| 1015 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1015 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1015 VCL_call c RECV **** v1 vsl| 1015 VCL_return c hash **** v1 vsl| 1015 VCL_call c HASH **** v1 vsl| 1015 VCL_return c lookup **** v1 vsl| 1015 VCL_call c MISS **** v1 vsl| 1015 VCL_return c fetch **** v1 vsl| 1016 Begin b bereq 1015 fetch **** v1 vsl| 1016 VCL_use b vcl1 **** v1 vsl| 1015 Link c bereq 1016 fetch **** v1 vsl| 1016 Timestamp b Start: 1788811016.947874 0.000000 0.000000 **** v1 vsl| 1016 BereqMethod b GET **** v1 vsl| 1016 BereqURL b /6 **** v1 vsl| 1016 BereqProtocol b HTTP/1.1 **** v1 vsl| 1016 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1016 BereqHeader b User-Agent: c1 **** v1 vsl| 1016 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1016 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1016 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1016 BereqHeader b X-Varnish: 1016 **** v1 vsl| 1016 VCL_call b BACKEND_FETCH **** v1 vsl| 1016 VCL_return b fetch **** v1 vsl| 1016 Timestamp b Fetch: 1788811016.947894 0.000020 0.000020 **** v1 vsl| 1016 Timestamp b Connected: 1788811016.947901 0.000026 0.000006 **** v1 vsl| 1016 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 reuse **** v1 vsl| 1016 Timestamp b Bereq: 1788811016.947958 0.000083 0.000056 **** v1 vsl| 1016 BerespProtocol b HTTP/1.1 **** v1 vsl| 1016 BerespStatus b 200 **** v1 vsl| 1016 BerespReason b OK **** v1 vsl| 1016 BerespHeader b Foo: bar6 **** v1 vsl| 1016 BerespHeader b Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1016 BerespHeader b Server: s1 **** v1 vsl| 1016 BerespHeader b Content-Length: 0 **** v1 vsl| 1016 Timestamp b Beresp: 1788811016.948488 0.000614 0.000530 **** v1 vsl| 1016 TTL b RFC 120 10 0 1788811017 1788811017 1788811016 0 0 cacheable **** v1 vsl| 1016 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1016 VCL_return b deliver **** v1 vsl| 1016 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1016 Timestamp b Process: 1788811016.948544 0.000670 0.000056 **** v1 vsl| 1016 Filters b **** v1 vsl| 1016 Storage b malloc s0 **** v1 vsl| 1016 Fetch_Body b 0 none - **** v1 vsl| 1016 BackendClose b 22 s1 recycle **** v1 vsl| 1016 Timestamp b BerespBody: 1788811016.963642 0.015768 0.015097 **** v1 vsl| 1016 Length b 0 **** v1 vsl| 1016 BereqAcct b 147 0 147 98 0 98 **** v1 vsl| 1016 End b **** v1 vsl| 1015 Timestamp c Fetch: 1788811016.963697 0.015926 0.015926 **** v1 vsl| 1015 RespProtocol c HTTP/1.1 **** v1 vsl| 1015 RespStatus c 200 **** v1 vsl| 1015 RespReason c OK **** v1 vsl| 1015 RespHeader c Foo: bar6 **** v1 vsl| 1015 RespHeader c Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1015 RespHeader c Server: s1 **** v1 vsl| 1015 RespHeader c Content-Length: 0 **** v1 vsl| 1015 RespHeader c X-Varnish: 1015 **** v1 vsl| 1015 RespHeader c Age: 0 **** v1 vsl| 1015 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1015 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1015 VCL_call c DELIVER **** v1 vsl| 1015 VCL_return c deliver **** v1 vsl| 1015 Timestamp c Process: 1788811016.963732 0.015960 0.000034 **** v1 vsl| 1015 Filters c **** v1 vsl| 1015 RespHeader c Connection: keep-alive **** v1 vsl| 1015 Timestamp c Resp: 1788811016.963819 0.016048 0.000087 **** v1 vsl| 1015 ReqAcct c 52 0 52 196 0 196 **** v1 vsl| 1015 End c **** v1 vsl| 1014 SessClose c REM_CLOSE 0.023 **** v1 vsl| 1014 End c **** v1 vsl| 0 CLI - Rd ban obj.http.foo == bar6 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 1017 Begin c sess 0 HTTP/1 **** v1 vsl| 1017 SessOpen c 127.0.0.1 37458 a0 127.0.0.1 43111 1788811017.011911 21 **** v1 vsl| 1017 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1017 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1017 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1017 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1017 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1017 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1017 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1017 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1018 Begin c req 1017 rxreq **** v1 vsl| 1017 Link c req 1018 rxreq **** v1 vsl| 1018 Timestamp c Start: 1788811017.011958 0.000000 0.000000 **** v1 vsl| 1018 Timestamp c Req: 1788811017.011958 0.000000 0.000000 **** v1 vsl| 1018 VCL_use c vcl1 **** v1 vsl| 1018 ReqStart c 127.0.0.1 37458 a0 **** v1 vsl| 1018 ReqMethod c GET **** v1 vsl| 1018 ReqURL c /7 **** v1 vsl| 1018 ReqProtocol c HTTP/1.1 **** v1 vsl| 1018 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1018 ReqHeader c User-Agent: c1 **** v1 vsl| 1018 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1018 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1018 VCL_call c RECV **** v1 vsl| 1018 VCL_return c hash **** v1 vsl| 1018 VCL_call c HASH **** v1 vsl| 1018 VCL_return c lookup **** v1 vsl| 1018 VCL_call c MISS **** v1 vsl| 1018 VCL_return c fetch **** v1 vsl| 1019 Begin b bereq 1018 fetch **** v1 vsl| 1019 VCL_use b vcl1 **** v1 vsl| 1018 Link c bereq 1019 fetch **** v1 vsl| 1019 Timestamp b Start: 1788811017.012047 0.000000 0.000000 **** v1 vsl| 1019 BereqMethod b GET **** v1 vsl| 1019 BereqURL b /7 **** v1 vsl| 1019 BereqProtocol b HTTP/1.1 **** v1 vsl| 1019 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1019 BereqHeader b User-Agent: c1 **** v1 vsl| 1019 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1019 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1019 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1019 BereqHeader b X-Varnish: 1019 **** v1 vsl| 1019 VCL_call b BACKEND_FETCH **** v1 vsl| 1019 VCL_return b fetch **** v1 vsl| 1019 Timestamp b Fetch: 1788811017.012068 0.000020 0.000020 **** v1 vsl| 1019 Timestamp b Connected: 1788811017.012074 0.000026 0.000005 **** v1 vsl| 1019 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 reuse **** v1 vsl| 1019 Timestamp b Bereq: 1788811017.012127 0.000080 0.000053 **** v1 vsl| 1019 BerespProtocol b HTTP/1.1 **** v1 vsl| 1019 BerespStatus b 200 **** v1 vsl| 1019 BerespReason b OK **** v1 vsl| 1019 BerespHeader b Foo: bar7 **** v1 vsl| 1019 BerespHeader b Date: Mon, 07 Sep 2026 19:56:57 GMT **** v1 vsl| 1019 BerespHeader b Server: s1 **** v1 vsl| 1019 BerespHeader b Content-Length: 0 **** v1 vsl| 1019 Timestamp b Beresp: 1788811017.012707 0.000659 0.000579 **** v1 vsl| 1019 TTL b RFC 120 10 0 1788811017 1788811017 1788811017 0 0 cacheable **** v1 vsl| 1019 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1019 VCL_return b deliver **** v1 vsl| 1019 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1019 Timestamp b Process: 1788811017.012750 0.000702 0.000042 **** v1 vsl| 1019 Filters b **** v1 vsl| 1019 Storage b malloc s0 **** v1 vsl| 1019 Fetch_Body b 0 none - **** v1 vsl| 1019 BackendClose b 22 s1 recycle **** dT 2.770 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar7\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:57 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1018\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 196 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar7 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:57 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1018 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar7 **** c1 EXPECT resp.http.foo (bar7) == "bar7" match *** c1 closing fd 16 ** c1 Ending ** top === delay 1 *** top delaying 1 second(s) **** dT 2.864 **** v1 vsl| 1019 Timestamp b BerespBody: 1788811017.022902 0.010854 0.010152 **** v1 vsl| 1019 Length b 0 **** v1 vsl| 1019 BereqAcct b 147 0 147 98 0 98 **** v1 vsl| 1019 End b **** v1 vsl| 1018 Timestamp c Fetch: 1788811017.022958 0.010999 0.010999 **** v1 vsl| 1018 RespProtocol c HTTP/1.1 **** v1 vsl| 1018 RespStatus c 200 **** v1 vsl| 1018 RespReason c OK **** v1 vsl| 1018 RespHeader c Foo: bar7 **** v1 vsl| 1018 RespHeader c Date: Mon, 07 Sep 2026 19:56:57 GMT **** v1 vsl| 1018 RespHeader c Server: s1 **** v1 vsl| 1018 RespHeader c Content-Length: 0 **** v1 vsl| 1018 RespHeader c X-Varnish: 1018 **** v1 vsl| 1018 RespHeader c Age: 0 **** v1 vsl| 1018 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1018 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1018 VCL_call c DELIVER **** v1 vsl| 1018 VCL_return c deliver **** v1 vsl| 1018 Timestamp c Process: 1788811017.022991 0.011032 0.000033 **** v1 vsl| 1018 Filters c **** v1 vsl| 1018 RespHeader c Connection: keep-alive **** v1 vsl| 1018 Timestamp c Resp: 1788811017.023080 0.011121 0.000088 **** v1 vsl| 1018 ReqAcct c 52 0 52 196 0 196 **** v1 vsl| 1018 End c **** v1 vsl| 1017 SessClose c REM_CLOSE 0.012 **** v1 vsl| 1017 End c **** dT 3.770 ** top === varnish v1 -cliok "ban.list" **** v1 CLI TX|ban.list **** dT 3.814 *** v1 CLI RX 200 **** v1 CLI RX|Present bans: **** v1 CLI RX|1788811017.007810 1 --O 0x7fded26235d0 obj.http.foo == bar6 **** v1 CLI RX| oc = 0x7fdec6006180 **** v1 CLI RX|1788811016.943841 1 --O 0x7fded2623580 obj.http.foo == bar5 **** v1 CLI RX| oc = 0x7fdec6806240 **** v1 CLI RX|1788811016.875833 1 -R- 0x7fded2623530 req.http.kill == yes **** v1 CLI RX| oc = 0x7fdec60060c0 **** v1 CLI RX|1788811016.807785 1 --O 0x7fded26234e0 obj.http.foo == bar2 && obj.http.foo != foof **** v1 CLI RX| oc = 0x7fdec6806180 **** v1 CLI RX|1788811016.743823 1 --O 0x7fded2623490 obj.http.foo == bar1 **** v1 CLI RX| oc = 0x7fdec6006000 **** v1 CLI RX|1788811016.340432 2 C-- 0x7fded2622c70 **** v1 CLI RX| oc = 0x7fdec6806000 **** v1 CLI RX| oc = 0x7fdec68060c0 ** v1 CLI 200 ** top === varnish v1 -expect bans == 6 **** dT 3.816 ** v1 as expected: bans (6) == 6 (6) ** top === varnish v1 -expect bans_completed == 1 ** v1 as expected: bans_completed (1) == 1 (1) ** top === varnish v1 -expect bans_req == 1 ** v1 as expected: bans_req (1) == 1 (1) ** top === varnish v1 -expect bans_obj == 4 ** v1 as expected: bans_obj (4) == 4 (4) ** top === varnish v1 -expect bans_added == 6 ** v1 as expected: bans_added (6) == 6 (6) ** top === varnish v1 -expect bans_deleted == 0 ** v1 as expected: bans_deleted (0) == 0 (0) ** top === varnish v1 -expect bans_tested == 0 ** v1 as expected: bans_tested (0) == 0 (0) ** top === varnish v1 -expect bans_tests_tested == 0 ** v1 as expected: bans_tests_tested (0) == 0 (0) ** top === varnish v1 -expect bans_obj_killed == 0 ** v1 as expected: bans_obj_killed (0) == 0 (0) ** top === varnish v1 -expect bans_lurker_tested == 0 ** v1 as expected: bans_lurker_tested (0) == 0 (0) ** top === varnish v1 -expect bans_lurker_tests_tested == 0 ** v1 as expected: bans_lurker_tests_tested (0) == 0 (0) ** top === varnish v1 -expect bans_lurker_obj_killed == 0 ** v1 as expected: bans_lurker_obj_killed (0) == 0 (0) ** top === varnish v1 -expect bans_dups == 0 ** v1 as expected: bans_dups (0) == 0 (0) ** top === varnish v1 -cliok "param.set ban_lurker_sleep .01" **** v1 CLI TX|param.set ban_lurker_sleep .01 **** dT 3.862 *** v1 CLI RX 200 ** v1 CLI 200 ** top === delay 1 *** top delaying 1 second(s) **** dT 3.866 **** v1 vsl| 0 CLI - Rd ban.list **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 0 CLI - Wr 200 568 Present bans: 1788811017.007810 1 --O 0x7fded26235d0 obj.http.foo == bar6 oc = 0x7fdec6006180 1788811016.943841 1 --O 0x7fded2623580 obj.http.foo == bar5 oc = 0x7fdec6806240 1788811016.875833 1 -R- 0x7fded2623530 req.http **** dT 7.719 ** top === varnish v1 -cliok "ban.list" **** v1 CLI TX|ban.list **** dT 7.766 *** v1 CLI RX 200 **** v1 CLI RX|Present bans: **** v1 CLI RX|1788811017.007810 1 --O 0x7fded26235d0 obj.http.foo == bar6 **** v1 CLI RX| oc = 0x7fdec6006180 **** v1 CLI RX|1788811016.943841 1 --O 0x7fded2623580 obj.http.foo == bar5 **** v1 CLI RX| oc = 0x7fdec6806240 **** v1 CLI RX|1788811016.875833 1 -R- 0x7fded2623530 req.http.kill == yes **** v1 CLI RX| oc = 0x7fdec60060c0 **** v1 CLI RX|1788811016.807785 1 --O 0x7fded26234e0 obj.http.foo == bar2 && obj.http.foo != foof **** v1 CLI RX| oc = 0x7fdec6806180 **** v1 CLI RX|1788811016.743823 1 --O 0x7fded2623490 obj.http.foo == bar1 **** v1 CLI RX| oc = 0x7fdec6006000 **** v1 CLI RX|1788811016.340432 2 C-- 0x7fded2622c70 **** v1 CLI RX| oc = 0x7fdec6806000 **** v1 CLI RX| oc = 0x7fdec68060c0 ** v1 CLI 200 ** top === delay 1 *** top delaying 1 second(s) **** dT 7.819 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811021 1.0 **** v1 vsl| 0 CLI - Rd ban.list **** v1 vsl| 0 CLI - Wr 200 568 Present bans: 1788811017.007810 1 --O 0x7fded26235d0 obj.http.foo == bar6 oc = 0x7fdec6006180 1788811016.943841 1 --O 0x7fded2623580 obj.http.foo == bar5 oc = 0x7fdec6806240 1788811016.875833 1 -R- 0x7fded2623530 req.http **** v1 vsl| 0 ExpBan - 1016 banned by lurker **** v1 vsl| 0 ExpBan - 1013 banned by lurker **** v1 vsl| 0 ExpBan - 1002 banned by lurker **** v1 vsl| 0 ExpBan - 1004 banned by lurker **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** dT 8.766 ** top === varnish v1 -cliok "ban.list" **** v1 CLI TX|ban.list **** dT 8.810 *** v1 CLI RX 200 **** v1 CLI RX|Present bans: **** v1 CLI RX|1788811017.007810 1 C-O 0x7fded26235d0 **** v1 CLI RX| oc = 0x7fdec6006180 **** v1 CLI RX|1788811016.943841 0 C-O 0x7fded2623580 **** v1 CLI RX|1788811016.875833 0 -R- 0x7fded2623530 req.http.kill == yes **** v1 CLI RX|1788811016.807785 2 C-O 0x7fded26234e0 **** v1 CLI RX| oc = 0x7fdec6806180 **** v1 CLI RX| oc = 0x7fdec6006000 **** v1 CLI RX|1788811016.743823 0 C-O 0x7fded2623490 **** v1 CLI RX|1788811016.340432 0 C-- 0x7fded2622c70 ** v1 CLI 200 ** top === varnish v1 -expect bans == 4 **** dT 8.820 **** v1 vsl| 0 CLI - Rd ban.list **** v1 vsl| 0 CLI - Wr 200 376 Present bans: 1788811017.007810 1 C-O 0x7fded26235d0 oc = 0x7fdec6006180 1788811016.943841 0 C-O 0x7fded2623580 1788811016.875833 0 -R- 0x7fded2623530 req.http.kill == yes 1788811016.807785 2 C-O 0x7fded26234e0 o **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** dT 8.910 ** v1 as expected: bans (4) == 4 (4) ** top === varnish v1 -expect bans_completed == 3 ** v1 as expected: bans_completed (3) == 3 (3) ** top === varnish v1 -expect bans_req == 1 ** v1 as expected: bans_req (1) == 1 (1) ** top === varnish v1 -expect bans_obj == 3 ** v1 as expected: bans_obj (3) == 3 (3) ** top === varnish v1 -expect bans_added == 6 ** v1 as expected: bans_added (6) == 6 (6) ** top === varnish v1 -expect bans_deleted == 2 ** v1 as expected: bans_deleted (2) == 2 (2) ** top === varnish v1 -expect bans_tested == 0 ** v1 as expected: bans_tested (0) == 0 (0) ** top === varnish v1 -expect bans_tests_tested == 0 ** v1 as expected: bans_tests_tested (0) == 0 (0) ** top === varnish v1 -expect bans_obj_killed == 0 ** v1 as expected: bans_obj_killed (0) == 0 (0) ** top === varnish v1 -expect bans_lurker_tested == 10 ** v1 as expected: bans_lurker_tested (10) == 10 (10) ** top === varnish v1 -expect bans_lurker_tests_tested == 11 ** v1 as expected: bans_lurker_tests_tested (11) == 11 (11) ** top === varnish v1 -expect bans_lurker_obj_killed == 4 ** v1 as expected: bans_lurker_obj_killed (4) == 4 (4) ** top === varnish v1 -expect bans_dups == 0 **** dT 8.911 ** v1 as expected: bans_dups (0) == 0 (0) ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 8.914 ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 *** c1 connected fd 18 from 127.0.0.1 57764 to 127.0.0.1:43111 ** c1 === txreq -url /3 **** c1 txreq|GET /3 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 8.920 **** v1 vsl| 1020 Begin c sess 0 HTTP/1 **** v1 vsl| 1020 SessOpen c 127.0.0.1 57764 a0 127.0.0.1 43111 1788811023.171654 20 **** v1 vsl| 1020 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1020 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1020 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1020 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1020 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1020 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1020 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1020 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1021 Begin c req 1020 rxreq **** v1 vsl| 1020 Link c req 1021 rxreq **** v1 vsl| 1021 Timestamp c Start: 1788811023.171734 0.000000 0.000000 **** v1 vsl| 1021 Timestamp c Req: 1788811023.171734 0.000000 0.000000 **** v1 vsl| 1021 VCL_use c vcl1 **** v1 vsl| 1021 ReqStart c 127.0.0.1 57764 a0 **** v1 vsl| 1021 ReqMethod c GET **** v1 vsl| 1021 ReqURL c /3 **** v1 vsl| 1021 ReqProtocol c HTTP/1.1 **** v1 vsl| 1021 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1021 ReqHeader c User-Agent: c1 **** v1 vsl| 1021 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1021 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1021 VCL_call c RECV **** v1 vsl| 1021 VCL_return c hash **** v1 vsl| 1021 VCL_call c HASH **** v1 vsl| 1021 VCL_return c lookup **** v1 vsl| 1021 Hit c 1007 113.577347 10.000000 0.000000 **** v1 vsl| 1021 VCL_call c HIT **** v1 vsl| 1021 VCL_return c deliver **** v1 vsl| 1021 RespProtocol c HTTP/1.1 **** v1 vsl| 1021 RespStatus c 200 **** v1 vsl| 1021 RespReason c OK **** v1 vsl| 1021 RespHeader c Foo: bar3 **** v1 vsl| 1021 RespHeader c Date: Mon, 07 Sep 2026 19:56:56 GMT **** v1 vsl| 1021 RespHeader c Server: s1 **** v1 vsl| 1021 RespHeader c Content-Length: 0 **** v1 vsl| 1021 RespHeader c X-Varnish: 1021 1007 **** v1 vsl| 1021 RespHeader c Age: 6 **** v1 vsl| 1021 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1021 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1021 VCL_call c DELIVER **** v1 vsl| 1021 VCL_return c deliver **** v1 vsl| 1021 Timestamp c Process: 1788811023.171859 0.000125 0.000125 **** v1 vsl| 1021 Filters c **** v1 vsl| 1021 RespHeader c Connection: keep-alive **** v1 vsl| 1021 Timestamp c Resp: 1788811023.171950 0.000216 0.000091 **** v1 vsl| 1021 ReqAcct c 52 0 52 201 0 201 **** v1 vsl| 1021 End c **** dT 8.922 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar3\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:56 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1021 1007\r **** c1 rxhdr|Age: 6\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 201 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar3 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:56:56 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1021 1007 **** c1 http[ 8] |Age: 6 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar3 **** c1 EXPECT resp.http.foo (bar3) == "bar3" match *** c1 closing fd 18 ** c1 Ending ** top === delay 1 *** top delaying 1 second(s) **** dT 9.020 **** v1 vsl| 1020 SessClose c REM_CLOSE 0.005 **** v1 vsl| 1020 End c **** dT 9.922 ** top === varnish v1 -cliok "ban.list" **** v1 CLI TX|ban.list **** dT 9.966 *** v1 CLI RX 200 **** v1 CLI RX|Present bans: **** v1 CLI RX|1788811017.007810 2 C-O 0x7fded26235d0 **** v1 CLI RX| oc = 0x7fdec6006180 **** v1 CLI RX| oc = 0x7fdec6006000 **** v1 CLI RX|1788811016.943841 0 C-O 0x7fded2623580 **** v1 CLI RX|1788811016.875833 0 -R- 0x7fded2623530 req.http.kill == yes **** v1 CLI RX|1788811016.807785 1 C-O 0x7fded26234e0 **** v1 CLI RX| oc = 0x7fdec6806180 ** v1 CLI 200 ** top === varnish v1 -expect bans == 4 ** v1 as expected: bans (4) == 4 (4) ** top === varnish v1 -expect bans_completed == 3 ** v1 as expected: bans_completed (3) == 3 (3) ** top === varnish v1 -expect bans_req == 1 ** v1 as expected: bans_req (1) == 1 (1) ** top === varnish v1 -expect bans_obj == 3 ** v1 as expected: bans_obj (3) == 3 (3) ** top === varnish v1 -expect bans_added == 6 ** v1 as expected: bans_added (6) == 6 (6) ** top === varnish v1 -expect bans_deleted == 2 ** v1 as expected: bans_deleted (2) == 2 (2) ** top === varnish v1 -expect bans_tested == 1 ** v1 as expected: bans_tested (1) == 1 (1) ** top === varnish v1 -expect bans_tests_tested == 1 ** v1 as expected: bans_tests_tested (1) == 1 (1) ** top === varnish v1 -expect bans_obj_killed == 0 ** v1 as expected: bans_obj_killed (0) == 0 (0) ** top === varnish v1 -expect bans_lurker_tested == 10 ** v1 as expected: bans_lurker_tested (10) == 10 (10) ** top === varnish v1 -expect bans_lurker_tests_tested == 11 ** v1 as expected: bans_lurker_tests_tested (11) == 11 (11) ** top === varnish v1 -expect bans_lurker_obj_killed == 4 ** v1 as expected: bans_lurker_obj_killed (4) == 4 (4) ** top === varnish v1 -expect bans_dups == 0 ** v1 as expected: bans_dups (0) == 0 (0) ** top === client c1 { **** dT 9.967 ** c1 Starting client ** c1 Waiting for client ** c1 Started on 127.0.0.1:43111 (1 iterations) *** c1 Connect to 127.0.0.1:43111 *** c1 connected fd 18 from 127.0.0.1 57774 to 127.0.0.1:43111 ** c1 === txreq -url /4 -hdr "kill: yes" **** c1 txreq|GET /4 HTTP/1.1\r **** c1 txreq|kill: yes\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 9.971 **** s1 rxhdr|GET /4 HTTP/1.1\r **** s1 rxhdr|kill: yes\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1024\r **** s1 rxhdr|\r **** s1 rxhdrlen = 158 **** s1 http[ 0] |GET **** s1 http[ 1] |/4 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |kill: yes **** s1 http[ 4] |Host: 127.0.0.1 **** s1 http[ 5] |User-Agent: c1 **** s1 http[ 6] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 7] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 8] |Accept-Encoding: gzip **** s1 http[ 9] |X-Varnish: 1024 **** s1 bodylen = 0 ** s1 === expect req.url == /4 **** s1 EXPECT req.url (/4) == "/4" match ** s1 === txresp -hdr "Foo: bar4.1" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Foo: bar4.1\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:57:04 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 9.986 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Foo: bar4.1\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:57:04 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1023\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 198 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Foo: bar4.1 **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:57:04 GMT **** c1 http[ 5] |Server: s1 **** c1 http[ 6] |Content-Length: 0 **** c1 http[ 7] |X-Varnish: 1023 **** c1 http[ 8] |Age: 0 **** c1 http[ 9] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[10] |Accept-Ranges: bytes **** c1 http[11] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.http.foo == bar4.1 **** c1 EXPECT resp.http.foo (bar4.1) == "bar4.1" match *** c1 closing fd 18 ** c1 Ending ** top === delay 1 *** top delaying 1 second(s) **** dT 10.022 **** v1 vsl| 0 CLI - Rd ban.list **** v1 vsl| 0 CLI - Wr 200 284 Present bans: 1788811017.007810 2 C-O 0x7fded26235d0 oc = 0x7fdec6006180 oc = 0x7fdec6006000 1788811016.943841 0 C-O 0x7fded2623580 1788811016.875833 0 -R- 0x7fded2623530 req.http.kill == yes 1788811016.807785 1 C-O **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 1022 Begin c sess 0 HTTP/1 **** v1 vsl| 1022 SessOpen c 127.0.0.1 57774 a0 127.0.0.1 43111 1788811024.224034 19 **** v1 vsl| 1022 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1022 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1022 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1022 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1022 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1022 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1022 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1022 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:43111 **** v1 vsl| 1023 Begin c req 1022 rxreq **** v1 vsl| 1022 Link c req 1023 rxreq **** v1 vsl| 1023 Timestamp c Start: 1788811024.224091 0.000000 0.000000 **** v1 vsl| 1023 Timestamp c Req: 1788811024.224091 0.000000 0.000000 **** v1 vsl| 1023 VCL_use c vcl1 **** v1 vsl| 1023 ReqStart c 127.0.0.1 57774 a0 **** v1 vsl| 1023 ReqMethod c GET **** v1 vsl| 1023 ReqURL c /4 **** v1 vsl| 1023 ReqProtocol c HTTP/1.1 **** v1 vsl| 1023 ReqHeader c kill: yes **** v1 vsl| 1023 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1023 ReqHeader c User-Agent: c1 **** v1 vsl| 1023 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1023 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1023 VCL_call c RECV **** v1 vsl| 1023 VCL_return c hash **** v1 vsl| 1023 VCL_call c HASH **** v1 vsl| 1023 VCL_return c lookup **** v1 vsl| 1023 ExpBan c 1010 banned lookup **** v1 vsl| 1023 VCL_call c MISS **** v1 vsl| 1023 VCL_return c fetch **** v1 vsl| 1024 Begin b bereq 1023 fetch **** v1 vsl| 1024 VCL_use b vcl1 **** v1 vsl| 1023 Link c bereq 1024 fetch **** v1 vsl| 1024 Timestamp b Start: 1788811024.224220 0.000000 0.000000 **** v1 vsl| 1024 BereqMethod b GET **** v1 vsl| 1024 BereqURL b /4 **** v1 vsl| 1024 BereqProtocol b HTTP/1.1 **** v1 vsl| 1024 BereqHeader b kill: yes **** v1 vsl| 1024 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1024 BereqHeader b User-Agent: c1 **** v1 vsl| 1024 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1024 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1024 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1024 BereqHeader b X-Varnish: 1024 **** v1 vsl| 1024 VCL_call b BACKEND_FETCH **** v1 vsl| 1024 VCL_return b fetch **** v1 vsl| 1024 Timestamp b Fetch: 1788811024.224242 0.000022 0.000022 **** v1 vsl| 1024 Timestamp b Connected: 1788811024.224249 0.000028 0.000006 **** v1 vsl| 1024 BackendOpen b 22 s1 127.0.0.1 38753 127.0.0.1 47738 reuse **** v1 vsl| 1024 Timestamp b Bereq: 1788811024.224305 0.000084 0.000056 **** v1 vsl| 1024 BerespProtocol b HTTP/1.1 **** v1 vsl| 1024 BerespStatus b 200 **** v1 vsl| 1024 BerespReason b OK **** v1 vsl| 1024 BerespHeader b Foo: bar4.1 **** v1 vsl| 1024 BerespHeader b Date: Mon, 07 Sep 2026 19:57:04 GMT **** v1 vsl| 1024 BerespHeader b Server: s1 **** v1 vsl| 1024 BerespHeader b Content-Length: 0 **** v1 vsl| 1024 Timestamp b Beresp: 1788811024.224920 0.000699 0.000614 **** v1 vsl| 1024 TTL b RFC 120 10 0 1788811024 1788811024 1788811024 0 0 cacheable **** v1 vsl| 1024 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1024 VCL_return b deliver **** v1 vsl| 1024 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1024 Timestamp b Process: 1788811024.224947 0.000726 0.000027 **** v1 vsl| 1024 Filters b **** v1 vsl| 1024 Storage b malloc s0 **** v1 vsl| 1024 Fetch_Body b 0 none - **** v1 vsl| 1024 BackendClose b 22 s1 recycle **** v1 vsl| 1024 Timestamp b BerespBody: 1788811024.235417 0.011197 0.010470 **** v1 vsl| 1024 Length b 0 **** v1 vsl| 1024 BereqAcct b 158 0 158 100 0 100 **** v1 vsl| 1024 End b **** v1 vsl| 1023 Timestamp c Fetch: 1788811024.235475 0.011384 0.011384 **** v1 vsl| 1023 RespProtocol c HTTP/1.1 **** v1 vsl| 1023 RespStatus c 200 **** v1 vsl| 1023 RespReason c OK **** v1 vsl| 1023 RespHeader c Foo: bar4.1 **** v1 vsl| 1023 RespHeader c Date: Mon, 07 Sep 2026 19:57:04 GMT **** v1 vsl| 1023 RespHeader c Server: s1 **** v1 vsl| 1023 RespHeader c Content-Length: 0 **** v1 vsl| 1023 RespHeader c X-Varnish: 1023 **** v1 vsl| 1023 RespHeader c Age: 0 **** v1 vsl| 1023 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1023 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1023 VCL_call c DELIVER **** v1 vsl| 1023 VCL_return c deliver **** v1 vsl| 1023 Timestamp c Process: 1788811024.235508 0.011416 0.000032 **** v1 vsl| 1023 Filters c **** v1 vsl| 1023 RespHeader c Connection: keep-alive **** v1 vsl| 1023 Timestamp c Resp: 1788811024.235579 0.011487 0.000071 **** v1 vsl| 1023 ReqAcct c 63 0 63 198 0 198 **** v1 vsl| 1023 End c **** v1 vsl| 1022 SessClose c REM_CLOSE 0.016 **** v1 vsl| 1022 End c **** dT 10.723 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811024 1.0 **** dT 10.986 ** top === varnish v1 -cliok "ban.list" **** v1 CLI TX|ban.list **** dT 11.030 *** v1 CLI RX 200 **** v1 CLI RX|Present bans: **** v1 CLI RX|1788811017.007810 3 C-O 0x7fded26235d0 **** v1 CLI RX| oc = 0x7fdec6006180 **** v1 CLI RX| oc = 0x7fdec6006000 **** v1 CLI RX| oc = 0x7fdec6806300 **** v1 CLI RX|1788811016.943841 0 C-O 0x7fded2623580 **** v1 CLI RX|1788811016.875833 0 -R- 0x7fded2623530 req.http.kill == yes **** v1 CLI RX|1788811016.807785 0 C-O 0x7fded26234e0 ** v1 CLI 200 ** top === varnish v1 -expect bans == 1 ** v1 as expected: bans (1) == 1 (1) ** top === varnish v1 -expect bans_completed == 1 ** v1 as expected: bans_completed (1) == 1 (1) ** top === varnish v1 -expect bans_req == 0 ** v1 as expected: bans_req (0) == 0 (0) ** top === varnish v1 -expect bans_obj == 1 ** v1 as expected: bans_obj (1) == 1 (1) ** top === varnish v1 -expect bans_added == 6 ** v1 as expected: bans_added (6) == 6 (6) ** top === varnish v1 -expect bans_deleted == 5 ** v1 as expected: bans_deleted (5) == 5 (5) ** top === varnish v1 -expect bans_tested == 2 ** v1 as expected: bans_tested (2) == 2 (2) ** top === varnish v1 -expect bans_tests_tested == 2 ** v1 as expected: bans_tests_tested (2) == 2 (2) ** top === varnish v1 -expect bans_obj_killed == 1 ** v1 as expected: bans_obj_killed (1) == 1 (1) ** top === varnish v1 -expect bans_lurker_tested == 10 ** v1 as expected: bans_lurker_tested (10) == 10 (10) ** top === varnish v1 -expect bans_lurker_tests_tested == 11 ** v1 as expected: bans_lurker_tests_tested (11) == 11 (11) ** top === varnish v1 -expect bans_lurker_obj_killed == 4 ** v1 as expected: bans_lurker_obj_killed (4) == 4 (4) ** top === varnish v1 -expect bans_dups == 0 ** v1 as expected: bans_dups (0) == 0 (0) ** top === varnish v1 -expect n_object == 3 ** v1 as expected: n_object (3) == 3 (3) ** top === varnish v1 -cliok "param.set ban_lurker_age 2" **** v1 CLI TX|param.set ban_lurker_age 2 **** dT 11.078 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set ban_cutoff 4" **** v1 CLI TX|param.set ban_cutoff 4 **** dT 11.122 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "ban.list" **** v1 CLI TX|ban.list **** dT 11.123 **** v1 vsl| 0 CLI - Rd ban.list **** v1 vsl| 0 CLI - Wr 200 284 Present bans: 1788811017.007810 3 C-O 0x7fded26235d0 oc = 0x7fdec6006180 oc = 0x7fdec6006000 oc = 0x7fdec6806300 1788811016.943841 0 C-O 0x7fded2623580 1788811016.875833 0 -R- 0x7fded2623530 req.http.kill == yes 17888 **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** dT 11.170 *** v1 CLI RX 200 **** v1 CLI RX|Present bans: **** v1 CLI RX|1788811017.007810 3 C-O 0x7fded26235d0 **** v1 CLI RX| oc = 0x7fdec6006180 **** v1 CLI RX| oc = 0x7fdec6006000 **** v1 CLI RX| oc = 0x7fdec6806300 ** v1 CLI 200 ** top === varnish v1 -cliok "ban obj.http.nomatch == 1" **** v1 CLI TX|ban obj.http.nomatch == 1 **** dT 11.218 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "ban obj.http.nomatch == 2" **** v1 CLI TX|ban obj.http.nomatch == 2 **** dT 11.223 **** v1 vsl| 0 CLI - Rd ban.list **** v1 vsl| 0 CLI - Wr 200 126 Present bans: 1788811017.007810 3 C-O 0x7fded26235d0 oc = 0x7fdec6006180 oc = 0x7fdec6006000 oc = 0x7fdec6806300 **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 0 CLI - Rd ban obj.http.nomatch == 1 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 1.999970 **** dT 11.266 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "ban obj.http.nomatch == 3" **** v1 CLI TX|ban obj.http.nomatch == 3 **** dT 11.310 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "ban obj.http.nomatch == 4" **** v1 CLI TX|ban obj.http.nomatch == 4 **** dT 11.323 **** v1 vsl| 0 CLI - Rd ban obj.http.nomatch == 2 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 1.952015 **** v1 vsl| 0 CLI - Rd ban obj.http.nomatch == 3 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 1.907996 **** dT 11.358 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "ban obj.http.nomatch == 5" **** v1 CLI TX|ban obj.http.nomatch == 5 **** dT 11.406 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "ban.list" **** v1 CLI TX|ban.list **** dT 11.424 **** v1 vsl| 0 CLI - Rd ban obj.http.nomatch == 4 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 1.859982 **** v1 vsl| 0 CLI - Rd ban obj.http.nomatch == 5 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 Debug - lurker: sleep = 1.811989 **** dT 11.450 *** v1 CLI RX 200 **** v1 CLI RX|Present bans: **** v1 CLI RX|1788811025.659786 0 --O 0x7fded2623760 obj.http.nomatch == 5 **** v1 CLI RX|1788811025.611745 0 --O 0x7fded2623710 obj.http.nomatch == 4 **** v1 CLI RX|1788811025.563776 0 --O 0x7fded26236c0 obj.http.nomatch == 3 **** v1 CLI RX|1788811025.519757 0 --O 0x7fded2623670 obj.http.nomatch == 2 **** v1 CLI RX|1788811025.471801 0 --O 0x7fded2623620 obj.http.nomatch == 1 **** v1 CLI RX|1788811017.007810 3 C-O 0x7fded26235d0 **** v1 CLI RX| oc = 0x7fdec6006180 **** v1 CLI RX| oc = 0x7fdec6006000 **** v1 CLI RX| oc = 0x7fdec6806300 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set ban_lurker_age .1" **** v1 CLI TX|param.set ban_lurker_age .1 **** dT 11.498 *** v1 CLI RX 200 ** v1 CLI 200 ** top === delay 3 *** top delaying 3 second(s) **** dT 11.524 **** v1 vsl| 0 CLI - Rd ban.list **** v1 vsl| 0 CLI - Wr 200 461 Present bans: 1788811025.659786 0 --O 0x7fded2623760 obj.http.nomatch == 5 1788811025.611745 0 --O 0x7fded2623710 obj.http.nomatch == 4 1788811025.563776 0 --O 0x7fded26236c0 obj.http.nomatch == 3 1788811025.519757 0 --O **** v1 vsl| 0 Debug - lurker: sleep = 1.767575 **** dT 15.838 ** top === varnish v1 -clijson "ban.list -j" **** v1 CLI TX|ban.list -j **** dT 15.886 *** v1 CLI RX 200 **** v1 CLI RX|[ 2, ["ban.list", "-j"], 1788811030.140, **** v1 CLI RX| { **** v1 CLI RX| "time": 1788811025.659786, **** v1 CLI RX| "refs": 0, **** v1 CLI RX| "completed": true, **** v1 CLI RX| "spec": "", **** v1 CLI RX| "req_tests": false, **** v1 CLI RX| "obj_tests": true, **** v1 CLI RX| "pointer": "0x7fded2623760", **** v1 CLI RX| "objcores": [ **** v1 CLI RX| **** v1 CLI RX|] **** v1 CLI RX|}, **** v1 CLI RX| { **** v1 CLI RX| "time": 1788811025.611745, **** v1 CLI RX| "refs": 0, **** v1 CLI RX| "completed": true, **** v1 CLI RX| "spec": "", **** v1 CLI RX| "req_tests": false, **** v1 CLI RX| "obj_tests": true, **** v1 CLI RX| "pointer": "0x7fded2623710", **** v1 CLI RX| "objcores": [ **** v1 CLI RX| **** v1 CLI RX|] **** v1 CLI RX|}, **** v1 CLI RX| { **** v1 CLI RX| "time": 1788811025.563776, **** v1 CLI RX| "refs": 0, **** v1 CLI RX| "completed": true, **** v1 CLI RX| "spec": "", **** v1 CLI RX| "req_tests": false, **** v1 CLI RX| "obj_tests": true, **** v1 CLI RX| "pointer": "0x7fded26236c0", **** v1 CLI RX| "objcores": [ **** v1 CLI RX| **** v1 CLI RX|] **** v1 CLI RX|}, **** v1 CLI RX| { **** v1 CLI RX| "time": 1788811025.519757, **** v1 CLI RX| "refs": 0, **** v1 CLI RX| "completed": true, **** v1 CLI RX| "spec": "", **** v1 CLI RX| "req_tests": false, **** v1 CLI RX| "obj_tests": true, **** v1 CLI RX| "pointer": "0x7fded2623670", **** v1 CLI RX| "objcores": [ **** v1 CLI RX| **** v1 CLI RX|] **** v1 CLI RX|}, **** v1 CLI RX| { **** v1 CLI RX| "time": 1788811025.471801, **** v1 CLI RX| "refs": 0, **** v1 CLI RX| "completed": true, **** v1 CLI RX| "spec": "", **** v1 CLI RX| "req_tests": false, **** v1 CLI RX| "obj_tests": true, **** v1 CLI RX| "pointer": "0x7fded2623620", **** v1 CLI RX| "objcores": [ **** v1 CLI RX| **** v1 CLI RX|] **** v1 CLI RX|}, **** v1 CLI RX| { **** v1 CLI RX| "time": 1788811017.007810, **** v1 CLI RX| "refs": 3, **** v1 CLI RX| "completed": true, **** v1 CLI RX| "spec": "", **** v1 CLI RX| "req_tests": false, **** v1 CLI RX| "obj_tests": true, **** v1 CLI RX| "pointer": "0x7fded26235d0", **** v1 CLI RX| "objcores": [ **** v1 CLI RX| 0x7fdec6006180, **** v1 CLI RX| 0x7fdec6006000, **** v1 CLI RX| 0x7fdec6806300 **** v1 CLI RX|] **** v1 CLI RX|} **** v1 CLI RX|] ** v1 CLI 200 **** dT 15.896 ---- v1 FAIL CLI, not good JSON: Expected ',' not found. * top RESETTING after ./tests/c00049.vtc **** dT 15.898 ** s1 Waiting for server (3/-1) ** v1 Wait **** v1 CLI TX|panic.show **** dT 15.922 **** v1 vsl| 0 ExpBan - 1019 killed for lurker cutoff **** v1 vsl| 0 ExpBan - 1007 killed for lurker cutoff **** v1 vsl| 0 ExpBan - 1024 killed for lurker cutoff **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811030 1.0 **** v1 vsl| 0 CLI - Rd ban.list -j **** v1 vsl| 0 Debug - lurker: sleep = 49.620000 **** v1 vsl| 0 CLI - Wr 200 1284 [ 2, ["ban.list", "-j"], 1788811030.140, { "time": 1788811025.659786, "refs": 0, "completed": true, "spec": "", "req_tests": false, "obj_tests": true, "pointer": "0x7fded2623760", "objcores": [ ] }, { **** dT 15.942 *** v1 CLI RX 300 **** v1 CLI RX|Child has not panicked or panic has been cleared *** v1 debug|Info: manager stopping child *** v1 debug|Debug: Stopping Child **** dT 16.026 **** v1 vsl| 0 CLI - EOF on CLI connection, worker stops **** dT 16.143 *** v1 debug|Info: Child (3642720) said Child dies **** dT 16.751 *** v1 debug|Info: Child (3642720) ended *** v1 debug|Debug: Child cleanup complete *** v1 debug|Info: manager dies **** dT 16.915 **** v1 STDOUT EOF ** v1 WAIT4 pid=3640353 status=0x0000 (user 1.212348 sys 2.165555) **** dT 16.916 * top TEST ./tests/c00049.vtc FAILED # top TEST ./tests/c00049.vtc FAILED (16.917) exit=2 FAIL tests/c00049.vtc (exit status: 2) FAIL: tests/c00063 ================== **** dT 0.000 * top TEST ./tests/c00063.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:42819 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3641488.3c12feb6 **** top macro def vtcid=vtc.3641488.3c12feb6 ** top === varnishtest "cache backend synth object" * top VTEST cache backend synth object ** top === varnish v1 -vcl { **** dT 0.014 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3641488.3c12feb6/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 32943' -P /tmp/vtc.3641488.3c12feb6/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3641488.3c12feb6/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 32943' -P /tmp/vtc.3641488.3c12feb6/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 PID: 3641586 **** v1 macro def v1_pid=3641586 **** v1 macro def v1_name=/tmp/vtc.3641488.3c12feb6/v1 **** dT 0.056 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** dT 0.058 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.154 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 4 *** v1 CLI RX 107 **** v1 CLI RX|vnhraokjizdczhavbrleeizjsnhiless **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** dT 0.155 **** v1 CLI TX|auth bb9edb35830213474730632b5fc92dd76364da8265e28609cb4a82fe3c26ed45 **** dT 0.160 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|\tbackend b { .host = "127.0.0.1:42819"; } **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_backend_error { **** v1 CLI TX|\t\tset beresp.ttl = 1s; **** v1 CLI TX|\t\tset beresp.grace = 3s; **** v1 CLI TX|\t\tset beresp.http.foobar = "BLA" + bereq.xid; **** v1 CLI TX|\t\tset beresp.body = beresp.http.foobar; **** v1 CLI TX|\t\treturn (deliver); **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.261 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.364 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.468 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.568 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.672 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.772 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.872 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.972 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.072 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.172 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.272 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.373 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.389 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 1.439 *** v1 debug|Debug: Child (3643405) Started **** dT 1.475 *** v1 debug|Child launched OK **** dT 1.480 *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status *** v1 debug|Info: Child (3643405) said Child starts *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** dT 1.524 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 34573 **** v1 CLI TX|debug.xid 1000 **** dT 1.572 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 1.573 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811015.496474/vgc.so 1auto **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811015.496474/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:34573 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:34573 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:34573 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:34573 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:34573 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:34573 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:34573 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:34573 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 34573 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** dT 1.616 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 34573 ** v1 Listen on 127.0.0.1 34573 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=34573 **** v1 macro def v1_sock=127.0.0.1:34573 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=34573 **** v1 macro def v1_a0_sock=127.0.0.1:34573 ** top === varnish v1 -cliok "param.set connect_timeout 1.0" **** v1 CLI TX|param.set connect_timeout 1.0 **** dT 1.660 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 1.664 ** c1 Started on 127.0.0.1:34573 (1 iterations) *** c1 Connect to 127.0.0.1:34573 *** c1 connected fd 14 from 127.0.0.1 39958 to 127.0.0.1:34573 ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 1.669 **** c1 rxhdr|HTTP/1.1 503 Backend fetch failed\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:56:57 GMT\r **** c1 rxhdr|Server: Varnish\r **** c1 rxhdr|foobar: BLA1002\r **** c1 rxhdr|X-Varnish: 1001\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Content-Length: 7\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 203 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |503 **** c1 http[ 2] |Backend fetch failed **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:56:57 GMT **** c1 http[ 4] |Server: Varnish **** c1 http[ 5] |foobar: BLA1002 **** c1 http[ 6] |X-Varnish: 1001 **** c1 http[ 7] |Age: 0 **** c1 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[ 9] |Content-Length: 7 **** c1 http[10] |Connection: keep-alive **** c1 c-l|BLA1002 **** c1 bodylen = 7 ** c1 === expect resp.http.foobar == "BLA1002" **** c1 EXPECT resp.http.foobar (BLA1002) == "BLA1002" match ** c1 === delay 2 *** c1 delaying 2 second(s) **** dT 1.673 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 34573 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 39958 a0 127.0.0.1 34573 1788811017.003840 19 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:34573 **** v1 vsl| 1000 Link c req 1001 rxreq **** v1 vsl| 1002 Begin b bereq 1001 fetch **** v1 vsl| 1002 VCL_use b vcl1 **** v1 vsl| 1002 Timestamp b Start: 1788811017.004107 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b GET **** v1 vsl| 1002 BereqURL b / **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b User-Agent: c1 **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1002 BereqHeader b X-Varnish: 1002 **** v1 vsl| 1002 VCL_call b BACKEND_FETCH **** v1 vsl| 1002 VCL_return b fetch **** v1 vsl| 1002 Timestamp b Fetch: 1788811017.004155 0.000048 0.000048 **** v1 vsl| 1002 FetchError b backend b: fail errno 111 (Connection refused) **** v1 vsl| 1002 Timestamp b Beresp: 1788811017.004469 0.000361 0.000313 **** v1 vsl| 1002 Timestamp b Error: 1788811017.004471 0.000364 0.000002 **** v1 vsl| 1002 BerespProtocol b HTTP/1.1 **** v1 vsl| 1002 BerespStatus b 503 **** v1 vsl| 1002 BerespReason b Backend fetch failed **** v1 vsl| 1002 BerespHeader b Date: Mon, 07 Sep 2026 19:56:57 GMT **** v1 vsl| 1002 BerespHeader b Server: Varnish **** v1 vsl| 1002 VCL_call b BACKEND_ERROR **** v1 vsl| 1002 TTL b VCL 1 0 0 1788811017 cacheable **** v1 vsl| 1002 TTL b VCL 1 3 0 1788811017 cacheable **** v1 vsl| 1002 BerespHeader b foobar: BLA1002 **** v1 vsl| 1002 VCL_return b deliver **** v1 vsl| 1002 Storage b malloc Transient **** v1 vsl| 1002 Length b 7 **** v1 vsl| 1002 BereqAcct b 0 0 0 0 0 0 **** v1 vsl| 1002 End b **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811017.003913 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811017.003913 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 39958 a0 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c / **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c hash **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 VCL_call c MISS **** v1 vsl| 1001 VCL_return c fetch **** v1 vsl| 1001 Link c bereq 1002 fetch **** v1 vsl| 1001 Timestamp c Fetch: 1788811017.004750 0.000836 0.000836 **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 503 **** v1 vsl| 1001 RespReason c Backend fetch failed **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:56:57 GMT **** v1 vsl| 1001 RespHeader c Server: Varnish **** v1 vsl| 1001 RespHeader c foobar: BLA1002 **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 RespHeader c Age: 0 **** v1 vsl| 1001 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c DELIVER **** v1 vsl| 1001 VCL_return c deliver **** v1 vsl| 1001 Timestamp c Process: 1788811017.004774 0.000861 0.000024 **** v1 vsl| 1001 Filters c **** v1 vsl| 1001 RespHeader c Content-Length: 7 **** v1 vsl| 1001 RespHeader c Connection: keep-alive **** v1 vsl| 1001 Timestamp c Resp: 1788811017.004844 0.000930 0.000069 **** v1 vsl| 1001 ReqAcct c 51 0 51 203 7 210 **** v1 vsl| 1001 End c **** dT 6.622 ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 6.623 **** c1 rxhdr|HTTP/1.1 503 Backend fetch failed\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:57:01 GMT\r **** c1 rxhdr|Server: Varnish\r **** c1 rxhdr|foobar: BLA1004\r **** c1 rxhdr|X-Varnish: 1003\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Content-Length: 7\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 203 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |503 **** c1 http[ 2] |Backend fetch failed **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:57:01 GMT **** c1 http[ 4] |Server: Varnish **** c1 http[ 5] |foobar: BLA1004 **** c1 http[ 6] |X-Varnish: 1003 **** c1 http[ 7] |Age: 0 **** c1 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[ 9] |Content-Length: 7 **** c1 http[10] |Connection: keep-alive **** c1 c-l|BLA1004 **** c1 bodylen = 7 ** c1 === expect resp.http.foobar == "BLA1002" ---- c1 EXPECT resp.http.foobar (BLA1004) == "BLA1002" failed **** dT 6.628 **** v1 vsl| 1000 Link c req 1003 rxreq **** v1 vsl| 1004 Begin b bereq 1003 fetch **** dT 6.643 **** v1 vsl| 1004 VCL_use b vcl1 **** v1 vsl| 1004 Timestamp b Start: 1788811021.958206 0.000000 0.000000 **** v1 vsl| 1004 BereqMethod b GET **** v1 vsl| 1004 BereqURL b / **** v1 vsl| 1004 BereqProtocol b HTTP/1.1 **** v1 vsl| 1004 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1004 BereqHeader b User-Agent: c1 **** v1 vsl| 1004 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1004 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1004 BereqHeader b X-Varnish: 1004 **** v1 vsl| 1004 VCL_call b BACKEND_FETCH **** v1 vsl| 1004 VCL_return b fetch **** v1 vsl| 1004 Timestamp b Fetch: 1788811021.958221 0.000015 0.000015 **** v1 vsl| 1004 FetchError b backend b: fail errno 111 (Connection refused) **** v1 vsl| 1004 Timestamp b Beresp: 1788811021.958310 0.000104 0.000088 **** v1 vsl| 1004 Timestamp b Error: 1788811021.958312 0.000106 0.000001 **** v1 vsl| 1004 BerespProtocol b HTTP/1.1 **** v1 vsl| 1004 BerespStatus b 503 **** v1 vsl| 1004 BerespReason b Backend fetch failed **** v1 vsl| 1004 BerespHeader b Date: Mon, 07 Sep 2026 19:57:01 GMT **** v1 vsl| 1004 BerespHeader b Server: Varnish **** v1 vsl| 1004 VCL_call b BACKEND_ERROR **** v1 vsl| 1004 TTL b VCL 1 0 0 1788811022 cacheable **** v1 vsl| 1004 TTL b VCL 1 3 0 1788811022 cacheable **** v1 vsl| 1004 BerespHeader b foobar: BLA1004 **** v1 vsl| 1004 VCL_return b deliver **** v1 vsl| 1004 Storage b malloc Transient **** v1 vsl| 1004 Length b 7 **** v1 vsl| 1004 BereqAcct b 0 0 0 0 0 0 **** v1 vsl| 1004 End b **** v1 vsl| 1003 Begin c req 1000 rxreq **** v1 vsl| 1003 Timestamp c Start: 1788811021.958111 0.000000 0.000000 **** v1 vsl| 1003 Timestamp c Req: 1788811021.958111 0.000000 0.000000 **** v1 vsl| 1003 VCL_use c vcl1 **** v1 vsl| 1003 ReqStart c 127.0.0.1 39958 a0 **** v1 vsl| 1003 ReqMethod c GET **** v1 vsl| 1003 ReqURL c / **** v1 vsl| 1003 ReqProtocol c HTTP/1.1 **** v1 vsl| 1003 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c User-Agent: c1 **** v1 vsl| 1003 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 VCL_call c RECV **** v1 vsl| 1003 VCL_return c hash **** v1 vsl| 1003 VCL_call c HASH **** v1 vsl| 1003 VCL_return c lookup **** v1 vsl| 1003 VCL_call c MISS **** v1 vsl| 1003 VCL_return c fetch **** v1 vsl| 1003 Link c bereq 1004 fetch **** v1 vsl| 1003 Timestamp c Fetch: 1788811021.958479 0.000367 0.000367 **** v1 vsl| 1003 RespProtocol c HTTP/1.1 **** v1 vsl| 1003 RespStatus c 503 **** v1 vsl| 1003 RespReason c Backend fetch failed **** v1 vsl| 1003 RespHeader c Date: Mon, 07 Sep 2026 19:57:01 GMT **** v1 vsl| 1003 RespHeader c Server: Varnish **** v1 vsl| 1003 RespHeader c foobar: BLA1004 **** v1 vsl| 1003 RespHeader c X-Varnish: 1003 **** v1 vsl| 1003 RespHeader c Age: 0 **** v1 vsl| 1003 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 VCL_call c DELIVER **** v1 vsl| 1003 VCL_return c deliver **** v1 vsl| 1003 Timestamp c Process: 1788811021.958490 0.000379 0.000011 **** v1 vsl| 1003 Filters c **** v1 vsl| 1003 RespHeader c Content-Length: 7 **** v1 vsl| 1003 RespHeader c Connection: keep-alive **** v1 vsl| 1003 Timestamp c Resp: 1788811021.958534 0.000422 0.000043 **** v1 vsl| 1003 ReqAcct c 51 0 51 203 7 210 **** v1 vsl| 1003 End c **** dT 6.636 * top RESETTING after ./tests/c00063.vtc **** dT 6.671 ** v1 Wait **** v1 CLI TX|panic.show **** dT 6.712 *** v1 CLI RX 300 **** v1 CLI RX|Child has not panicked or panic has been cleared *** v1 debug|Info: manager stopping child *** v1 debug|Debug: Stopping Child **** dT 6.743 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811021 1.0 **** v1 vsl| 0 CLI - EOF on CLI connection, worker stops **** dT 6.816 *** v1 debug|Info: Child (3643405) said Child dies *** v1 debug|Info: Child (3643405) ended *** v1 debug|Debug: Child cleanup complete *** v1 debug|Info: manager dies **** dT 7.064 **** v1 STDOUT EOF **** dT 7.066 ** v1 WAIT4 pid=3641586 status=0x0000 (user 0.681445 sys 0.077955) **** dT 7.072 * top TEST ./tests/c00063.vtc FAILED # top TEST ./tests/c00063.vtc FAILED (7.081) exit=2 FAIL tests/c00063.vtc (exit status: 2) SKIP: tests/c00086 ================== **** dT 0.000 * top TEST ./tests/c00086.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:38817 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3643823.66e689ee **** top macro def vtcid=vtc.3643823.66e689ee ** top === varnishtest "-a sub-args user, group and mode; and warn if s... * top VTEST -a sub-args user, group and mode; and warn if stat(EACCES) fails for UDS ** top === feature user_vcache * top SKIPPING test, lacking feature: user_vcache * top RESETTING after ./tests/c00086.vtc * top TEST ./tests/c00086.vtc completed # top TEST ./tests/c00086.vtc skipped (0.077) SKIP tests/c00086.vtc (exit status: 77) SKIP: tests/c00109 ================== **** dT 0.000 * top TEST ./tests/c00109.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:38251 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3646008.06d723ba **** top macro def vtcid=vtc.3646008.06d723ba ** top === varnishtest "cc_command and cc_warnings" * top VTEST cc_command and cc_warnings ** top === feature cmd false **** dT 0.005 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/c00109.vtc * top TEST ./tests/c00109.vtc completed # top TEST ./tests/c00109.vtc skipped (0.065) SKIP tests/c00109.vtc (exit status: 77) SKIP: tests/c00114 ================== **** dT 0.000 * top TEST ./tests/c00114.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:45207 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3646271.364d39be **** top macro def vtcid=vtc.3646271.364d39be ** top === varnishtest "TLV authority over via backends used as SNI for... * top VTEST TLV authority over via backends used as SNI for haproxy backend/1 ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.011 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/c00114.vtc * top TEST ./tests/c00114.vtc completed # top TEST ./tests/c00114.vtc skipped (0.072) SKIP tests/c00114.vtc (exit status: 77) SKIP: tests/h00001 ================== **** dT 0.000 * top TEST ./tests/h00001.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:36049 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655040.28fa07ff **** top macro def vtcid=vtc.3655040.28fa07ff ** top === varnishtest "Basic HAproxy test" * top VTEST Basic HAproxy test ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.007 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/h00001.vtc * top TEST ./tests/h00001.vtc completed # top TEST ./tests/h00001.vtc skipped (0.061) SKIP tests/h00001.vtc (exit status: 77) SKIP: tests/h00002 ================== **** dT 0.000 * top TEST ./tests/h00002.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:42433 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655227.6152540c **** top macro def vtcid=vtc.3655227.6152540c ** top === varnishtest "Basic HAproxy test (daemon mode)" * top VTEST Basic HAproxy test (daemon mode) ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.012 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/h00002.vtc * top TEST ./tests/h00002.vtc completed # top TEST ./tests/h00002.vtc skipped (0.012) SKIP tests/h00002.vtc (exit status: 77) SKIP: tests/h00003 ================== **** dT 0.000 * top TEST ./tests/h00003.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:40379 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655231.18b924e5 **** top macro def vtcid=vtc.3655231.18b924e5 ** top === varnishtest "Test -conf+backend" * top VTEST Test -conf+backend ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.010 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/h00003.vtc * top TEST ./tests/h00003.vtc completed # top TEST ./tests/h00003.vtc skipped (0.018) SKIP tests/h00003.vtc (exit status: 77) SKIP: tests/h00004 ================== **** dT 0.000 * top TEST ./tests/h00004.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:39533 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655265.1e861453 **** top macro def vtcid=vtc.3655265.1e861453 ** top === varnishtest "Test -conf+backend" * top VTEST Test -conf+backend ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.031 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/h00004.vtc * top TEST ./tests/h00004.vtc completed # top TEST ./tests/h00004.vtc skipped (0.067) SKIP tests/h00004.vtc (exit status: 77) SKIP: tests/h00005 ================== **** dT 0.000 * top TEST ./tests/h00005.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:41677 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655317.05c13edc **** top macro def vtcid=vtc.3655317.05c13edc ** top === varnishtest "Exercise varnishtest syslog facility" * top VTEST Exercise varnishtest syslog facility ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.015 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/h00005.vtc * top TEST ./tests/h00005.vtc completed # top TEST ./tests/h00005.vtc skipped (0.095) SKIP tests/h00005.vtc (exit status: 77) SKIP: tests/h00006 ================== **** dT 0.000 * top TEST ./tests/h00006.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:42779 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655424.5a801e71 **** top macro def vtcid=vtc.3655424.5a801e71 ** top === varnishtest "haproxy tcp-mode, uds, send-proxy-v2, client ip... * top VTEST haproxy tcp-mode, uds, send-proxy-v2, client ip and acl ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.018 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/h00006.vtc * top TEST ./tests/h00006.vtc completed # top TEST ./tests/h00006.vtc skipped (0.031) SKIP tests/h00006.vtc (exit status: 77) SKIP: tests/h00007 ================== **** dT 0.000 * top TEST ./tests/h00007.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:41039 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655530.5bbabf14 **** top macro def vtcid=vtc.3655530.5bbabf14 ** top === varnishtest "haproxy tcp-mode, tcp, send-proxy-v2, client ip... * top VTEST haproxy tcp-mode, tcp, send-proxy-v2, client ip and acl ** top === feature ignore_unknown_macro ** top === feature cmd {haproxy --version 2>&1 | grep -q 'HA-*Proxy ver... **** dT 0.019 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/h00007.vtc * top TEST ./tests/h00007.vtc completed # top TEST ./tests/h00007.vtc skipped (0.064) SKIP tests/h00007.vtc (exit status: 77) SKIP: tests/j00000 ================== **** dT 0.000 * top TEST ./tests/j00000.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:37281 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655633.73185e26 **** top macro def vtcid=vtc.3655633.73185e26 ** top === varnishtest "Code coverage basic UNIX jail" * top VTEST Code coverage basic UNIX jail ** top === feature user_varnish * top SKIPPING test, lacking feature: user_varnish * top RESETTING after ./tests/j00000.vtc * top TEST ./tests/j00000.vtc completed # top TEST ./tests/j00000.vtc skipped (0.091) SKIP tests/j00000.vtc (exit status: 77) SKIP: tests/j00001 ================== **** dT 0.000 * top TEST ./tests/j00001.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:39245 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655784.7e4999ea **** top macro def vtcid=vtc.3655784.7e4999ea ** top === varnishtest "Run worker with different uid in UNIX jail" * top VTEST Run worker with different uid in UNIX jail ** top === feature user_varnish **** dT 0.001 * top SKIPPING test, lacking feature: user_varnish * top RESETTING after ./tests/j00001.vtc * top TEST ./tests/j00001.vtc completed # top TEST ./tests/j00001.vtc skipped (2.411) SKIP tests/j00001.vtc (exit status: 77) SKIP: tests/j00003 ================== **** dT 0.000 * top TEST ./tests/j00003.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:42567 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655812.34a6f8ae **** top macro def vtcid=vtc.3655812.34a6f8ae ** top === varnishtest "-junix bad subarg handling" * top VTEST -junix bad subarg handling ** top === feature root * top SKIPPING test, lacking feature: root * top RESETTING after ./tests/j00003.vtc * top TEST ./tests/j00003.vtc completed # top TEST ./tests/j00003.vtc skipped (0.004) SKIP tests/j00003.vtc (exit status: 77) SKIP: tests/j00004 ================== **** dT 0.000 * top TEST ./tests/j00004.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:45757 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3655701.43a162d8 **** top macro def vtcid=vtc.3655701.43a162d8 ** top === varnishtest "Listen at a Unix domain socket while in jail" * top VTEST Listen at a Unix domain socket while in jail ** top === feature user_varnish **** dT 0.001 * top SKIPPING test, lacking feature: user_varnish * top RESETTING after ./tests/j00004.vtc * top TEST ./tests/j00004.vtc completed # top TEST ./tests/j00004.vtc skipped (0.011) SKIP tests/j00004.vtc (exit status: 77) SKIP: tests/p00000 ================== **** dT 0.000 * top TEST ./tests/p00000.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:37277 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3658925.15907ec8 **** top macro def vtcid=vtc.3658925.15907ec8 ** top === varnishtest "Test Basic persistence" * top VTEST Test Basic persistence ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00000.vtc * top TEST ./tests/p00000.vtc completed # top TEST ./tests/p00000.vtc skipped (0.097) SKIP tests/p00000.vtc (exit status: 77) SKIP: tests/p00002 ================== **** dT 0.000 * top TEST ./tests/p00002.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:41937 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3658959.669c5e92 **** top macro def vtcid=vtc.3658959.669c5e92 **** dT 0.004 ** top === varnishtest "Ban a persistent object" * top VTEST Ban a persistent object ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00002.vtc * top TEST ./tests/p00002.vtc completed # top TEST ./tests/p00002.vtc skipped (0.016) SKIP tests/p00002.vtc (exit status: 77) SKIP: tests/p00003 ================== **** dT 0.000 * top TEST ./tests/p00003.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:34889 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3659025.2198c0c9 **** top macro def vtcid=vtc.3659025.2198c0c9 ** top === varnishtest "Ban a persistent object" * top VTEST Ban a persistent object ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00003.vtc * top TEST ./tests/p00003.vtc completed # top TEST ./tests/p00003.vtc skipped (0.004) SKIP tests/p00003.vtc (exit status: 77) SKIP: tests/p00004 ================== **** dT 0.000 * top TEST ./tests/p00004.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:35315 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3659166.6ca19c0e **** top macro def vtcid=vtc.3659166.6ca19c0e ** top === varnishtest "Check object references" * top VTEST Check object references ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00004.vtc * top TEST ./tests/p00004.vtc completed # top TEST ./tests/p00004.vtc skipped (0.022) SKIP tests/p00004.vtc (exit status: 77) SKIP: tests/p00005 ================== **** dT 0.000 * top TEST ./tests/p00005.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:38091 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3659190.39f0e270 **** top macro def vtcid=vtc.3659190.39f0e270 ** top === varnishtest "Check expiry of non-instantiated object" * top VTEST Check expiry of non-instantiated object ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00005.vtc * top TEST ./tests/p00005.vtc completed # top TEST ./tests/p00005.vtc skipped (0.036) SKIP tests/p00005.vtc (exit status: 77) SKIP: tests/p00006 ================== **** dT 0.000 * top TEST ./tests/p00006.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:40587 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3659217.412691cf **** top macro def vtcid=vtc.3659217.412691cf ** top === varnishtest "Check that Vary headers are stored" * top VTEST Check that Vary headers are stored ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00006.vtc * top TEST ./tests/p00006.vtc completed # top TEST ./tests/p00006.vtc skipped (0.085) SKIP tests/p00006.vtc (exit status: 77) SKIP: tests/p00007 ================== **** dT 0.000 * top TEST ./tests/p00007.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:42993 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3659295.52851cb0 **** top macro def vtcid=vtc.3659295.52851cb0 ** top === varnishtest "test reload of object spanning incomplete segme... * top VTEST test reload of object spanning incomplete segment ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00007.vtc * top TEST ./tests/p00007.vtc completed # top TEST ./tests/p00007.vtc skipped (0.004) SKIP tests/p00007.vtc (exit status: 77) SKIP: tests/p00008 ================== **** dT 0.000 * top TEST ./tests/p00008.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:38169 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3659347.63ecba26 **** top macro def vtcid=vtc.3659347.63ecba26 ** top === varnishtest "Ban list sync across silos" * top VTEST Ban list sync across silos ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00008.vtc * top TEST ./tests/p00008.vtc completed # top TEST ./tests/p00008.vtc skipped (0.083) SKIP tests/p00008.vtc (exit status: 77) SKIP: tests/p00009 ================== **** dT 0.000 * top TEST ./tests/p00009.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:34529 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3659436.1faab823 **** top macro def vtcid=vtc.3659436.1faab823 **** dT 0.002 ** top === varnishtest "Check that reloaded bans with completed flag ar... * top VTEST Check that reloaded bans with completed flag are really completed on restart ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/p00009.vtc * top TEST ./tests/p00009.vtc completed # top TEST ./tests/p00009.vtc skipped (0.083) SKIP tests/p00009.vtc (exit status: 77) SKIP: tests/r00915 ================== **** dT 0.000 * top TEST ./tests/r00915.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:35435 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3664907.05af0798 **** top macro def vtcid=vtc.3664907.05af0798 ** top === varnishtest "error object allocation with persistent" * top VTEST error object allocation with persistent ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/r00915.vtc * top TEST ./tests/r00915.vtc completed # top TEST ./tests/r00915.vtc skipped (0.050) SKIP tests/r00915.vtc (exit status: 77) SKIP: tests/r00962 ================== **** dT 0.000 * top TEST ./tests/r00962.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:46471 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3666381.2a9188da **** top macro def vtcid=vtc.3666381.2a9188da ** top === varnishtest "Test address remapping" * top VTEST Test address remapping ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/r00962.vtc * top TEST ./tests/r00962.vtc completed # top TEST ./tests/r00962.vtc skipped (0.053) SKIP tests/r00962.vtc (exit status: 77) SKIP: tests/r01225 ================== **** dT 0.000 * top TEST ./tests/r01225.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:36315 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3669544.3d962b74 **** top macro def vtcid=vtc.3669544.3d962b74 ** top === varnishtest "Test bans_req counter on persistent reload - #1... * top VTEST Test bans_req counter on persistent reload - #1225 ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/r01225.vtc * top TEST ./tests/r01225.vtc completed # top TEST ./tests/r01225.vtc skipped (0.052) SKIP tests/r01225.vtc (exit status: 77) SKIP: tests/r01266 ================== **** dT 0.000 * top TEST ./tests/r01266.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:35911 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3669713.75fdd48e **** top macro def vtcid=vtc.3669713.75fdd48e **** dT 0.001 ** top === varnishtest "#1266 - Check persisted truncated completed ban... * top VTEST #1266 - Check persisted truncated completed bans ** top === feature persistent_storage * top SKIPPING test, lacking feature: persistent_storage * top RESETTING after ./tests/r01266.vtc * top TEST ./tests/r01266.vtc completed # top TEST ./tests/r01266.vtc skipped (0.086) SKIP tests/r01266.vtc (exit status: 77) SKIP: tests/r01762 ================== **** dT 0.000 * top TEST ./tests/r01762.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:35931 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3676288.11bcfd74 **** top macro def vtcid=vtc.3676288.11bcfd74 ** top === varnishtest "test vsl api handling of incomplete vtxes combi... * top VTEST test vsl api handling of incomplete vtxes combined with bad vxids ** top === feature cmd false **** dT 0.003 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/r01762.vtc * top TEST ./tests/r01762.vtc completed # top TEST ./tests/r01762.vtc skipped (0.039) SKIP tests/r01762.vtc (exit status: 77) SKIP: tests/r02275 ================== **** dT 0.000 * top TEST ./tests/r02275.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:37779 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3681763.4da69a85 **** top macro def vtcid=vtc.3681763.4da69a85 **** dT 0.096 ** top === varnishtest "Chunked with no space for iov's on workspace" * top VTEST Chunked with no space for iov's on workspace ** top === feature cmd false **** dT 0.102 * top SKIPPING test, lacking feature: cmd * top RESETTING after ./tests/r02275.vtc * top TEST ./tests/r02275.vtc completed # top TEST ./tests/r02275.vtc skipped (0.106) SKIP tests/r02275.vtc (exit status: 77) FAIL: tests/r02923 ================== **** dT 0.000 * top TEST ./tests/r02923.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:46691 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3687910.4f33786a **** top macro def vtcid=vtc.3687910.4f33786a ** top === varnishtest "race cond in max_concurrent_streams when reques... * top VTEST race cond in max_concurrent_streams when request after receiving RST_STREAM ** top === barrier b1 sock 2 **** dT 0.004 **** b1 macro def b1_addr=127.0.0.1 **** b1 macro def b1_port=39453 **** b1 macro def b1_sock=127.0.0.1:39453 **** dT 0.012 ** top === barrier b2 sock 2 **** b2 macro def b2_addr=127.0.0.1 **** b2 macro def b2_port=40501 **** b2 macro def b2_sock=127.0.0.1:40501 **** dT 0.016 ** top === barrier b3 sock 2 **** dT 0.020 **** b3 macro def b3_addr=127.0.0.1 **** b3 macro def b3_port=45421 **** b3 macro def b3_sock=127.0.0.1:45421 **** dT 0.024 ** top === barrier b4 sock 2 **** b4 macro def b4_addr=127.0.0.1 **** b4 macro def b4_port=36415 **** b4 macro def b4_sock=127.0.0.1:36415 **** dT 0.028 ** top === barrier b5 sock 3 **** b5 macro def b5_addr=127.0.0.1 **** b5 macro def b5_port=41977 **** b5 macro def b5_sock=127.0.0.1:41977 ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=42883 **** s1 macro def s1_sock=127.0.0.1:42883 * s1 Listen on 127.0.0.1:42883 ** top === varnish v1 -cliok "param.set feature +http2" **** dT 0.032 ** s1 Started on 127.0.0.1:42883 (1 iterations) **** dT 0.048 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3687910.4f33786a/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 34487' -P /tmp/vtc.3687910.4f33786a/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3687910.4f33786a/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 34487' -P /tmp/vtc.3687910.4f33786a/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs **** dT 0.049 *** v1 PID: 3688138 **** v1 macro def v1_pid=3688138 **** v1 macro def v1_name=/tmp/vtc.3687910.4f33786a/v1 **** dT 0.077 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.180 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 11 *** v1 CLI RX 107 **** v1 CLI RX|cbdgjoyhjimjwwnksutaqjtpbfblrmlq **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** dT 0.181 **** v1 CLI TX|auth f60c784ec76a887dc7985741f1ac9887e488f9911408332657830d28c1bbae18 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** v1 CLI TX|param.set feature +http2 **** dT 0.224 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set debug +syncvsl" **** v1 CLI TX|param.set debug +syncvsl **** dT 0.268 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set h2_max_concurrent_streams 3" **** v1 CLI TX|param.set h2_max_concurrent_streams 3 **** dT 0.284 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.316 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -vcl+backend { **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX|backend s1 { .host = "127.0.0.1"; .port = "42883"; } **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|\timport vtc; **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_recv { **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_backend_fetch { **** v1 CLI TX|\t\tif(bereq.url ~ "/sync"){ **** v1 CLI TX|\t\t\tvtc.barrier_sync("127.0.0.1:39453"); **** v1 CLI TX|\t\t\tvtc.barrier_sync("127.0.0.1:41977"); **** v1 CLI TX|\t\t} **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.384 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.484 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.584 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.122 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.222 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.322 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.422 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.522 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.623 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.723 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.823 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 3.923 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.023 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.123 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.223 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.324 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.424 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.524 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.624 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.728 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.828 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.928 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.028 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.128 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.229 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.329 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.429 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.529 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.629 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.709 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 5.729 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.768 *** v1 debug|Debug: Child (3690504) Started **** dT 5.801 *** v1 debug|Child launched OK **** dT 5.806 *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status *** v1 debug|Info: Child (3690504) said Child starts *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** dT 5.832 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811079.975874/vgc.so 1auto **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811079.975874/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:38061 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:38061 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:38061 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:38061 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:38061 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:38061 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:38061 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:38061 **** v1 vsl| 0 CLI - Wr 200 0 **** dT 5.848 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 38061 **** v1 CLI TX|debug.xid 1000 **** dT 5.892 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 5.932 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 38061 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** dT 5.936 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 38061 ** v1 Listen on 127.0.0.1 38061 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=38061 **** v1 macro def v1_sock=127.0.0.1:38061 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=38061 **** v1 macro def v1_a0_sock=127.0.0.1:38061 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 5.940 ** c1 Started on 127.0.0.1:38061 (1 iterations) *** c1 Connect to 127.0.0.1:38061 *** c1 connected fd 21 from 127.0.0.1 57198 to 127.0.0.1:38061 ** c1 === txpri **** c1 txpri|PRI * HTTP/2.0\r **** c1 txpri|\r **** c1 txpri|SM\r **** c1 txpri|\r **** dT 5.950 ** c1 === stream 0 rxsettings -run ** c1 Starting stream 0 (0x7f98fc0017c0) **** dT 5.951 ** c1 Waiting for stream 0 **** dT 5.952 ** c1.0 === rxsettings *** c1 rx: stream: 0, type: SETTINGS (4), flags: 0x00, size: 18 **** c1.0 settings->MAX_CONCURRENT_STREAMS (3): 3 **** c1.0 settings->INITIAL_WINDOW_SIZE (4): 1048576 **** c1.0 settings->MAX_HEADER_LIST_SIZE (6): 32768 ** c1.0 Ending stream 0 ** c1 === stream 1 { ** c1 Starting stream 1 (0x7f98fc002f10) ** c1 === stream 3 { ** c1 Starting stream 3 (0x7f98fc004490) ** c1 === stream 5 { ** c1 Starting stream 5 (0x7f98fc005c00) ** c1 === stream 7 { ** c1 Starting stream 7 (0x7f98fc007360) ** c1 === stream 9 { ** c1 Starting stream 9 (0x7f98fc008ad0) ** c1.7 === barrier b3 sync **** c1.7 Barrier(b3) sync with socket ** c1 === stream 11 { ** c1 Starting stream 11 (0x7f98fc00a2e0) **** dT 5.953 ** c1 Waiting for stream 11 **** b3 Barrier(b3) wait 1 of 2 **** dT 5.954 ** c1.5 === barrier b2 sync **** c1.5 Barrier(b2) sync with socket **** b2 Barrier(b2) wait 1 of 2 **** dT 5.956 ** c1.1 === txreq -url /sync ** c1.11 === barrier b5 sync ** c1.9 === barrier b4 sync ** c1.3 === barrier b1 sync **** c1.11 Barrier(b5) sync with socket *** c1.1 tx: stream: 1, type: HEADERS (1), flags: 0x05, size: 40 ** c1.1 === rxresp **** c1.9 Barrier(b4) sync with socket **** b4 Barrier(b4) wait 1 of 2 **** c1.3 Barrier(b1) sync with socket **** b1 Barrier(b1) wait 1 of 2 **** dT 5.958 **** b5 Barrier(b5) wait 1 of 3 **** dT 5.968 **** b1 Barrier(b1) wake 2 **** b1 macro undef b1_addr **** b1 macro undef b1_port **** b1 macro undef b1_sock **** dT 5.969 ** c1.3 === delay .5 *** c1.3 delaying 0.5 second(s) **** b5 Barrier(b5) wait 2 of 3 **** dT 6.032 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 38061 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 57198 a0 127.0.0.1 38061 1788811085.603814 19 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:38061 **** v1 vsl| 1000 Debug c H2 Prior Knowledge Upgrade **** v1 vsl| 1000 Debug c H2: Got pu PRISM **** dT 6.033 **** v1 vsl| 1000 H2RxHdr c [000028010500000001] **** v1 vsl| 1000 H2RxBody c [00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470] **** v1 vsl| 1000 Debug c H2RXF HEADERS[40] 0x05 0x00000001 0x00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470 **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1000 Link c req 1001 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811085.610242 0.000000 0.000000 **** v1 vsl| 1001 ReqProtocol c HTTP/2.0 **** v1 vsl| 1001 Timestamp c Req: 1788811085.619750 0.009508 0.009508 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 57198 a0 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c /sync **** v1 vsl| 1001 ReqProtocol c HTTP/2.0 **** v1 vsl| 1001 ReqHeader c scheme: http **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c hash **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 VCL_call c MISS **** v1 vsl| 1001 VCL_return c fetch **** v1 vsl| 1002 Begin b bereq 1001 fetch **** v1 vsl| 1002 VCL_use b vcl1 **** v1 vsl| 1001 Link c bereq 1002 fetch **** v1 vsl| 1002 Timestamp b Start: 1788811085.627627 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b GET **** v1 vsl| 1002 BereqURL b /sync **** v1 vsl| 1002 BereqProtocol b HTTP/2.0 **** v1 vsl| 1002 BereqHeader b scheme: http **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b X-Varnish: 1002 **** v1 vsl| 1002 VCL_call b BACKEND_FETCH **** v1 vsl| 1002 Debug b barrier_sync("127.0.0.1:39453") **** v1 vsl| 1002 Debug b barrier_sync("127.0.0.1:41977") **** dT 6.469 ** c1.3 === txreq -url /sync *** c1.3 tx: stream: 3, type: HEADERS (1), flags: 0x05, size: 40 ** c1.3 === delay .5 *** c1.3 delaying 0.5 second(s) **** dT 6.533 **** v1 vsl| 1000 H2RxHdr c [000028010500000003] **** v1 vsl| 1000 H2RxBody c [00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470] **** v1 vsl| 1000 Debug c H2RXF HEADERS[40] 0x05 0x00000003 0x00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470 **** v1 vsl| 1003 Begin c req 1000 rxreq **** v1 vsl| 1000 Link c req 1003 rxreq **** v1 vsl| 1003 Timestamp c Start: 1788811086.119660 0.000000 0.000000 **** v1 vsl| 1003 ReqProtocol c HTTP/2.0 **** v1 vsl| 1003 Timestamp c Req: 1788811086.128685 0.009025 0.009025 **** v1 vsl| 1003 VCL_use c vcl1 **** v1 vsl| 1003 ReqStart c 127.0.0.1 57198 a0 **** v1 vsl| 1003 ReqMethod c GET **** v1 vsl| 1003 ReqURL c /sync **** v1 vsl| 1003 ReqProtocol c HTTP/2.0 **** v1 vsl| 1003 ReqHeader c scheme: http **** v1 vsl| 1003 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 VCL_call c RECV **** v1 vsl| 1003 VCL_return c hash **** v1 vsl| 1003 VCL_call c HASH **** v1 vsl| 1003 VCL_return c lookup **** dT 6.969 ** c1.3 === txrst -err 0x8 *** c1.3 tx: stream: 3, type: RST_STREAM (3), flags: 0x00, size: 4 ** c1.3 === delay .5 *** c1.3 delaying 0.5 second(s) **** dT 7.034 **** v1 vsl| 1000 H2RxHdr c [000004030000000003] **** v1 vsl| 1000 H2RxBody c [00000008] **** v1 vsl| 1000 Debug c H2RXF RST_STREAM[4] 0x00 0x00000003 0x00000008 **** v1 vsl| 1000 Debug c KILL st=3 state=5 sched=1 **** dT 7.469 ** c1.3 === barrier b2 sync **** c1.3 Barrier(b2) sync with socket **** b2 Barrier(b2) wake 2 **** b2 macro undef b2_addr **** b2 macro undef b2_port **** b2 macro undef b2_sock ** c1.5 === txreq -url /nosync *** c1.5 tx: stream: 5, type: HEADERS (1), flags: 0x05, size: 42 ** c1.3 Ending stream 3 ** c1.5 === delay .5 *** c1.5 delaying 0.5 second(s) **** dT 7.480 *** s1 accepted fd 9 127.0.0.1 55942 ** s1 === rxreq **** dT 7.481 **** s1 rxhdr|GET /nosync HTTP/1.1\r **** s1 rxhdr|scheme: http\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1005\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|\r **** s1 rxhdrlen = 150 **** s1 http[ 0] |GET **** s1 http[ 1] |/nosync **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |scheme: http **** s1 http[ 4] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 5] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 6] |Accept-Encoding: gzip **** s1 http[ 7] |X-Varnish: 1005 **** s1 http[ 8] |Host: 127.0.0.1 **** s1 bodylen = 0 ** s1 === expect req.url == /nosync **** s1 EXPECT req.url (/nosync) == "/nosync" match ** s1 === txresp **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:07 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 7.493 *** c1 rx: stream: 5, type: HEADERS (1), flags: 0x05, size: 93 *** c1 flag: END_STREAM **** c1 header[ 0]: :status: 200 **** c1 header[ 1]: date: Mon, 07 Sep 2026 19:58:07 GMT **** c1 header[ 2]: server: s1 **** c1 header[ 3]: content-length: 0 **** c1 header[ 4]: x-varnish: 1004 **** c1 header[ 5]: age: 0 **** c1 header[ 6]: via: 1.1 v1 (Varnish/7.7) **** c1 header[ 7]: accept-ranges: bytes **** dT 7.535 **** v1 vsl| 1000 H2RxHdr c [00002a010500000005] **** v1 vsl| 1000 H2RxBody c [00053a70617468072f6e6f73796e6300073a6d6574686f640347455400073a736368656d650468747470] **** v1 vsl| 1000 Debug c H2RXF HEADERS[42] 0x05 0x00000005 0x00053a70617468072f6e6f73796e6300073a6d6574686f640347455400073a736368656d650468747470 **** v1 vsl| 1004 Begin c req 1000 rxreq **** v1 vsl| 1000 Link c req 1004 rxreq **** v1 vsl| 1004 Timestamp c Start: 1788811086.628815 0.000000 0.000000 **** v1 vsl| 1004 ReqProtocol c HTTP/2.0 **** v1 vsl| 1004 Timestamp c Req: 1788811087.129333 0.500518 0.500518 **** v1 vsl| 1004 VCL_use c vcl1 **** v1 vsl| 1004 ReqStart c 127.0.0.1 57198 a0 **** v1 vsl| 1004 ReqMethod c GET **** v1 vsl| 1004 ReqURL c /nosync **** v1 vsl| 1004 ReqProtocol c HTTP/2.0 **** v1 vsl| 1004 ReqHeader c scheme: http **** v1 vsl| 1004 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1004 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 VCL_call c RECV **** v1 vsl| 1004 VCL_return c hash **** v1 vsl| 1004 VCL_call c HASH **** v1 vsl| 1004 VCL_return c lookup **** v1 vsl| 1004 VCL_call c MISS **** v1 vsl| 1004 VCL_return c fetch **** v1 vsl| 1005 Begin b bereq 1004 fetch **** v1 vsl| 1005 VCL_use b vcl1 **** v1 vsl| 1004 Link c bereq 1005 fetch **** v1 vsl| 1005 Timestamp b Start: 1788811087.139705 0.000000 0.000000 **** v1 vsl| 1005 BereqMethod b GET **** v1 vsl| 1005 BereqURL b /nosync **** v1 vsl| 1005 BereqProtocol b HTTP/2.0 **** v1 vsl| 1005 BereqHeader b scheme: http **** v1 vsl| 1005 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1005 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1005 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1005 BereqProtocol b HTTP/1.1 **** v1 vsl| 1005 BereqHeader b X-Varnish: 1005 **** v1 vsl| 1005 VCL_call b BACKEND_FETCH **** v1 vsl| 1005 VCL_return b fetch **** v1 vsl| 1005 Timestamp b Fetch: 1788811087.139994 0.000289 0.000289 **** v1 vsl| 1005 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1005 Timestamp b Connected: 1788811087.140126 0.000421 0.000131 **** v1 vsl| 1005 BackendOpen b 23 s1 127.0.0.1 42883 127.0.0.1 55942 connect **** v1 vsl| 1005 Timestamp b Bereq: 1788811087.140176 0.000471 0.000050 **** v1 vsl| 1005 BerespProtocol b HTTP/1.1 **** v1 vsl| 1005 BerespStatus b 200 **** v1 vsl| 1005 BerespReason b OK **** v1 vsl| 1005 BerespHeader b Date: Mon, 07 Sep 2026 19:58:07 GMT **** v1 vsl| 1005 BerespHeader b Server: s1 **** v1 vsl| 1005 BerespHeader b Content-Length: 0 **** v1 vsl| 1005 Timestamp b Beresp: 1788811087.140739 0.001034 0.000562 **** v1 vsl| 1005 TTL b RFC 120 10 0 1788811087 1788811087 1788811087 0 0 cacheable **** v1 vsl| 1005 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1005 VCL_return b deliver **** v1 vsl| 1005 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1005 Timestamp b Process: 1788811087.140770 0.001065 0.000030 **** v1 vsl| 1005 Filters b **** v1 vsl| 1005 Storage b malloc s0 **** v1 vsl| 1005 Fetch_Body b 0 none - **** v1 vsl| 1005 BackendClose b 23 s1 recycle **** v1 vsl| 1005 Timestamp b BerespBody: 1788811087.150971 0.011266 0.010200 **** v1 vsl| 1005 Length b 0 **** v1 vsl| 1005 BereqAcct b 150 0 150 87 0 87 **** v1 vsl| 1005 End b **** v1 vsl| 1004 Timestamp c Fetch: 1788811087.151103 0.522288 0.021770 **** v1 vsl| 1004 RespProtocol c HTTP/1.1 **** v1 vsl| 1004 RespStatus c 200 **** v1 vsl| 1004 RespReason c OK **** v1 vsl| 1004 RespHeader c Date: Mon, 07 Sep 2026 19:58:07 GMT **** v1 vsl| 1004 RespHeader c Server: s1 **** v1 vsl| 1004 RespHeader c Content-Length: 0 **** v1 vsl| 1004 RespHeader c X-Varnish: 1004 **** v1 vsl| 1004 RespHeader c Age: 0 **** v1 vsl| 1004 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1004 VCL_call c DELIVER **** v1 vsl| 1004 VCL_return c deliver **** v1 vsl| 1004 Timestamp c Process: 1788811087.151152 0.522336 0.000048 **** v1 vsl| 1004 Filters c **** v1 vsl| 1004 RespProtocol c HTTP/2.0 **** v1 vsl| 1004 Debug c HP {33, "date:", ""} **** v1 vsl| 1004 Debug c HP {54, "server:", ""} **** v1 vsl| 1004 Debug c HP {28, "content-length:", ""} **** v1 vsl| 1004 Debug c HP {21, "age:", ""} **** v1 vsl| 1004 Debug c HP {60, "via:", ""} **** v1 vsl| 1004 Debug c HP {18, "accept-ranges:", ""} **** v1 vsl| 1004 Timestamp c Resp: 1788811087.151880 0.523065 0.000728 **** dT 7.970 ** c1.5 === rxresp ** c1.5 === delay .5 *** c1.5 delaying 0.5 second(s) **** dT 8.037 **** v1 vsl| 1004 ReqAcct c 42 0 42 93 0 93 **** v1 vsl| 1004 End c **** dT 8.472 ** c1.5 === expect resp.status == 200 **** c1.5 EXPECT resp.status (200) == "200" match ** c1.5 === barrier b3 sync **** c1.5 Barrier(b3) sync with socket **** b3 Barrier(b3) wake 2 **** b3 macro undef b3_addr **** b3 macro undef b3_port **** b3 macro undef b3_sock ** c1.7 === txreq -url /sync **** dT 8.476 *** c1.7 tx: stream: 7, type: HEADERS (1), flags: 0x05, size: 40 ** c1.7 === delay .5 *** c1.7 delaying 0.5 second(s) ** c1.5 Ending stream 5 **** dT 8.538 **** v1 vsl| 1000 H2RxHdr c [000028010500000007] **** v1 vsl| 1000 H2RxBody c [00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470] **** v1 vsl| 1000 Debug c H2RXF HEADERS[40] 0x05 0x00000007 0x00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470 **** v1 vsl| 1006 Begin c req 1000 rxreq **** v1 vsl| 1000 Link c req 1006 rxreq **** v1 vsl| 1006 Timestamp c Start: 1788811087.630994 0.000000 0.000000 **** v1 vsl| 1006 ReqProtocol c HTTP/2.0 **** v1 vsl| 1006 Timestamp c Req: 1788811088.135709 0.504714 0.504714 **** v1 vsl| 1006 VCL_use c vcl1 **** v1 vsl| 1006 ReqStart c 127.0.0.1 57198 a0 **** v1 vsl| 1006 ReqMethod c GET **** v1 vsl| 1006 ReqURL c /sync **** v1 vsl| 1006 ReqProtocol c HTTP/2.0 **** v1 vsl| 1006 ReqHeader c scheme: http **** v1 vsl| 1006 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1006 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1006 VCL_call c RECV **** v1 vsl| 1006 VCL_return c hash **** v1 vsl| 1006 VCL_call c HASH **** v1 vsl| 1006 VCL_return c lookup **** dT 8.839 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811088 1.0 **** dT 8.976 ** c1.7 === txrst -err 0x8 *** c1.7 tx: stream: 7, type: RST_STREAM (3), flags: 0x00, size: 4 ** c1.7 === delay .5 *** c1.7 delaying 0.5 second(s) **** dT 9.476 ** c1.7 === barrier b4 sync **** c1.7 Barrier(b4) sync with socket **** b4 Barrier(b4) wake 2 **** b4 macro undef b4_addr **** b4 macro undef b4_port **** b4 macro undef b4_sock ** c1.7 Ending stream 7 **** dT 9.477 ** c1.9 === txreq -url /sync *** c1.9 tx: stream: 9, type: HEADERS (1), flags: 0x05, size: 40 ** c1.9 === delay .5 *** c1.9 delaying 0.5 second(s) **** dT 9.546 **** v1 vsl| 1000 H2RxHdr c [000028010500000009] **** v1 vsl| 1000 H2RxBody c [00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470] **** v1 vsl| 1000 Debug c H2RXF HEADERS[40] 0x05 0x00000009 0x00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470 **** v1 vsl| 1007 Begin c req 1000 rxreq **** v1 vsl| 1000 Link c req 1007 rxreq **** v1 vsl| 1007 Timestamp c Start: 1788811089.135646 0.000000 0.000000 **** v1 vsl| 1007 ReqProtocol c HTTP/2.0 **** v1 vsl| 1007 Timestamp c Req: 1788811089.136496 0.000849 0.000849 **** v1 vsl| 1007 VCL_use c vcl1 **** v1 vsl| 1007 ReqStart c 127.0.0.1 57198 a0 **** v1 vsl| 1007 ReqMethod c GET **** v1 vsl| 1007 ReqURL c /sync **** v1 vsl| 1007 ReqProtocol c HTTP/2.0 **** v1 vsl| 1007 ReqHeader c scheme: http **** v1 vsl| 1007 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1007 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1007 VCL_call c RECV **** v1 vsl| 1007 VCL_return c hash **** v1 vsl| 1007 VCL_call c HASH **** v1 vsl| 1007 VCL_return c lookup **** dT 14.475 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811094 1.0 **** dT 14.480 ** c1.9 === barrier b5 sync **** c1.9 Barrier(b5) sync with socket **** b5 Barrier(b5) wake 3 **** b5 macro undef b5_addr **** b5 macro undef b5_port **** b5 macro undef b5_sock ** c1.11 === txreq -url /sync *** c1.11 tx: stream: 11, type: HEADERS (1), flags: 0x05, size: 40 **** dT 14.481 ** c1.11 === delay .5 *** c1.11 delaying 0.5 second(s) **** s1 rxhdr|GET /sync HTTP/1.1\r **** s1 rxhdr|scheme: http\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1002\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|\r **** s1 rxhdrlen = 148 **** s1 http[ 0] |GET **** s1 http[ 1] |/sync **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |scheme: http **** s1 http[ 4] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 5] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 6] |Accept-Encoding: gzip **** s1 http[ 7] |X-Varnish: 1002 **** s1 http[ 8] |Host: 127.0.0.1 **** s1 bodylen = 0 ** s1 === expect req.url == /sync **** s1 EXPECT req.url (/sync) == "/sync" match ** s1 === txresp **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:14 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r *** s1 shutting fd 9 ** s1 Ending *** c1 rx: stream: 11, type: RST_STREAM (3), flags: 0x00, size: 4 ** c1.11 ouch **** c1.11 rst->err: REFUSED_STREAM (7) **** dT 14.484 ** c1.9 === delay .5 *** c1.9 delaying 0.5 second(s) **** dT 14.516 *** c1 rx: stream: 1, type: HEADERS (1), flags: 0x05, size: 93 *** c1 flag: END_STREAM **** c1 header[ 0]: :status: 200 **** c1 header[ 1]: date: Mon, 07 Sep 2026 19:58:14 GMT **** c1 header[ 2]: server: s1 **** c1 header[ 3]: content-length: 0 **** c1 header[ 4]: x-varnish: 1001 **** c1 header[ 5]: age: 0 **** c1 header[ 6]: via: 1.1 v1 (Varnish/7.7) **** c1 header[ 7]: accept-ranges: bytes **** dT 14.520 ** c1.1 === expect resp.status == 200 **** c1.1 EXPECT resp.status (200) == "200" match ** c1.1 Ending stream 1 **** dT 14.575 **** v1 vsl| 1002 VCL_return b fetch **** v1 vsl| 1002 Timestamp b Fetch: 1788811094.140080 8.512452 8.512452 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 Timestamp b Connected: 1788811094.140100 8.512472 0.000020 **** v1 vsl| 1002 BackendOpen b 23 s1 127.0.0.1 42883 127.0.0.1 55942 reuse **** v1 vsl| 1002 Timestamp b Bereq: 1788811094.140168 8.512540 0.000068 **** v1 vsl| 1000 H2RxHdr c [00002801050000000b] **** v1 vsl| 1000 H2RxBody c [00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470] **** v1 vsl| 1000 Debug c H2RXF HEADERS[40] 0x05 0x0000000b 0x00053a70617468052f73796e6300073a6d6574686f640347455400073a736368656d650468747470 **** v1 vsl| 1000 Debug c H2: stream 11: Hit maximum number of concurrent streams **** v1 vsl| 1000 Debug c H2: stream 11: Stream not processed **** v1 vsl| 1002 BerespProtocol b HTTP/1.1 **** v1 vsl| 1002 BerespStatus b 200 **** v1 vsl| 1002 BerespReason b OK **** v1 vsl| 1002 BerespHeader b Date: Mon, 07 Sep 2026 19:58:14 GMT **** v1 vsl| 1002 BerespHeader b Server: s1 **** v1 vsl| 1002 BerespHeader b Content-Length: 0 **** v1 vsl| 1002 Timestamp b Beresp: 1788811094.165651 8.538023 0.025482 **** v1 vsl| 1002 TTL b RFC 120 10 0 1788811094 1788811094 1788811094 0 0 cacheable **** v1 vsl| 1002 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1002 VCL_return b deliver **** v1 vsl| 1002 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1002 Timestamp b Process: 1788811094.165701 8.538073 0.000050 **** v1 vsl| 1002 Filters b **** v1 vsl| 1002 Storage b malloc s0 **** v1 vsl| 1002 Fetch_Body b 0 none - **** v1 vsl| 1002 BackendClose b 23 s1 recycle **** v1 vsl| 1002 Timestamp b BerespBody: 1788811094.175955 8.548327 0.010254 **** v1 vsl| 1002 Length b 0 **** v1 vsl| 1002 BereqAcct b 148 0 148 87 0 87 **** v1 vsl| 1002 End b **** v1 vsl| 1001 Timestamp c Fetch: 1788811094.175967 8.565724 8.556216 **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 200 **** v1 vsl| 1001 RespReason c OK **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:58:14 GMT **** v1 vsl| 1001 RespHeader c Server: s1 **** v1 vsl| 1001 RespHeader c Content-Length: 0 **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 RespHeader c Age: 0 **** v1 vsl| 1001 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1001 VCL_call c DELIVER **** v1 vsl| 1001 VCL_return c deliver **** v1 vsl| 1001 Timestamp c Process: 1788811094.176059 8.565817 0.000092 **** v1 vsl| 1001 Filters c **** v1 vsl| 1001 RespProtocol c HTTP/2.0 **** v1 vsl| 1001 Debug c HP {33, "date:", ""} **** v1 vsl| 1001 Debug c HP {54, "server:", ""} **** v1 vsl| 1001 Debug c HP {28, "content-length:", ""} **** v1 vsl| 1001 Debug c HP {21, "age:", ""} **** v1 vsl| 1001 Debug c HP {60, "via:", ""} **** v1 vsl| 1001 Debug c HP {18, "accept-ranges:", ""} **** v1 vsl| 1001 Timestamp c Resp: 1788811094.176154 8.565912 0.000095 **** v1 vsl| 1006 Hit c 1002 126.029942 10.000000 0.000000 **** v1 vsl| 1006 Timestamp c Waitinglist: 1788811094.176184 6.545189 6.040475 **** v1 vsl| 1006 VCL_call c HIT **** v1 vsl| 1006 VCL_return c deliver **** v1 vsl| 1006 RespProtocol c HTTP/1.1 **** v1 vsl| 1006 RespStatus c 200 **** v1 vsl| 1006 RespReason c OK **** v1 vsl| 1006 RespHeader c Date: Mon, 07 Sep 2026 19:58:14 GMT **** v1 vsl| 1006 RespHeader c Server: s1 **** v1 vsl| 1006 RespHeader c Content-Length: 0 **** v1 vsl| 1006 RespHeader c X-Varnish: 1006 1002 **** v1 vsl| 1006 RespHeader c Age: 0 **** v1 vsl| 1006 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1006 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1006 VCL_call c DELIVER **** v1 vsl| 1006 VCL_return c deliver **** v1 vsl| 1006 Timestamp c Process: 1788811094.176207 6.545212 0.000023 **** v1 vsl| 1006 Filters c **** v1 vsl| 1006 RespProtocol c HTTP/2.0 **** v1 vsl| 1006 Debug c HP {33, "date:", ""} **** v1 vsl| 1006 Debug c HP {54, "server:", ""} **** v1 vsl| 1006 Debug c HP {28, "content-length:", ""} **** v1 vsl| 1006 Debug c HP {21, "age:", ""} **** v1 vsl| 1006 Debug c HP {60, "via:", ""} **** v1 vsl| 1006 Debug c HP {18, "accept-ranges:", ""} **** v1 vsl| 1006 Timestamp c Resp: 1788811094.176275 6.545280 0.000067 **** v1 vsl| 1003 Hit c 1002 128.036966 10.000000 0.000000 **** v1 vsl| 1003 Timestamp c Waitinglist: 1788811094.176302 8.056642 8.047616 **** v1 vsl| 1003 Timestamp c Reset: 1788811094.176304 8.056644 0.000002 **** v1 vsl| 1003 RespProtocol c HTTP/1.1 **** v1 vsl| 1003 RespStatus c 408 **** v1 vsl| 1003 RespReason c Client disconnected **** v1 vsl| 1003 RespHeader c Date: Mon, 07 Sep 2026 19:58:14 GMT **** v1 vsl| 1003 RespHeader c Server: Varnish **** v1 vsl| 1003 RespHeader c X-Varnish: 1003 **** v1 vsl| 1003 Timestamp c Process: 1788811094.176447 8.056787 0.000143 **** v1 vsl| 1003 RespProtocol c HTTP/2.0 **** v1 vsl| 1003 RespStatus c 408 **** v1 vsl| 1003 RespReason c Request Timeout **** v1 vsl| 1000 Debug c H2: stream 3: Stream cancelled **** v1 vsl| 1003 Timestamp c Resp: 1788811094.176481 8.056821 0.000033 **** v1 vsl| 1007 Hit c 1002 125.029155 10.000000 0.000000 **** v1 vsl| 1007 Timestamp c Waitinglist: 1788811094.192604 5.056957 5.056108 **** v1 vsl| 1007 VCL_call c HIT **** v1 vsl| 1007 VCL_return c deliver **** v1 vsl| 1007 RespProtocol c HTTP/1.1 **** v1 vsl| 1007 RespStatus c 200 **** v1 vsl| 1007 RespReason c OK **** v1 vsl| 1007 RespHeader c Date: Mon, 07 Sep 2026 19:58:14 GMT **** v1 vsl| 1007 RespHeader c Server: s1 **** v1 vsl| 1007 RespHeader c Content-Length: 0 **** v1 vsl| 1007 RespHeader c X-Varnish: 1007 1002 **** v1 vsl| 1007 RespHeader c Age: 0 **** v1 vsl| 1007 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1007 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1007 VCL_call c DELIVER **** v1 vsl| 1007 VCL_return c deliver **** v1 vsl| 1007 Timestamp c Process: 1788811094.192643 5.056996 0.000038 **** v1 vsl| 1007 Filters c **** v1 vsl| 1007 RespProtocol c HTTP/2.0 **** v1 vsl| 1007 Debug c HP {33, "date:", ""} **** v1 vsl| 1007 Debug c HP {54, "server:", ""} **** v1 vsl| 1007 Debug c HP {28, "content-length:", ""} **** v1 vsl| 1007 Debug c HP {21, "age:", ""} **** v1 vsl| 1007 Debug c HP {60, "via:", ""} **** v1 vsl| 1007 Debug c HP {18, "accept-ranges:", ""} **** v1 vsl| 1007 Timestamp c Resp: 1788811094.192786 5.057139 0.000142 **** dT 14.984 ** c1.11 === rxresp ---- c1.11 Frame #1 for rxresp was of type RST_STREAM (3) instead of HEADERS (1) **** dT 14.988 ** c1.9 Ending stream 9 ** c1 Waiting for stream 9 ** c1 Waiting for stream 7 ** c1 Waiting for stream 5 ** c1 Waiting for stream 3 ** c1 Waiting for stream 1 **** dT 14.989 *** c1 closing fd 21 ** c1 Ending * top RESETTING after ./tests/r02923.vtc ** s1 Waiting for server (8/-1) ** v1 Wait **** v1 CLI TX|panic.show **** dT 15.032 *** v1 CLI RX 300 **** v1 CLI RX|Child has not panicked or panic has been cleared *** v1 debug|Info: manager stopping child *** v1 debug|Debug: Stopping Child **** dT 15.076 **** v1 vsl| 1001 ReqAcct c 40 0 40 93 0 93 **** v1 vsl| 1001 End c **** v1 vsl| 1003 ReqAcct c 40 0 40 0 0 0 **** v1 vsl| 1003 End c **** v1 vsl| 1006 ReqAcct c 40 0 40 98 0 98 **** v1 vsl| 1006 End c **** v1 vsl| 1007 ReqAcct c 40 0 40 98 0 98 **** v1 vsl| 1007 End c **** v1 vsl| 1000 Debug c H2: HTC eof (Unexpected end of input) frame=complete goaway=0 **** v1 vsl| 1000 Debug c H2: stream 0: write error s=-1/17 errno=32 **** v1 vsl| 1000 Debug c H2 CLEANUP H2CE_PROTOCOL_ERROR **** v1 vsl| 1000 ReqAcct c 63 4 67 72 34 106 **** v1 vsl| 1000 SessClose c RX_JUNK 9.045 **** v1 vsl| 1000 End c **** v1 vsl| 0 CLI - EOF on CLI connection, worker stops **** dT 15.133 *** v1 debug|Info: Child (3690504) said Child dies **** dT 15.441 *** v1 debug|Info: Child (3690504) ended *** v1 debug|Debug: Child cleanup complete *** v1 debug|Info: manager dies **** dT 15.450 **** v1 STDOUT EOF **** dT 15.477 ** v1 WAIT4 pid=3688138 status=0x0000 (user 2.105153 sys 0.114195) * top TEST ./tests/r02923.vtc FAILED # top TEST ./tests/r02923.vtc FAILED (15.480) exit=2 FAIL tests/r02923.vtc (exit status: 2) FAIL: tests/s00004 ================== **** dT 0.000 * top TEST ./tests/s00004.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:32899 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3695640.343639a3 **** top macro def vtcid=vtc.3695640.343639a3 ** top === varnishtest "Timestamps" * top VTEST Timestamps ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=38299 **** s1 macro def s1_sock=127.0.0.1:38299 * s1 Listen on 127.0.0.1:38299 ** top === varnish v1 -vcl+backend { **** dT 0.002 ** s1 Started on 127.0.0.1:38299 (1 iterations) **** dT 0.024 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3695640.343639a3/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 38911' -P /tmp/vtc.3695640.343639a3/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3695640.343639a3/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 38911' -P /tmp/vtc.3695640.343639a3/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs **** dT 0.025 *** v1 PID: 3695735 **** v1 macro def v1_pid=3695735 **** v1 macro def v1_name=/tmp/vtc.3695640.343639a3/v1 **** dT 0.078 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** dT 0.079 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.180 **** v1 CLIPOLL 1 0x1 0x0 0x0 **** dT 0.181 *** v1 CLI connection fd = 6 *** v1 CLI RX 107 **** v1 CLI RX|dcjmmqplaykbylwldzcjfekcjmycxtyy **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** v1 CLI TX|auth ed5bb115289f428b24477f25cb3c2f686ab4022be1a41c47e426656dcfdc98cb **** dT 0.184 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** dT 0.185 **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX|backend s1 { .host = "127.0.0.1"; .port = "38299"; } **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_backend_response { **** v1 CLI TX|\t\tset beresp.do_stream = false; **** v1 CLI TX|\t} **** v1 CLI TX|\tsub vcl_deliver { **** v1 CLI TX|\t\tif (req.url == "/1" && req.restarts == 0) { **** v1 CLI TX|\t\t\treturn (restart); **** v1 CLI TX|\t\t} **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 4.849 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 4.952 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.057 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.161 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.261 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.364 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.468 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.569 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.672 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.773 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.873 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 5.973 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.076 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.180 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.284 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.384 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.484 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.584 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.684 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.784 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.884 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 6.988 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.092 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.196 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.297 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.397 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.497 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.597 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.698 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.798 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.898 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 7.998 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.098 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.198 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.298 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.399 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.499 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.599 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.699 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.799 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 8.800 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 **** dT 8.801 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 8.858 *** v1 debug|Debug: Child (3699907) Started **** dT 8.900 *** v1 debug|Child launched OK **** dT 8.901 *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status **** dT 8.902 *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address *** v1 debug|Info: Child (3699907) said Child starts **** dT 8.945 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 37715 **** v1 CLI TX|debug.xid 1000 **** dT 8.989 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 9.000 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811089.392132/vgc.so 1auto **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811089.392132/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:37715 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:37715 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:37715 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:37715 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:37715 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:37715 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:37715 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:37715 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 37715 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** dT 9.033 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 37715 ** v1 Listen on 127.0.0.1 37715 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=37715 **** v1 macro def v1_sock=127.0.0.1:37715 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=37715 **** v1 macro def v1_a0_sock=127.0.0.1:37715 ** top === logexpect l1 -v v1 -g request { ** l1 === expect 0 1001 Begin req ** l1 === expect * = Timestamp {Start: \S+ 0\.000000 0\.000000} ** l1 === expect * = Timestamp {Req: \S+ 0\.\d+ 0\.\d+} ** l1 === expect * = Timestamp {Fetch: \S+ [0-4]\.\d+ [0-4]\.\d+} ** l1 === expect * = Timestamp {Restart: \S+ 2\.\d+ 0\.\d+} ** l1 === expect * = End ** l1 === expect 0 1002 Begin bereq ** l1 === expect * = Timestamp {Start: \S+ 0\.000000 0\.000000} ** l1 === expect * = Timestamp {Bereq: \S+ 0\.\d+ 0\.\d+} ** l1 === expect * = Timestamp {Beresp: \S+ 1\.\d+ [01]\.\d+} ** l1 === expect * = Timestamp {BerespBody: \S+ 2\.\d+ (1\.\d+|0\.9)} **** dT 9.034 ** l1 === expect * = End ** l1 === expect 0 1003 Begin {req 1001 restart} ** l1 === expect * = Timestamp {Start: \S+ 2\.\d+ 0\.\d+} ** l1 === expect * = Timestamp {Process: \S+ 2\.\d+ 0\.\d+} ** l1 === expect * = Timestamp {Resp: \S+ 2\.\d+ 0\.\d+} ** l1 === expect * = End ** l1 === expect 0 1004 Begin req ** l1 === expect * = Timestamp {Start: \S+ 0\.000000 0\.000000} ** l1 === expect * = Timestamp {Req: \S+ 0\.\d+ 0\.\d+} ** l1 === expect * = Timestamp {ReqBody: \S+ 0\.\d+ 0\.\d+} ** l1 === expect * = Timestamp {Fetch: \S+ 0\.\d+ 0\.\d+} ** l1 === expect * = Timestamp {Resp: \S+ 0\.\d+ 0\.\d+} ** l1 === expect * = End ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** l1 begin| *** l1 test | expect 0 1001 Begin req **** dT 9.037 ** c1 Started on 127.0.0.1:37715 (1 iterations) *** c1 Connect to 127.0.0.1:37715 *** c1 connected fd 21 from 127.0.0.1 40440 to 127.0.0.1:37715 ** c1 === txreq -url "/1" **** c1 txreq|GET /1 HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 9.045 *** s1 accepted fd 4 127.0.0.1 59408 ** s1 === rxreq **** s1 rxhdr|GET /1 HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1002\r **** s1 rxhdr|\r **** s1 rxhdrlen = 147 **** s1 http[ 0] |GET **** s1 http[ 1] |/1 **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1002 **** s1 bodylen = 0 ** s1 === expect req.url == "/1" **** s1 EXPECT req.url (/1) == "/1" match ** s1 === delay 1 *** s1 delaying 1 second(s) **** dT 9.100 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 37715 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 40440 a0 127.0.0.1 37715 1788811098.247932 19 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:37715 **** v1 vsl| 1000 Link c req 1001 rxreq **** dT 10.052 ** s1 === txresp -nolen -hdr "Transfer-Encoding: chunked" **** dT 10.053 **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Transfer-Encoding: chunked\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:19 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|\r ** s1 === delay 1 *** s1 delaying 1 second(s) **** dT 11.053 ** s1 === chunkedlen 1000 **** s1 chunked|3e8\r **** s1 chunked|0123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567\r ** s1 === chunkedlen 0 **** s1 chunked|0\r **** s1 chunked|\r ** s1 === rxreq **** dT 12.305 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811101 1.0 **** dT 12.813 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:19 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|X-Varnish: 1003 1002\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Content-Length: 1000\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 193 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:58:19 GMT **** c1 http[ 4] |Server: s1 **** c1 http[ 5] |X-Varnish: 1003 1002 **** c1 http[ 6] |Age: 0 **** c1 http[ 7] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[ 8] |Accept-Ranges: bytes **** c1 http[ 9] |Content-Length: 1000 **** c1 http[10] |Connection: keep-alive **** c1 c-l|0123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567012345670123456701234567 **** c1 bodylen = 1000 ** c1 === delay 1 *** c1 delaying 1 second(s) **** dT 12.817 **** l1 match| 1001 Begin c req 1000 rxreq *** l1 test | expect * = Timestamp Start: \\S+ 0\\.000000 0\\.000000 **** l1 match| 1001 Timestamp c Start: 1788811098.248007 0.000000 0.000000 *** l1 test | expect * = Timestamp Req: \\S+ 0\\.\\d+ 0\\.\\d+ **** l1 match| 1001 Timestamp c Req: 1788811098.248007 0.000000 0.000000 *** l1 test | expect * = Timestamp Fetch: \\S+ [0-4]\\.\\d+ [0-4]\\.\\d+ **** l1 match| 1001 Timestamp c Fetch: 1788811102.019916 3.771908 3.771908 *** l1 test | expect * = Timestamp Restart: \\S+ 2\\.\\d+ 0\\.\\d+ **** l1 end | 1001 End c ---- l1 bad | expectation failed **** dT 12.820 **** v1 vsl| 1002 Begin b bereq 1001 fetch **** v1 vsl| 1002 VCL_use b vcl1 **** v1 vsl| 1002 Timestamp b Start: 1788811098.251629 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b GET **** v1 vsl| 1002 BereqURL b /1 **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b User-Agent: c1 **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1002 BereqHeader b X-Varnish: 1002 **** v1 vsl| 1002 VCL_call b BACKEND_FETCH **** v1 vsl| 1002 VCL_return b fetch **** v1 vsl| 1002 Timestamp b Fetch: 1788811098.251720 0.000091 0.000091 **** v1 vsl| 1002 Timestamp b Connected: 1788811098.252009 0.000379 0.000288 **** v1 vsl| 1002 BackendOpen b 22 s1 127.0.0.1 38299 127.0.0.1 59408 connect **** v1 vsl| 1002 Timestamp b Bereq: 1788811098.252069 0.000439 0.000060 **** v1 vsl| 1002 BerespProtocol b HTTP/1.1 **** v1 vsl| 1002 BerespStatus b 200 **** v1 vsl| 1002 BerespReason b OK **** v1 vsl| 1002 BerespHeader b Transfer-Encoding: chunked **** v1 vsl| 1002 BerespHeader b Date: Mon, 07 Sep 2026 19:58:19 GMT **** v1 vsl| 1002 BerespHeader b Server: s1 **** v1 vsl| 1002 Timestamp b Beresp: 1788811102.007669 3.756039 3.755599 **** v1 vsl| 1002 TTL b RFC 120 10 0 1788811102 1788811102 1788811099 0 0 cacheable **** v1 vsl| 1002 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1002 VCL_return b deliver **** v1 vsl| 1002 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1002 Timestamp b Process: 1788811102.007790 3.756160 0.000121 **** v1 vsl| 1002 Filters b **** v1 vsl| 1002 Storage b malloc s0 **** v1 vsl| 1002 Fetch_Body b 2 chunked - **** v1 vsl| 1002 BackendClose b 22 s1 recycle **** v1 vsl| 1002 Timestamp b BerespBody: 1788811102.019661 3.768031 0.011871 **** v1 vsl| 1002 Length b 1000 **** v1 vsl| 1002 BereqAcct b 147 0 147 96 1000 1096 **** v1 vsl| 1002 End b **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811098.248007 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811098.248007 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 40440 a0 **** dT 12.821 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c /1 **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c hash **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 VCL_call c MISS **** v1 vsl| 1001 VCL_return c fetch **** v1 vsl| 1001 Link c bereq 1002 fetch **** v1 vsl| 1001 Timestamp c Fetch: 1788811102.019916 3.771908 3.771908 **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 200 **** v1 vsl| 1001 RespReason c OK **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:58:19 GMT **** v1 vsl| 1001 RespHeader c Server: s1 **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 RespHeader c Age: 0 **** v1 vsl| 1001 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1001 VCL_call c DELIVER **** v1 vsl| 1001 VCL_return c restart **** v1 vsl| 1001 Timestamp c Restart: 1788811102.019970 3.771962 0.000053 **** v1 vsl| 1001 Link c req 1003 restart **** v1 vsl| 1001 End c **** v1 vsl| 1003 Begin c req 1001 restart **** v1 vsl| 1003 Timestamp c Start: 1788811102.019970 3.771962 0.000000 **** v1 vsl| 1003 ReqStart c 127.0.0.1 40440 a0 **** v1 vsl| 1003 ReqMethod c GET **** v1 vsl| 1003 ReqURL c /1 **** v1 vsl| 1003 ReqProtocol c HTTP/1.1 **** v1 vsl| 1003 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c User-Agent: c1 **** v1 vsl| 1003 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 VCL_call c RECV **** v1 vsl| 1003 VCL_return c hash **** v1 vsl| 1003 VCL_call c HASH **** v1 vsl| 1003 VCL_return c lookup **** v1 vsl| 1003 Hit c 1002 123.759661 10.000000 0.000000 **** v1 vsl| 1003 VCL_call c HIT **** v1 vsl| 1003 VCL_return c deliver **** v1 vsl| 1003 RespProtocol c HTTP/1.1 **** v1 vsl| 1003 RespStatus c 200 **** v1 vsl| 1003 RespReason c OK **** v1 vsl| 1003 RespHeader c Date: Mon, 07 Sep 2026 19:58:19 GMT **** v1 vsl| 1003 RespHeader c Server: s1 **** v1 vsl| 1003 RespHeader c X-Varnish: 1003 1002 **** v1 vsl| 1003 RespHeader c Age: 0 **** v1 vsl| 1003 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1003 VCL_call c DELIVER **** v1 vsl| 1003 VCL_return c deliver **** v1 vsl| 1003 Timestamp c Process: 1788811102.020049 3.772041 0.000078 **** v1 vsl| 1003 Filters c **** v1 vsl| 1003 RespHeader c Content-Length: 1000 **** v1 vsl| 1003 RespHeader c Connection: keep-alive **** v1 vsl| 1003 Timestamp c Resp: 1788811102.020152 3.772144 0.000102 **** v1 vsl| 1003 ReqAcct c 52 0 52 193 1000 1193 **** v1 vsl| 1003 End c **** dT 13.820 *** c1 closing fd 21 **** dT 13.821 ** c1 Ending * top RESETTING after ./tests/s00004.vtc ** l1 Waiting for logexp ** s1 Waiting for server (3/-1) ** v1 Wait **** v1 CLI TX|panic.show **** dT 13.841 **** v1 vsl| 1000 SessClose c REM_CLOSE 4.784 **** v1 vsl| 1000 End c **** dT 13.869 *** v1 CLI RX 300 **** v1 CLI RX|Child has not panicked or panic has been cleared *** v1 debug|Info: manager stopping child *** v1 debug|Debug: Stopping Child **** dT 13.941 **** v1 vsl| 0 CLI - EOF on CLI connection, worker stops **** dT 13.974 *** v1 debug|Info: Child (3699907) said Child dies *** v1 debug|Info: Child (3699907) ended *** v1 debug|Debug: Child cleanup complete *** v1 debug|Info: manager dies **** dT 13.980 **** v1 STDOUT EOF **** dT 14.042 ** v1 WAIT4 pid=3695735 status=0x0000 (user 0.727321 sys 0.086562) * top TEST ./tests/s00004.vtc FAILED # top TEST ./tests/s00004.vtc FAILED (14.044) exit=2 FAIL tests/s00004.vtc (exit status: 2) FAIL: tests/s00009 ================== **** dT 0.000 * top TEST ./tests/s00009.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:33403 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3696008.6830bac4 **** top macro def vtcid=vtc.3696008.6830bac4 ** top === varnishtest "Correct obj.ttl is when backend and processing ... * top VTEST Correct obj.ttl is when backend and processing are slow ** top === barrier b1 sock 2 **** dT 0.001 **** b1 macro def b1_addr=127.0.0.1 **** b1 macro def b1_port=36021 **** b1 macro def b1_sock=127.0.0.1:36021 ** top === barrier b2 sock 2 **** dT 0.004 **** b2 macro def b2_addr=127.0.0.1 **** b2 macro def b2_port=45181 **** b2 macro def b2_sock=127.0.0.1:45181 **** dT 0.005 ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=44195 **** s1 macro def s1_sock=127.0.0.1:44195 * s1 Listen on 127.0.0.1:44195 ** top === varnish v1 -vcl+backend { **** dT 0.008 ** s1 Started on 127.0.0.1:44195 (1 iterations) **** dT 0.079 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3696008.6830bac4/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 35453' -P /tmp/vtc.3696008.6830bac4/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3696008.6830bac4/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 35453' -P /tmp/vtc.3696008.6830bac4/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 PID: 3696165 **** v1 macro def v1_pid=3696165 **** v1 macro def v1_name=/tmp/vtc.3696008.6830bac4/v1 **** dT 0.116 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.212 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 8 *** v1 CLI RX 107 **** v1 CLI RX|pzmmgsiitlilggtwygmfwprydesavahy **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** dT 0.213 **** v1 CLI TX|auth 3416ec5f6f9e2fe5d9f1b6cf17b07a1d69b377a1e1eccabe5019bb7e9859020f **** dT 0.220 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX|backend s1 { .host = "127.0.0.1"; .port = "44195"; } **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|\timport vtc; **** v1 CLI TX|\tsub vcl_backend_response { **** v1 CLI TX|\t\t# Simulate processing for 1.5 sec **** v1 CLI TX|\t\tvtc.barrier_sync("127.0.0.1:36021"); **** v1 CLI TX|\t\tvtc.barrier_sync("127.0.0.1:45181"); **** v1 CLI TX| **** v1 CLI TX|\t\t# Moving this above the processing should not change **** v1 CLI TX|\t\t# anything. **** v1 CLI TX| **** v1 CLI TX|\t\tset beresp.ttl = 10s; **** v1 CLI TX|\t} **** v1 CLI TX|\tsub vcl_deliver { **** v1 CLI TX|\t\tset resp.http.X-ttl = obj.ttl; **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.322 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.422 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.524 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.624 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.727 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.827 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.927 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.032 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.132 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.232 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.332 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.436 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.536 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.636 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.736 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.840 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.925 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 1.940 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.985 *** v1 debug|Debug: Child (3697911) Started **** dT 2.032 *** v1 debug|Child launched OK **** dT 2.034 *** v1 debug|Info: Child (3697911) said Child starts **** dT 2.036 *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status **** dT 2.037 *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** dT 2.040 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811094.472490/vgc.so 1auto **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811094.472490/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:40993 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:40993 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:40993 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:40993 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:40993 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:40993 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:40993 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:40993 **** v1 vsl| 0 CLI - Wr 200 0 **** dT 2.084 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 40993 **** v1 CLI TX|debug.xid 1000 **** dT 2.129 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 2.140 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 40993 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** dT 2.180 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 40993 ** v1 Listen on 127.0.0.1 40993 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=40993 **** v1 macro def v1_sock=127.0.0.1:40993 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=40993 **** v1 macro def v1_a0_sock=127.0.0.1:40993 ** top === client c1 { ** c1 Starting client ** top === barrier b1 sync **** top Barrier(b1) sync with socket ** c1 Started on 127.0.0.1:40993 (1 iterations) *** c1 Connect to 127.0.0.1:40993 *** c1 connected fd 19 from 127.0.0.1 43404 to 127.0.0.1:40993 ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 2.184 **** b1 Barrier(b1) wait 1 of 2 **** dT 2.188 *** s1 accepted fd 6 127.0.0.1 34206 ** s1 === rxreq **** s1 rxhdr|GET / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1002\r **** s1 rxhdr|\r **** s1 rxhdrlen = 146 **** s1 http[ 0] |GET **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1002 **** s1 bodylen = 0 ** s1 === delay 2 *** s1 delaying 2 second(s) **** dT 2.248 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 40993 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 43404 a0 127.0.0.1 40993 1788811096.432583 19 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:40993 **** v1 vsl| 1000 Link c req 1001 rxreq **** dT 4.188 ** s1 === txresp -body "foo" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:18 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 3\r **** s1 txresp|\r **** s1 txresp|foo **** dT 4.189 ** s1 === rxreq **** dT 4.196 **** b1 Barrier(b1) wake 2 **** b1 macro undef b1_addr **** b1 macro undef b1_port **** b1 macro undef b1_sock ** top === delay 1.5 *** top delaying 1.5 second(s) **** dT 4.197 **** b2 Barrier(b2) wait 1 of 2 **** dT 6.945 ** top === barrier b2 sync **** top Barrier(b2) sync with socket **** dT 6.964 **** b2 Barrier(b2) wake 2 **** b2 macro undef b2_addr **** b2 macro undef b2_port **** b2 macro undef b2_sock **** dT 6.965 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:18 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 3\r **** c1 rxhdr|X-Varnish: 1001\r **** c1 rxhdr|Age: 2\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|X-ttl: 7.231\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 199 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:58:18 GMT **** c1 http[ 4] |Server: s1 **** c1 http[ 5] |Content-Length: 3 **** c1 http[ 6] |X-Varnish: 1001 **** c1 http[ 7] |Age: 2 **** c1 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[ 9] |Accept-Ranges: bytes **** c1 http[10] |X-ttl: 7.231 **** c1 http[11] |Connection: keep-alive **** c1 c-l|foo **** c1 bodylen = 3 ** c1 === expect resp.status == 200 **** c1 EXPECT resp.status (200) == "200" match ** c1 === expect resp.body == "foo" **** c1 EXPECT resp.body (foo) == "foo" match ** c1 === expect resp.http.X-ttl <= 9 **** c1 EXPECT resp.http.X-ttl (7.231) <= "9" match ** c1 === expect resp.http.X-ttl >= 8 ---- c1 EXPECT resp.http.X-ttl (7.231) >= "8" failed **** dT 6.988 * top RESETTING after ./tests/s00009.vtc ** c1 Waiting for client ** s1 Waiting for server (5/-1) ** v1 Wait **** v1 CLI TX|panic.show **** dT 7.076 *** v1 CLI RX 300 **** v1 CLI RX|Child has not panicked or panic has been cleared **** dT 7.108 *** v1 debug|Info: manager stopping child *** v1 debug|Debug: Stopping Child **** dT 7.122 **** v1 vsl| 1002 Begin b bereq 1001 fetch **** v1 vsl| 1002 VCL_use b vcl1 **** v1 vsl| 1002 Timestamp b Start: 1788811096.435626 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b GET **** v1 vsl| 1002 BereqURL b / **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b User-Agent: c1 **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1002 BereqHeader b X-Varnish: 1002 **** v1 vsl| 1002 VCL_call b BACKEND_FETCH **** v1 vsl| 1002 VCL_return b fetch **** v1 vsl| 1002 Timestamp b Fetch: 1788811096.435687 0.000061 0.000061 **** v1 vsl| 1002 Timestamp b Connected: 1788811096.435986 0.000360 0.000298 **** v1 vsl| 1002 BackendOpen b 22 s1 127.0.0.1 44195 127.0.0.1 34206 connect **** v1 vsl| 1002 Timestamp b Bereq: 1788811096.436042 0.000416 0.000056 **** v1 vsl| 1002 BerespProtocol b HTTP/1.1 **** v1 vsl| 1002 BerespStatus b 200 **** v1 vsl| 1002 BerespReason b OK **** v1 vsl| 1002 BerespHeader b Date: Mon, 07 Sep 2026 19:58:18 GMT **** v1 vsl| 1002 BerespHeader b Server: s1 **** v1 vsl| 1002 BerespHeader b Content-Length: 3 **** v1 vsl| 1002 Timestamp b Beresp: 1788811098.447655 2.012029 2.011613 **** v1 vsl| 1002 TTL b RFC 120 10 0 1788811098 1788811098 1788811098 0 0 cacheable **** v1 vsl| 1002 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1002 Debug b barrier_sync("127.0.0.1:36021") **** v1 vsl| 1002 Debug b barrier_sync("127.0.0.1:45181") **** v1 vsl| 1002 TTL b VCL 10 10 0 1788811098 cacheable **** v1 vsl| 1002 VCL_return b deliver **** v1 vsl| 1002 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1002 Timestamp b Process: 1788811101.216324 4.780698 2.768668 **** v1 vsl| 1002 Filters b **** v1 vsl| 1002 Storage b malloc s0 **** v1 vsl| 1002 Fetch_Body b 3 length stream **** v1 vsl| 1002 BackendClose b 22 s1 recycle **** v1 vsl| 1002 Timestamp b BerespBody: 1788811101.226562 4.790936 0.010238 **** v1 vsl| 1002 Length b 3 **** v1 vsl| 1002 BereqAcct b 146 0 146 87 3 90 **** v1 vsl| 1002 End b **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811096.432658 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811096.432658 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 43404 a0 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c / **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c hash **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 VCL_call c MISS **** v1 vsl| 1001 VCL_return c fetch **** v1 vsl| 1001 Link c bereq 1002 fetch **** v1 vsl| 1001 Timestamp c Fetch: 1788811101.216407 4.783749 4.783749 **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 200 **** v1 vsl| 1001 RespReason c OK **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:58:18 GMT **** v1 vsl| 1001 RespHeader c Server: s1 **** v1 vsl| 1001 RespHeader c Content-Length: 3 **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 RespHeader c Age: 2 **** v1 vsl| 1001 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1001 VCL_call c DELIVER **** v1 vsl| 1001 RespHeader c X-ttl: 7.231 **** v1 vsl| 1001 VCL_return c deliver **** v1 vsl| 1001 Timestamp c Process: 1788811101.216443 4.783784 0.000035 **** v1 vsl| 1001 Filters c **** v1 vsl| 1001 RespHeader c Connection: keep-alive **** v1 vsl| 1001 Timestamp c Resp: 1788811101.226674 4.794015 0.010231 **** v1 vsl| 1001 ReqAcct c 51 0 51 199 3 202 **** v1 vsl| 1001 End c **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811101 1.0 **** v1 vsl| 0 CLI - EOF on CLI connection, worker stops **** dT 7.176 *** v1 debug|Info: Child (3697911) said Child dies **** dT 7.785 *** v1 debug|Info: Child (3697911) ended *** v1 debug|Debug: Child cleanup complete *** v1 debug|Info: manager dies **** dT 7.788 **** v1 STDOUT EOF **** dT 7.852 ** v1 WAIT4 pid=3696165 status=0x0000 (user 0.698914 sys 0.110872) * top TEST ./tests/s00009.vtc FAILED # top TEST ./tests/s00009.vtc FAILED (7.863) exit=2 FAIL tests/s00009.vtc (exit status: 2) FAIL: tests/s00012 ================== **** dT 0.000 * top TEST ./tests/s00012.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:42967 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3696048.5a309b40 **** top macro def vtcid=vtc.3696048.5a309b40 ** top === varnishtest "client h1 send timeouts - uds" * top VTEST client h1 send timeouts - uds ** top === feature cmd {test $(uname) != "SunOS"} **** dT 0.010 ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=36027 **** s1 macro def s1_sock=127.0.0.1:36027 * s1 Listen on 127.0.0.1:36027 ** top === varnish v1 \ ** s1 Started on 127.0.0.1:36027 (1 iterations) **** dT 0.023 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3696048.5a309b40/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -M '127.0.0.1 41053' -P /tmp/vtc.3696048.5a309b40/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs -p timeout_idle=1 -p idle_send_timeout=.1 -p send_timeout=.1 -a /tmp/vtc.3696048.5a309b40/v1.sock *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3696048.5a309b40/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -M '127.0.0.1 41053' -P /tmp/vtc.3696048.5a309b40/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs -p timeout_idle=1 -p idle_send_timeout=.1 -p send_timeout=.1 -a /tmp/vtc.3696048.5a309b40/v1.sock **** dT 0.024 *** v1 PID: 3696232 **** v1 macro def v1_pid=3696232 **** v1 macro def v1_name=/tmp/vtc.3696048.5a309b40/v1 **** dT 0.058 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.157 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 6 *** v1 CLI RX 107 **** v1 CLI RX|bxnalvknvkmmrjkbhanrvlxtevphiftu **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** v1 CLI TX|auth b79d2b3e3f3cd932a78aa67bd53a2294662d5453bf26ba31fa3b60cad5afdc17 **** dT 0.158 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** dT 0.159 **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX|backend s1 { .host = "127.0.0.1"; .port = "36027"; } **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|\timport debug; **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_recv { **** v1 CLI TX|\t\tif (req.url == "/longsend") { **** v1 CLI TX|\t\t\t# client -rcvbuf 128 is super inefficient, so **** v1 CLI TX|\t\t\t# we need a very long timeout **** v1 CLI TX|\t\t\tset sess.send_timeout = 20s; **** v1 CLI TX|\t\t} else **** v1 CLI TX|\t\tif (req.url == "/longidlesend") { **** v1 CLI TX|\t\t\tset sess.idle_send_timeout = 2s; **** v1 CLI TX|\t\t} **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_hash { **** v1 CLI TX|\t\thash_data("/"); **** v1 CLI TX|\t\treturn (lookup); **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_deliver { **** v1 CLI TX|\t\tdebug.sndbuf(128b); **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.264 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.364 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.464 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.564 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.664 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.767 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.867 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.968 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.068 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.171 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.271 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.372 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.472 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.572 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.672 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.775 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.875 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.975 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 2.075 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 2.176 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 2.276 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 2.377 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 2.393 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 **** dT 2.394 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 2.460 *** v1 debug|Debug: Child (3698686) Started **** dT 2.513 *** v1 debug|Child launched OK **** dT 2.522 *** v1 debug|Info: Child (3698686) said Child starts *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** dT 2.563 *** v1 CLI RX 200 **** v1 CLI RX|a0 /tmp/vtc.3696048.5a309b40/v1.sock - **** v1 CLI TX|debug.xid 1000 **** dT 2.578 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811094.492064/vgc.so 1auto **** v1 vsl| 0 Debug - vcl1: VCL_EVENT_WARM **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811094.492064/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 39 a0 /tmp/vtc.3696048.5a309b40/v1.sock - **** dT 2.611 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 2.659 *** v1 CLI RX 200 **** v1 CLI RX|a0 /tmp/vtc.3696048.5a309b40/v1.sock - ** v1 Listen on 0.0.0.0 0 **** v1 macro def v1_addr=0.0.0.0 **** v1 macro def v1_port=0 **** v1 macro def v1_sock=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 macro def v1_a0_addr=0.0.0.0 **** v1 macro def v1_a0_port=0 **** v1 macro def v1_a0_sock=/tmp/vtc.3696048.5a309b40/v1.sock ** top === logexpect l1 -v v1 -q "ReqURL ~ \"^/$\"" { ** l1 === expect * * Debug "Hit total send timeout" ** top === client c1 -connect "${tmpdir}/v1.sock" -rcvbuf 128 { ** c1 Starting client **** l1 begin| **** l1 qry | ReqURL ~ "^/$" *** l1 test | expect * * Debug Hit total send timeout **** dT 2.660 ** top === client c2 -connect "${tmpdir}/v1.sock" -rcvbuf 128 { ** c2 Starting client ** top === client c1 -wait ** c1 Waiting for client ** c1 Started on /tmp/vtc.3696048.5a309b40/v1.sock (1 iterations) *** c1 Connect to /tmp/vtc.3696048.5a309b40/v1.sock ** c2 Started on /tmp/vtc.3696048.5a309b40/v1.sock (1 iterations) *** c2 Connect to /tmp/vtc.3696048.5a309b40/v1.sock *** c2 connected fd 22 to /tmp/vtc.3696048.5a309b40/v1.sock *** c1 connected fd 21 to /tmp/vtc.3696048.5a309b40/v1.sock *** c1 -rcvbuf fd=21 old=212992 new=128 actual=2304 *** c2 -rcvbuf fd=22 old=212992 new=128 actual=2304 ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c2 === txreq -url /longsend ** c1 === non_fatal ** c1 === rxresphdrs **** c2 txreq|GET /longsend HTTP/1.1\r **** c2 txreq|Host: 127.0.0.1\r **** c2 txreq|User-Agent: c2\r **** c2 txreq|\r ** c2 === rxresphdrs **** dT 2.661 *** s1 accepted fd 4 127.0.0.1 57614 ** s1 === rxreq **** s1 rxhdr|GET / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 0.0.0.0\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|Accept-Encoding: gzip\r **** s1 rxhdr|X-Varnish: 1002\r **** s1 rxhdr|\r **** s1 rxhdrlen = 144 **** s1 http[ 0] |GET **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 0.0.0.0 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |Accept-Encoding: gzip **** s1 http[ 8] |X-Varnish: 1002 **** s1 bodylen = 0 ** s1 === txresp -bodylen 100000 **** dT 2.662 **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:16 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 100000\r **** s1 txresp|\r **** s1 txresp|!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ **** s1 txresp|"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` **** s1 txresp|#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a **** s1 txresp|$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab **** s1 txresp|%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc **** s1 txresp|&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd **** s1 txresp|'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde **** s1 txresp|()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdef **** s1 txresp|)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg **** s1 txresp|*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgh **** s1 txresp|+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghi **** s1 txresp|,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghij **** s1 txresp|-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk **** s1 txresp|./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkl **** s1 txresp|/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm **** s1 txresp|0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn **** s1 txresp|123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno **** s1 txresp|23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnop **** s1 txresp|3456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopq **** s1 txresp|456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqr **** s1 txresp|56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs **** s1 txresp|6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst **** s1 txresp|789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu **** s1 txresp|89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv **** s1 txresp|9:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw **** s1 txresp|:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx **** s1 txresp|;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy **** s1 txresp|<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz **** s1 txresp|=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{ **** s1 txresp|>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{| **** s1 txresp|?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|} **** s1 txresp|@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}! **** s1 txresp|ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!" **** s1 txresp|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"# **** s1 txresp|CDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$ **** s1 txresp|DEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$% **** s1 txresp|EFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%& **** s1 txresp|FGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&' **** s1 txresp|GHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'( **** s1 txresp|HIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'() **** s1 txresp|IJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()* **** s1 txresp|JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+ **** s1 txresp|KLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+, **** s1 txresp|LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,- **** s1 txresp|MNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-. **** s1 txresp|NOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./ **** s1 txresp|OPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0 **** s1 txresp|PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01 **** s1 txresp|QRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012 **** s1 txresp|RSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123 **** s1 txresp|STUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01234 **** s1 txresp|TUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012345 **** s1 txresp|UVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456 **** s1 txresp|VWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01234567 **** s1 txresp|WXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012345678 **** s1 txresp|XYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789 **** s1 txresp|YZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789: **** s1 txresp|Z[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:; **** s1 txresp|[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;< **** s1 txresp|\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<= **** s1 txresp|]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=> **** s1 txresp|^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>? **** s1 txresp|_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ **** s1 txresp|`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@A **** s1 txresp|abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@AB **** s1 txresp|bcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABC **** s1 txresp|cdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCD **** s1 txresp|defghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDE **** s1 txresp|efghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEF **** s1 txresp|fghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFG **** s1 txresp|ghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGH **** s1 txresp|hijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHI **** s1 txresp|ijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJ **** s1 txresp|jklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK **** s1 txresp|klmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKL **** s1 txresp|lmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLM **** s1 txresp|mnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMN **** s1 txresp|nopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO **** s1 txresp|opqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP **** s1 txresp|pqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQ **** s1 txresp|qrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQR **** s1 txresp|rstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRS **** s1 txresp|stuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRST **** s1 txresp|tuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTU **** s1 txresp|uvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV **** s1 txresp|vwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVW **** s1 txresp|wxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX **** s1 txresp|xyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXY **** s1 txresp|yz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ **** s1 txresp|z{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[ **** s1 txresp|{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\ **** s1 txresp||}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\] **** s1 txresp|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^ **** s1 txresp|!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ **** s1 txresp|"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` **** s1 txresp|#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a **** s1 txresp|$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab **** s1 txresp|%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc **** s1 txresp|&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd **** s1 txresp|'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde **** s1 txresp|()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdef **** s1 txresp|)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg **** s1 txresp|*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgh **** s1 txresp|+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghi **** s1 txresp|,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghij **** s1 txresp|-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk **** s1 txresp|./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkl **** s1 txresp|/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm **** s1 txresp|0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn **** s1 txresp|123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno **** s1 txresp|23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnop **** s1 txresp|3456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopq **** s1 txresp|456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqr **** s1 txresp|56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs **** s1 txresp|6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst **** s1 txresp|789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu **** s1 txresp|89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv **** s1 txresp|9:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw **** s1 txresp|:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx **** s1 txresp|;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy **** s1 txresp|<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz **** s1 txresp|=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{ **** s1 txresp|>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{| **** s1 txresp|?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|} **** s1 txresp|@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}! **** s1 txresp|ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!" **** s1 txresp|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde **** s1 txresp| [...] (91900) *** s1 shutting fd 4 ** s1 Ending **** dT 2.667 **** c2 rxhdr|HTTP/1.1 200 OK\r **** c2 rxhdr|Date: Mon, 07 Sep 2026 19:58:16 GMT\r **** c2 rxhdr|Server: s1\r **** c2 rxhdr|Content-Length: 100000\r **** c2 rxhdr|X-Varnish: 1004 1002\r **** c2 rxhdr|Age: 0\r **** c2 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c2 rxhdr|Accept-Ranges: bytes\r **** c2 rxhdr|Connection: keep-alive\r **** c2 rxhdr|\r **** c2 rxhdrlen = 195 **** c2 http[ 0] |HTTP/1.1 **** c2 http[ 1] |200 **** c2 http[ 2] |OK **** c2 http[ 3] |Date: Mon, 07 Sep 2026 19:58:16 GMT **** c2 http[ 4] |Server: s1 **** c2 http[ 5] |Content-Length: 100000 **** c2 http[ 6] |X-Varnish: 1004 1002 **** c2 http[ 7] |Age: 0 **** c2 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c2 http[ 9] |Accept-Ranges: bytes **** c2 http[10] |Connection: keep-alive ** c2 === delay 0.8 *** c2 delaying 0.8 second(s) **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:16 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 100000\r **** c1 rxhdr|X-Varnish: 1001\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Accept-Ranges: bytes\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 190 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:58:16 GMT **** c1 http[ 4] |Server: s1 **** c1 http[ 5] |Content-Length: 100000 **** c1 http[ 6] |X-Varnish: 1001 **** c1 http[ 7] |Age: 0 **** c1 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[ 9] |Accept-Ranges: bytes **** c1 http[10] |Connection: keep-alive ** c1 === delay 2 *** c1 delaying 2 second(s) **** dT 2.679 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 39 a0 /tmp/vtc.3696048.5a309b40/v1.sock - **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 0.0.0.0 0 a0 0.0.0.0 0 1788811096.992945 22 **** v1 vsl| 1000 Debug c sockopt: Test confirmed SO_KEEPALIVE non heredity for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1000 Debug c sockopt: Test confirmed SO_SNDTIMEO non heredity for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1000 Debug c sockopt: Test confirmed SO_RCVTIMEO non heredity for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1000 Debug c sockopt: Setting SO_KEEPALIVE for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1000 Debug c sockopt: Setting SO_SNDTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1000 Debug c sockopt: Setting SO_RCVTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1000 Link c req 1001 rxreq **** v1 vsl| 1003 Begin c sess 0 HTTP/1 **** v1 vsl| 1003 SessOpen c 0.0.0.0 0 a0 0.0.0.0 0 1788811096.995811 20 **** v1 vsl| 1003 Debug c sockopt: SO_LINGER may be inherited for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1003 Debug c sockopt: Setting SO_KEEPALIVE for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1003 Debug c sockopt: Setting SO_SNDTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1003 Debug c sockopt: Setting SO_RCVTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1003 Link c req 1004 rxreq **** v1 vsl| 1002 Begin b bereq 1001 fetch **** v1 vsl| 1002 VCL_use b vcl1 **** v1 vsl| 1002 Timestamp b Start: 1788811096.993200 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b GET **** v1 vsl| 1002 BereqURL b / **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b User-Agent: c1 **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 0.0.0.0 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b Accept-Encoding: gzip **** v1 vsl| 1002 BereqHeader b X-Varnish: 1002 **** v1 vsl| 1002 VCL_call b BACKEND_FETCH **** v1 vsl| 1002 VCL_return b fetch **** v1 vsl| 1002 Timestamp b Fetch: 1788811096.993223 0.000022 0.000022 **** v1 vsl| 1002 Timestamp b Connected: 1788811096.993527 0.000327 0.000304 **** v1 vsl| 1002 BackendOpen b 24 s1 127.0.0.1 36027 127.0.0.1 57614 connect **** v1 vsl| 1002 Timestamp b Bereq: 1788811096.993601 0.000401 0.000074 **** v1 vsl| 1002 BerespProtocol b HTTP/1.1 **** v1 vsl| 1002 BerespStatus b 200 **** v1 vsl| 1002 BerespReason b OK **** v1 vsl| 1002 BerespHeader b Date: Mon, 07 Sep 2026 19:58:16 GMT **** v1 vsl| 1002 BerespHeader b Server: s1 **** v1 vsl| 1002 BerespHeader b Content-Length: 100000 **** v1 vsl| 1002 Timestamp b Beresp: 1788811096.994633 0.001433 0.001032 **** v1 vsl| 1002 TTL b RFC 120 10 0 1788811097 1788811097 1788811096 0 0 cacheable **** v1 vsl| 1002 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1002 VCL_return b deliver **** v1 vsl| 1002 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1002 Timestamp b Process: 1788811096.994715 0.001515 0.000081 **** v1 vsl| 1002 Filters b **** v1 vsl| 1002 Storage b malloc s0 **** v1 vsl| 1002 Fetch_Body b 3 length stream **** v1 vsl| 1002 BackendClose b 24 s1 recycle **** v1 vsl| 1002 Timestamp b BerespBody: 1788811097.005065 0.011865 0.010350 **** v1 vsl| 1002 Length b 100000 **** v1 vsl| 1002 BereqAcct b 144 0 144 92 100000 100092 **** v1 vsl| 1002 End b **** dT 2.764 **** l1 match| 1001 Debug c Hit total send timeout, wrote = 4480/95710; not retrying **** l1 done | **** dT 2.779 **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811096.993022 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811096.993022 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 0.0.0.0 0 a0 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c / **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 0.0.0.0 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c hash **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 VCL_call c MISS **** v1 vsl| 1001 VCL_return c fetch **** v1 vsl| 1001 Link c bereq 1002 fetch **** v1 vsl| 1001 Timestamp c Fetch: 1788811096.994994 0.001972 0.001972 **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 200 **** v1 vsl| 1001 RespReason c OK **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:58:16 GMT **** v1 vsl| 1001 RespHeader c Server: s1 **** v1 vsl| 1001 RespHeader c Content-Length: 100000 **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 RespHeader c Age: 0 **** v1 vsl| 1001 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1001 VCL_call c DELIVER **** v1 vsl| 1001 Debug c SO_SNDBUF fd=22 old=212992 new=128 actual=4608 **** v1 vsl| 1001 VCL_return c deliver **** v1 vsl| 1001 Timestamp c Process: 1788811096.995030 0.002008 0.000036 **** v1 vsl| 1001 Filters c **** v1 vsl| 1001 RespHeader c Connection: keep-alive **** v1 vsl| 1001 Debug c Hit total send timeout, wrote = 4480/95710; not retrying **** v1 vsl| 1001 Debug c Write error, retval = -1, len = 95710, errno = Success **** v1 vsl| 1001 Timestamp c Resp: 1788811097.095779 0.102757 0.100749 **** v1 vsl| 1001 ReqAcct c 51 0 51 190 100000 100190 **** v1 vsl| 1001 End c **** v1 vsl| 1000 SessClose c TX_ERROR 0.103 **** v1 vsl| 1000 End c **** dT 3.467 ** c2 === rxrespbody **** dT 3.469 **** c2 c-l|!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ **** c2 c-l|"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` **** c2 c-l|#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a **** c2 c-l|$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab **** c2 c-l|%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc **** c2 c-l|&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd **** c2 c-l|'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde **** c2 c-l|()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdef **** c2 c-l|)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg **** c2 c-l|*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgh **** c2 c-l|+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghi **** c2 c-l|,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghij **** c2 c-l|-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk **** c2 c-l|./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkl **** c2 c-l|/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm **** c2 c-l|0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn **** c2 c-l|123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno **** c2 c-l|23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnop **** c2 c-l|3456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopq **** c2 c-l|456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqr **** c2 c-l|56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs **** c2 c-l|6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst **** c2 c-l|789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu **** c2 c-l|89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv **** c2 c-l|9:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw **** c2 c-l|:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx **** c2 c-l|;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy **** c2 c-l|<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz **** c2 c-l|=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{ **** c2 c-l|>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{| **** c2 c-l|?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|} **** c2 c-l|@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}! **** c2 c-l|ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!" **** c2 c-l|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"# **** c2 c-l|CDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$ **** c2 c-l|DEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$% **** c2 c-l|EFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%& **** c2 c-l|FGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&' **** c2 c-l|GHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'( **** c2 c-l|HIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'() **** c2 c-l|IJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()* **** c2 c-l|JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+ **** c2 c-l|KLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+, **** c2 c-l|LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,- **** c2 c-l|MNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-. **** c2 c-l|NOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./ **** c2 c-l|OPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0 **** c2 c-l|PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01 **** c2 c-l|QRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012 **** c2 c-l|RSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123 **** c2 c-l|STUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01234 **** c2 c-l|TUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012345 **** c2 c-l|UVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456 **** c2 c-l|VWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01234567 **** c2 c-l|WXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012345678 **** c2 c-l|XYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789 **** c2 c-l|YZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789: **** c2 c-l|Z[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:; **** c2 c-l|[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;< **** c2 c-l|\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<= **** c2 c-l|]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=> **** c2 c-l|^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>? **** c2 c-l|_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ **** c2 c-l|`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@A **** c2 c-l|abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@AB **** c2 c-l|bcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABC **** c2 c-l|cdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCD **** c2 c-l|defghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDE **** c2 c-l|efghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEF **** c2 c-l|fghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFG **** c2 c-l|ghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGH **** c2 c-l|hijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHI **** c2 c-l|ijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJ **** c2 c-l|jklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK **** c2 c-l|klmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKL **** c2 c-l|lmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLM **** c2 c-l|mnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMN **** c2 c-l|nopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO **** c2 c-l|opqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP **** c2 c-l|pqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQ **** c2 c-l|qrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQR **** c2 c-l|rstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRS **** c2 c-l|stuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRST **** c2 c-l|tuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTU **** c2 c-l|uvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV **** c2 c-l|vwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVW **** c2 c-l|wxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX **** c2 c-l|xyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXY **** c2 c-l|yz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ **** c2 c-l|z{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[ **** c2 c-l|{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\ **** c2 c-l||}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\] **** c2 c-l|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^ **** c2 c-l|!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ **** c2 c-l|"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` **** c2 c-l|#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a **** c2 c-l|$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab **** c2 c-l|%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc **** c2 c-l|&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd **** c2 c-l|'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde **** c2 c-l|()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdef **** c2 c-l|)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg **** c2 c-l|*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgh **** c2 c-l|+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghi **** c2 c-l|,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghij **** c2 c-l|-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk **** c2 c-l|./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkl **** c2 c-l|/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm **** c2 c-l|0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn **** c2 c-l|123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno **** c2 c-l|23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnop **** c2 c-l|3456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopq **** c2 c-l|456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqr **** c2 c-l|56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs **** c2 c-l|6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst **** c2 c-l|789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu **** c2 c-l|89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv **** c2 c-l|9:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw **** c2 c-l|:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx **** c2 c-l|;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy **** c2 c-l|<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz **** c2 c-l|=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{ **** c2 c-l|>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{| **** c2 c-l|?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|} **** c2 c-l|@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}! **** c2 c-l|ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!" **** c2 c-l|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"# **** c2 c-l|CDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$ **** c2 c-l| [...] (91808) **** c2 bodylen = 100000 ** c2 === expect resp.bodylen == 100000 **** c2 EXPECT resp.bodylen (100000) == "100000" match *** c2 closing fd 22 ** c2 Ending **** dT 3.484 **** v1 vsl| 1004 Begin c req 1003 rxreq **** v1 vsl| 1004 Timestamp c Start: 1788811096.996061 0.000000 0.000000 **** v1 vsl| 1004 Timestamp c Req: 1788811096.996061 0.000000 0.000000 **** v1 vsl| 1004 VCL_use c vcl1 **** v1 vsl| 1004 ReqStart c 0.0.0.0 0 a0 **** v1 vsl| 1004 ReqMethod c GET **** v1 vsl| 1004 ReqURL c /longsend **** v1 vsl| 1004 ReqProtocol c HTTP/1.1 **** v1 vsl| 1004 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1004 ReqHeader c User-Agent: c2 **** v1 vsl| 1004 ReqHeader c X-Forwarded-For: 0.0.0.0 **** v1 vsl| 1004 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 VCL_call c RECV **** v1 vsl| 1004 VCL_return c hash **** v1 vsl| 1004 VCL_call c HASH **** v1 vsl| 1004 VCL_return c lookup **** v1 vsl| 1004 Hit c 1002 119.998572 10.000000 0.000000 100000 100000 **** v1 vsl| 1004 VCL_call c HIT **** v1 vsl| 1004 VCL_return c deliver **** v1 vsl| 1004 RespProtocol c HTTP/1.1 **** v1 vsl| 1004 RespStatus c 200 **** v1 vsl| 1004 RespReason c OK **** v1 vsl| 1004 RespHeader c Date: Mon, 07 Sep 2026 19:58:16 GMT **** v1 vsl| 1004 RespHeader c Server: s1 **** v1 vsl| 1004 RespHeader c Content-Length: 100000 **** v1 vsl| 1004 RespHeader c X-Varnish: 1004 1002 **** v1 vsl| 1004 RespHeader c Age: 0 **** v1 vsl| 1004 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1004 VCL_call c DELIVER **** v1 vsl| 1004 Debug c SO_SNDBUF fd=20 old=212992 new=128 actual=4608 **** v1 vsl| 1004 VCL_return c deliver **** v1 vsl| 1004 Timestamp c Process: 1788811096.996210 0.000149 0.000149 **** v1 vsl| 1004 Filters c **** v1 vsl| 1004 RespHeader c Connection: keep-alive **** v1 vsl| 1004 Debug c Hit idle send timeout, wrote = -1/95715; retrying **** v1 vsl| 1004 Debug c Hit idle send timeout, wrote = -1/95715; retrying **** v1 vsl| 1004 Debug c Hit idle send timeout, wrote = -1/95715; retrying **** v1 vsl| 1004 Debug c Hit idle send timeout, wrote = -1/95715; retrying **** v1 vsl| 1004 Debug c Hit idle send timeout, wrote = -1/95715; retrying **** v1 vsl| 1004 Debug c Hit idle send timeout, wrote = -1/95715; retrying **** v1 vsl| 1004 Timestamp c Resp: 1788811097.801580 0.805519 0.805369 **** v1 vsl| 1004 ReqAcct c 59 0 59 195 100000 100195 **** v1 vsl| 1004 End c **** v1 vsl| 1003 SessClose c REM_CLOSE 0.806 **** v1 vsl| 1003 End c **** dT 4.679 *** c1 closing fd 21 ** c1 Ending **** dT 4.686 ** top === client c2 -wait ** c2 Waiting for client ** top === varnish v1 -cliok "param.set idle_send_timeout 1" **** v1 CLI TX|param.set idle_send_timeout 1 **** dT 4.731 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.reset send_timeout" **** v1 CLI TX|param.reset send_timeout **** dT 4.779 *** v1 CLI RX 200 ** v1 CLI 200 ** top === logexpect l2 -v v1 -q "ReqURL ~ \"^/$\"" { ** l2 === expect * * Debug "Hit idle send timeout" ** top === client c3 -connect "${tmpdir}/v1.sock" -rcvbuf 128 { ** c3 Starting client ** top === client c4 -connect "${tmpdir}/v1.sock" -rcvbuf 128 { ** c4 Starting client **** dT 4.783 **** l2 begin| **** l2 qry | ReqURL ~ "^/$" *** l2 test | expect * * Debug Hit idle send timeout **** dT 5.203 ** c3 Started on /tmp/vtc.3696048.5a309b40/v1.sock (1 iterations) *** c3 Connect to /tmp/vtc.3696048.5a309b40/v1.sock **** dT 6.863 ** top === client c3 -wait ** c3 Waiting for client **** dT 6.864 ** c4 Started on /tmp/vtc.3696048.5a309b40/v1.sock (1 iterations) *** c4 Connect to /tmp/vtc.3696048.5a309b40/v1.sock **** dT 6.865 *** c4 connected fd 26 to /tmp/vtc.3696048.5a309b40/v1.sock *** c4 -rcvbuf fd=26 old=212992 new=128 actual=2304 ** c4 === txreq -url /longidlesend **** c4 txreq|GET /longidlesend HTTP/1.1\r **** c4 txreq|Host: 127.0.0.1\r **** c4 txreq|User-Agent: c4\r **** c4 txreq|\r ** c4 === rxresphdrs **** dT 6.866 *** c3 connected fd 25 to /tmp/vtc.3696048.5a309b40/v1.sock *** c3 -rcvbuf fd=25 old=212992 new=128 actual=2304 ** c3 === txreq **** c3 txreq|GET / HTTP/1.1\r **** c3 txreq|Host: 127.0.0.1\r **** c3 txreq|User-Agent: c3\r **** c3 txreq|\r ** c3 === rxresphdrs **** dT 6.883 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811101 1.0 **** v1 vsl| 0 Debug - sockopt: Not setting unmodified SO_LINGER for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 0 Debug - sockopt: Not setting unmodified SO_KEEPALIVE for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 0 Debug - sockopt: Not setting unmodified SO_RCVTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Begin c sess 0 HTTP/1 **** v1 vsl| 1005 SessOpen c 0.0.0.0 0 a0 0.0.0.0 0 1788811101.196662 21 **** v1 vsl| 1005 Debug c sockopt: Not testing nonhereditary SO_KEEPALIVE for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Debug c sockopt: Not testing nonhereditary SO_SNDTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Debug c sockopt: Not testing nonhereditary SO_RCVTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Debug c sockopt: SO_LINGER may be inherited for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Debug c sockopt: Setting SO_KEEPALIVE for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Debug c sockopt: Setting SO_SNDTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Debug c sockopt: Setting SO_RCVTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1006 Begin c sess 0 HTTP/1 **** v1 vsl| 1006 SessOpen c 0.0.0.0 0 a0 0.0.0.0 0 1788811101.197950 22 **** v1 vsl| 1006 Debug c sockopt: SO_LINGER may be inherited for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1006 Debug c sockopt: Setting SO_KEEPALIVE for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1006 Debug c sockopt: Setting SO_SNDTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** dT 6.893 **** c4 rxhdr|HTTP/1.1 200 OK\r **** c4 rxhdr|Date: Mon, 07 Sep 2026 19:58:16 GMT\r **** c4 rxhdr|Server: s1\r **** c4 rxhdr|Content-Length: 100000\r **** c4 rxhdr|X-Varnish: 1008 1002\r **** c4 rxhdr|Age: 4\r **** c4 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c4 rxhdr|Accept-Ranges: bytes\r **** c4 rxhdr|Connection: keep-alive\r **** c4 rxhdr|\r **** c4 rxhdrlen = 195 **** c4 http[ 0] |HTTP/1.1 **** c4 http[ 1] |200 **** c4 http[ 2] |OK **** c4 http[ 3] |Date: Mon, 07 Sep 2026 19:58:16 GMT **** c4 http[ 4] |Server: s1 **** c3 rxhdr|HTTP/1.1 200 OK\r **** c3 rxhdr|Date: Mon, 07 Sep 2026 19:58:16 GMT\r **** c3 rxhdr|Server: s1\r **** c3 rxhdr|Content-Length: 100000\r **** c3 rxhdr|X-Varnish: 1007 1002\r **** c3 rxhdr|Age: 4\r **** c3 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c3 rxhdr|Accept-Ranges: bytes\r **** c3 rxhdr|Connection: keep-alive\r **** c3 rxhdr|\r **** c4 http[ 5] |Content-Length: 100000 **** c4 http[ 6] |X-Varnish: 1008 1002 **** c4 http[ 7] |Age: 4 **** c4 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c3 rxhdrlen = 195 **** c4 http[ 9] |Accept-Ranges: bytes **** c4 http[10] |Connection: keep-alive **** c3 http[ 0] |HTTP/1.1 **** c3 http[ 1] |200 **** c3 http[ 2] |OK ** c4 === delay 1.8 **** c3 http[ 3] |Date: Mon, 07 Sep 2026 19:58:16 GMT **** c3 http[ 4] |Server: s1 **** c3 http[ 5] |Content-Length: 100000 **** c3 http[ 6] |X-Varnish: 1007 1002 **** c3 http[ 7] |Age: 4 **** c3 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c3 http[ 9] |Accept-Ranges: bytes **** c3 http[10] |Connection: keep-alive *** c4 delaying 1.8 second(s) ** c3 === delay 2 *** c3 delaying 2 second(s) **** dT 6.983 **** v1 vsl| 1006 Debug c sockopt: Setting SO_RCVTIMEO for a0=/tmp/vtc.3696048.5a309b40/v1.sock **** v1 vsl| 1005 Link c req 1007 rxreq **** v1 vsl| 1006 Link c req 1008 rxreq **** dT 8.694 ** c4 === rxrespbody **** c4 c-l|!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ **** c4 c-l|"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` **** c4 c-l|#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a **** c4 c-l|$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab **** c4 c-l|%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc **** c4 c-l|&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd **** c4 c-l|'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde **** c4 c-l|()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdef **** c4 c-l|)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg **** c4 c-l|*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgh **** c4 c-l|+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghi **** c4 c-l|,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghij **** c4 c-l|-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk **** c4 c-l|./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkl **** c4 c-l|/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm **** c4 c-l|0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn **** c4 c-l|123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno **** c4 c-l|23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnop **** c4 c-l|3456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopq **** c4 c-l|456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqr **** c4 c-l|56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs **** c4 c-l|6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst **** c4 c-l|789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu **** c4 c-l|89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv **** c4 c-l|9:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw **** c4 c-l|:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx **** c4 c-l|;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy **** c4 c-l|<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz **** c4 c-l|=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{ **** c4 c-l|>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{| **** c4 c-l|?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|} **** c4 c-l|@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}! **** c4 c-l|ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!" **** c4 c-l|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"# **** c4 c-l|CDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$ **** c4 c-l|DEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$% **** c4 c-l|EFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%& **** c4 c-l|FGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&' **** c4 c-l|GHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'( **** c4 c-l|HIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'() **** c4 c-l|IJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()* **** c4 c-l|JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+ **** c4 c-l|KLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+, **** c4 c-l|LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,- **** c4 c-l|MNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-. **** c4 c-l|NOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./ **** c4 c-l|OPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0 **** c4 c-l|PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01 **** c4 c-l|QRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012 **** c4 c-l|RSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123 **** c4 c-l|STUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01234 **** c4 c-l|TUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012345 **** c4 c-l|UVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456 **** c4 c-l|VWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./01234567 **** c4 c-l|WXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./012345678 **** c4 c-l|XYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789 **** c4 c-l|YZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789: **** c4 c-l|Z[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:; **** c4 c-l|[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;< **** c4 c-l|\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<= **** c4 c-l|]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=> **** c4 c-l|^_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>? **** c4 c-l|_`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ **** c4 c-l|`abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@A **** c4 c-l|abcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@AB **** c4 c-l|bcdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABC **** c4 c-l|cdefghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCD **** c4 c-l|defghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDE **** c4 c-l|efghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEF **** c4 c-l|fghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFG **** c4 c-l|ghijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGH **** c4 c-l|hijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHI **** c4 c-l|ijklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJ **** c4 c-l|jklmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK **** c4 c-l|klmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKL **** c4 c-l|lmnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLM **** c4 c-l|mnopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMN **** c4 c-l|nopqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO **** c4 c-l|opqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP **** c4 c-l|pqrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQ **** c4 c-l|qrstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQR **** c4 c-l|rstuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRS **** c4 c-l|stuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRST **** c4 c-l|tuvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTU **** c4 c-l|uvwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV **** c4 c-l|vwxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVW **** c4 c-l|wxyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX **** c4 c-l|xyz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXY **** c4 c-l|yz{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ **** c4 c-l|z{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[ **** c4 c-l|{|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\ **** c4 c-l||}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\] **** c4 c-l|}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^ **** c4 c-l|!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ **** c4 c-l|"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` **** c4 c-l|#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a **** c4 c-l|$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab **** c4 c-l|%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc **** c4 c-l|&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd **** c4 c-l|'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde **** c4 c-l|()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdef **** c4 c-l|)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg **** c4 c-l|*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgh **** c4 c-l|+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghi **** c4 c-l|,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghij **** c4 c-l|-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk **** c4 c-l|./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkl **** c4 c-l|/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm **** c4 c-l|0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn **** c4 c-l|123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno **** c4 c-l|23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnop **** c4 c-l|3456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopq **** c4 c-l|456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqr **** c4 c-l|56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs **** c4 c-l|6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst **** c4 c-l|789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu **** c4 c-l|89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv **** c4 c-l|9:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw **** c4 c-l|:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx **** c4 c-l|;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy **** c4 c-l|<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz **** c4 c-l|=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{ **** c4 c-l|>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{| **** c4 c-l|?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|} **** c4 c-l|@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}! **** c4 c-l|ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!" **** c4 c-l|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"# **** c4 c-l|CDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}!"#$ **** c4 c-l| [...] (91808) **** c4 bodylen = 100000 ** c4 === expect resp.bodylen == 100000 **** c4 EXPECT resp.bodylen (100000) == "100000" match *** c4 closing fd 26 ** c4 Ending **** dT 8.695 **** v1 vsl| 1008 Begin c req 1006 rxreq **** v1 vsl| 1008 Timestamp c Start: 1788811101.225740 0.000000 0.000000 **** v1 vsl| 1008 Timestamp c Req: 1788811101.225740 0.000000 0.000000 **** v1 vsl| 1008 VCL_use c vcl1 **** v1 vsl| 1008 ReqStart c 0.0.0.0 0 a0 **** v1 vsl| 1008 ReqMethod c GET **** v1 vsl| 1008 ReqURL c /longidlesend **** v1 vsl| 1008 ReqProtocol c HTTP/1.1 **** v1 vsl| 1008 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1008 ReqHeader c User-Agent: c4 **** v1 vsl| 1008 ReqHeader c X-Forwarded-For: 0.0.0.0 **** v1 vsl| 1008 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1008 VCL_call c RECV **** v1 vsl| 1008 VCL_return c hash **** v1 vsl| 1008 VCL_call c HASH **** v1 vsl| 1008 VCL_return c lookup **** v1 vsl| 1008 Hit c 1002 115.768893 10.000000 0.000000 **** v1 vsl| 1008 VCL_call c HIT **** v1 vsl| 1008 VCL_return c deliver **** v1 vsl| 1008 RespProtocol c HTTP/1.1 **** v1 vsl| 1008 RespStatus c 200 **** v1 vsl| 1008 RespReason c OK **** v1 vsl| 1008 RespHeader c Date: Mon, 07 Sep 2026 19:58:16 GMT **** v1 vsl| 1008 RespHeader c Server: s1 **** v1 vsl| 1008 RespHeader c Content-Length: 100000 **** v1 vsl| 1008 RespHeader c X-Varnish: 1008 1002 **** v1 vsl| 1008 RespHeader c Age: 4 **** v1 vsl| 1008 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1008 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1008 VCL_call c DELIVER **** v1 vsl| 1008 Debug c SO_SNDBUF fd=22 old=212992 new=128 actual=4608 **** v1 vsl| 1008 VCL_return c deliver **** v1 vsl| 1008 Timestamp c Process: 1788811101.225784 0.000044 0.000044 **** v1 vsl| 1008 Filters c **** v1 vsl| 1008 RespHeader c Connection: keep-alive **** v1 vsl| 1008 Timestamp c Resp: 1788811103.027112 1.801372 1.801327 **** v1 vsl| 1008 ReqAcct c 63 0 63 195 100000 100195 **** v1 vsl| 1008 End c **** v1 vsl| 1006 SessClose c REM_CLOSE 1.829 **** v1 vsl| 1006 End c **** dT 8.795 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811103 1.0 **** dT 8.893 *** c3 closing fd 25 ** c3 Ending **** dT 8.895 **** v1 vsl| 1007 Begin c req 1005 rxreq **** v1 vsl| 1007 Timestamp c Start: 1788811101.199088 0.000000 0.000000 **** v1 vsl| 1007 Timestamp c Req: 1788811101.199088 0.000000 0.000000 **** v1 vsl| 1007 VCL_use c vcl1 **** v1 vsl| 1007 ReqStart c 0.0.0.0 0 a0 **** v1 vsl| 1007 ReqMethod c GET **** v1 vsl| 1007 ReqURL c / **** v1 vsl| 1007 ReqProtocol c HTTP/1.1 **** v1 vsl| 1007 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1007 ReqHeader c User-Agent: c3 **** v1 vsl| 1007 ReqHeader c X-Forwarded-For: 0.0.0.0 **** v1 vsl| 1007 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1007 VCL_call c RECV **** v1 vsl| 1007 VCL_return c hash **** v1 vsl| 1007 VCL_call c HASH **** v1 vsl| 1007 VCL_return c lookup **** v1 vsl| 1007 Hit c 1002 115.795545 10.000000 0.000000 **** v1 vsl| 1007 VCL_call c HIT **** v1 vsl| 1007 VCL_return c deliver **** v1 vsl| 1007 RespProtocol c HTTP/1.1 **** v1 vsl| 1007 RespStatus c 200 **** v1 vsl| 1007 RespReason c OK **** v1 vsl| 1007 RespHeader c Date: Mon, 07 Sep 2026 19:58:16 GMT **** v1 vsl| 1007 RespHeader c Server: s1 **** v1 vsl| 1007 RespHeader c Content-Length: 100000 **** v1 vsl| 1007 RespHeader c X-Varnish: 1007 1002 **** v1 vsl| 1007 RespHeader c Age: 4 **** v1 vsl| 1007 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1007 RespHeader c Accept-Ranges: bytes **** v1 vsl| 1007 VCL_call c DELIVER **** v1 vsl| 1007 Debug c SO_SNDBUF fd=21 old=212992 new=128 actual=4608 **** v1 vsl| 1007 VCL_return c deliver **** v1 vsl| 1007 Timestamp c Process: 1788811101.225648 0.026559 0.026559 **** v1 vsl| 1007 Filters c **** v1 vsl| 1007 RespHeader c Connection: keep-alive **** v1 vsl| 1007 Debug c Write error, retval = -1, len = 95715, errno = Connection reset by peer **** v1 vsl| 1007 Timestamp c Resp: 1788811103.226496 2.027408 2.000848 **** v1 vsl| 1007 ReqAcct c 51 0 51 195 100000 100195 **** v1 vsl| 1007 End c **** v1 vsl| 1005 SessClose c TX_ERROR 2.030 **** v1 vsl| 1005 End c **** dT 8.899 ** top === client c4 -wait ** c4 Waiting for client ** top === logexpect l1 -wait ** l1 Waiting for logexp ** top === logexpect l2 -wait ** l2 Waiting for logexp **** dT 11.799 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811106 1.0 **** dT 16.687 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811110 1.0 **** dT 18.693 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811112 1.0 **** dT 21.708 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811115 1.0 **** dT 25.671 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811119 1.0 **** dT 28.583 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811122 1.0 **** dT 34.567 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811128 1.0 **** dT 37.577 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811131 1.0 **** dT 42.575 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811136 1.0 **** dT 45.525 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811139 1.0 **** dT 52.467 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811146 1.0 **** dT 55.333 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811149 1.0 **** dT 58.432 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811152 1.0 # top TEST ./tests/s00012.vtc TIMED OUT (kill -9) # top TEST ./tests/s00012.vtc FAILED (60.101) signal=9 FAIL tests/s00012.vtc (exit status: 2) FAIL: tests/s00013 ================== **** dT 0.000 * top TEST ./tests/s00013.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:35953 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3696264.1c44427b **** top macro def vtcid=vtc.3696264.1c44427b **** dT 0.001 ** top === varnishtest "pipe timeouts" * top VTEST pipe timeouts ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=37601 **** s1 macro def s1_sock=127.0.0.1:37601 * s1 Listen on 127.0.0.1:37601 ** top === varnish v1 -cliok "param.set pipe_timeout 0s" **** dT 0.004 ** s1 Started on 127.0.0.1:37601 (1 iterations) **** dT 0.015 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3696264.1c44427b/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 46859' -P /tmp/vtc.3696264.1c44427b/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3696264.1c44427b/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 46859' -P /tmp/vtc.3696264.1c44427b/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 PID: 3696332 **** v1 macro def v1_pid=3696332 **** v1 macro def v1_name=/tmp/vtc.3696264.1c44427b/v1 **** dT 0.069 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.156 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 6 *** v1 CLI RX 107 **** v1 CLI RX|cubxuhexecgdtafhyxtyejnvcicewdyw **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** dT 0.157 **** v1 CLI TX|auth 36118ac94ce64179bc4b8d18c7323eaf7a795c9b1ffd6d4a251840f33dade9c3 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** dT 0.160 **** v1 CLI TX|param.set pipe_timeout 0s **** dT 0.208 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set pipe_task_deadline 0s" **** v1 CLI TX|param.set pipe_task_deadline 0s **** dT 0.256 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -vcl+backend { **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX|backend s1 { .host = "127.0.0.1"; .port = "37601"; } **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_pipe { **** v1 CLI TX|\t\tset bereq.task_deadline = 1.1s; **** v1 CLI TX|\t\tif (req.method != "TMO") { **** v1 CLI TX|\t\t\tunset bereq.task_deadline; **** v1 CLI TX|\t\t} **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.263 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.363 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.464 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.572 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.672 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.772 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.872 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.973 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.073 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.173 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.273 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.373 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.473 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.574 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.674 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.774 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.874 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.968 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 **** dT 1.972 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 1.974 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 2.030 *** v1 debug|Debug: Child (3698163) Started **** dT 2.075 *** v1 debug|Child launched OK **** dT 2.077 *** v1 debug|Info: Child (3698163) said Child starts **** dT 2.080 *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status **** dT 2.084 *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** dT 2.131 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 33069 **** v1 CLI TX|debug.xid 1000 **** dT 2.175 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811094.715915/vgc.so 1auto **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811094.715915/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:33069 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:33069 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:33069 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:33069 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:33069 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:33069 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:33069 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:33069 **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 33069 **** dT 2.180 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 2.228 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 33069 ** v1 Listen on 127.0.0.1 33069 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=33069 **** v1 macro def v1_sock=127.0.0.1:33069 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=33069 **** v1 macro def v1_a0_sock=127.0.0.1:33069 ** top === logexpect l1 -v v1 -g raw -q SessClose { ** l1 === expect 1000 * SessClose {^TX_PIPE 1\.} ** l1 === expect 1003 * SessClose {^RX_TIMEOUT 0\.} ** l1 === expect 1006 * SessClose {^RX_TIMEOUT 1\.} ** l1 === expect 1009 * SessClose {^RX_TIMEOUT 1\.} ** l1 === expect 1012 * SessClose {^RX_TIMEOUT 1\.} **** dT 2.229 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client **** dT 2.231 **** l1 begin| **** l1 qry | SessClose *** l1 test | expect 1000 * SessClose ^TX_PIPE 1\\. **** dT 2.232 ** c1 Started on 127.0.0.1:33069 (1 iterations) *** c1 Connect to 127.0.0.1:33069 *** c1 connected fd 21 from 127.0.0.1 53930 to 127.0.0.1:33069 ** c1 === non_fatal ** c1 === txreq -method PIPE **** c1 txreq|PIPE / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 2.241 *** s1 accepted fd 4 127.0.0.1 38376 ** s1 === rxreq **** s1 rxhdr|PIPE / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|X-Varnish: 1001\r **** s1 rxhdr|Connection: close\r **** s1 rxhdr|\r **** s1 rxhdrlen = 143 **** s1 http[ 0] |PIPE **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |X-Varnish: 1001 **** s1 http[ 8] |Connection: close **** s1 bodylen = 0 ** s1 === txresp -hdr "transfer-encoding: chunked" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|transfer-encoding: chunked\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:16 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|\r ** s1 === delay 1.1 *** s1 delaying 1.1 second(s) **** dT 2.244 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|transfer-encoding: chunked\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:16 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|\r **** c1 rxhdrlen = 96 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |transfer-encoding: chunked **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:58:16 GMT **** c1 http[ 5] |Server: s1 **** dT 2.276 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 33069 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 53930 a0 127.0.0.1 33069 1788811096.699810 19 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1000 Link c req 1001 rxreq **** dT 3.341 ** s1 === close **** s1 Closed ** s1 === loop 3 { **** s1 Loop #0 ** s1 === accept **** s1 Accepting **** dT 3.344 **** c1 bodylen = 0 *** c1 closing fd 21 ** c1 Ending ** top === varnish v1 -cliok "param.set pipe_timeout 500ms" **** v1 CLI TX|param.set pipe_timeout 500ms **** dT 3.352 **** l1 match| 1000 SessClose c TX_PIPE 1.104 *** l1 test | expect 1003 * SessClose ^RX_TIMEOUT 0\\. **** dT 3.378 **** v1 vsl| 1002 Begin b bereq 1001 pipe **** v1 vsl| 1002 Timestamp b Start: 1788811096.700006 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b PIPE **** v1 vsl| 1002 BereqURL b / **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b User-Agent: c1 **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b X-Varnish: 1001 **** v1 vsl| 1002 BereqHeader b Connection: close **** v1 vsl| 1002 Timestamp b Process: 1788811096.700015 0.000008 0.000008 **** v1 vsl| 1002 Timestamp b Connected: 1788811096.700146 0.000139 0.000130 **** v1 vsl| 1002 BackendOpen b 22 s1 127.0.0.1 37601 127.0.0.1 38376 connect **** v1 vsl| 1002 Timestamp b Bereq: 1788811096.700193 0.000186 0.000046 **** v1 vsl| 1002 BackendClose b 22 s1 close TX_PIPE **** v1 vsl| 1002 BereqAcct b 0 0 0 0 0 0 **** v1 vsl| 1002 End b **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811096.699893 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811096.699893 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 53930 a0 **** v1 vsl| 1001 ReqMethod c PIPE **** v1 vsl| 1001 ReqURL c / **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c pipe **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 Link c bereq 1002 pipe **** v1 vsl| 1001 VCL_call c PIPE **** v1 vsl| 1001 VCL_return c pipe **** v1 vsl| 1001 Timestamp c Process: 1788811096.700015 0.000121 0.000121 **** v1 vsl| 1001 Timestamp c Pipe: 1788811096.700194 0.000301 0.000179 **** v1 vsl| 1001 Timestamp c PipeSess: 1788811097.803750 1.103857 1.103555 **** v1 vsl| 1001 PipeAcct c 52 143 0 96 **** v1 vsl| 1001 End c **** v1 vsl| 1000 SessClose c TX_PIPE 1.104 **** v1 vsl| 1000 End c **** dT 3.388 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set pipe_task_deadline 0s" **** v1 CLI TX|param.set pipe_task_deadline 0s **** dT 3.436 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 -run ** c1 Starting client ** c1 Waiting for client ** c1 Started on 127.0.0.1:33069 (1 iterations) *** c1 Connect to 127.0.0.1:33069 **** dT 3.440 *** c1 connected fd 21 from 127.0.0.1 53936 to 127.0.0.1:33069 ** c1 === non_fatal ** c1 === txreq -method PIPE **** c1 txreq|PIPE / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 3.441 *** s1 Accepted socket fd is 4 ** s1 === rxreq **** dT 3.442 **** s1 rxhdr|PIPE / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|X-Varnish: 1004\r **** s1 rxhdr|Connection: close\r **** s1 rxhdr|\r **** s1 rxhdrlen = 143 **** s1 http[ 0] |PIPE **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |X-Varnish: 1004 **** s1 http[ 8] |Connection: close **** s1 bodylen = 0 ** s1 === txresp -hdr "transfer-encoding: chunked" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|transfer-encoding: chunked\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:17 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|\r ** s1 === expect_close **** s1 Expecting close (fd = 4) **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|transfer-encoding: chunked\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:17 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|\r **** c1 rxhdrlen = 96 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |transfer-encoding: chunked **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:58:17 GMT **** c1 http[ 5] |Server: s1 **** dT 3.478 **** v1 vsl| 1003 Begin c sess 0 HTTP/1 **** v1 vsl| 1003 SessOpen c 127.0.0.1 53936 a0 127.0.0.1 33069 1788811097.900283 20 **** v1 vsl| 1003 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1003 Link c req 1004 rxreq **** dT 3.944 **** c1 bodylen = 0 *** c1 closing fd 21 ** c1 Ending ** top === varnish v1 -cliok "param.set pipe_timeout 0s" **** v1 CLI TX|param.set pipe_timeout 0s **** s1 fd=4 EOF, as expected **** s1 Loop #1 ** s1 === accept **** s1 Accepting **** dT 3.948 **** l1 match| 1003 SessClose c RX_TIMEOUT 0.504 *** l1 test | expect 1006 * SessClose ^RX_TIMEOUT 1\\. **** dT 3.979 **** v1 vsl| 1005 Begin b bereq 1004 pipe **** v1 vsl| 1005 Timestamp b Start: 1788811097.900453 0.000000 0.000000 **** v1 vsl| 1005 BereqMethod b PIPE **** v1 vsl| 1005 BereqURL b / **** v1 vsl| 1005 BereqProtocol b HTTP/1.1 **** v1 vsl| 1005 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1005 BereqHeader b User-Agent: c1 **** v1 vsl| 1005 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1005 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1005 BereqHeader b X-Varnish: 1004 **** v1 vsl| 1005 BereqHeader b Connection: close **** v1 vsl| 1005 Timestamp b Process: 1788811097.900462 0.000008 0.000008 **** v1 vsl| 1005 Timestamp b Connected: 1788811097.900591 0.000138 0.000129 **** v1 vsl| 1005 BackendOpen b 22 s1 127.0.0.1 37601 127.0.0.1 38378 connect **** v1 vsl| 1005 Timestamp b Bereq: 1788811097.900647 0.000193 0.000055 **** v1 vsl| 1005 BackendClose b 22 s1 close RX_TIMEOUT **** v1 vsl| 1005 BereqAcct b 0 0 0 0 0 0 **** v1 vsl| 1005 End b **** v1 vsl| 1004 Begin c req 1003 rxreq **** v1 vsl| 1004 Timestamp c Start: 1788811097.900348 0.000000 0.000000 **** v1 vsl| 1004 Timestamp c Req: 1788811097.900348 0.000000 0.000000 **** v1 vsl| 1004 VCL_use c vcl1 **** v1 vsl| 1004 ReqStart c 127.0.0.1 53936 a0 **** v1 vsl| 1004 ReqMethod c PIPE **** v1 vsl| 1004 ReqURL c / **** v1 vsl| 1004 ReqProtocol c HTTP/1.1 **** v1 vsl| 1004 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1004 ReqHeader c User-Agent: c1 **** v1 vsl| 1004 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1004 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 VCL_call c RECV **** v1 vsl| 1004 VCL_return c pipe **** v1 vsl| 1004 VCL_call c HASH **** v1 vsl| 1004 VCL_return c lookup **** v1 vsl| 1004 Link c bereq 1005 pipe **** v1 vsl| 1004 VCL_call c PIPE **** v1 vsl| 1004 VCL_return c pipe **** v1 vsl| 1004 Timestamp c Process: 1788811097.900462 0.000114 0.000114 **** v1 vsl| 1004 Timestamp c Pipe: 1788811097.900649 0.000301 0.000186 **** v1 vsl| 1004 Timestamp c PipeSess: 1788811098.403622 0.503273 0.502972 **** v1 vsl| 1004 PipeAcct c 52 143 0 96 **** v1 vsl| 1004 End c **** v1 vsl| 1003 SessClose c RX_TIMEOUT 0.504 **** v1 vsl| 1003 End c **** dT 3.988 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set pipe_task_deadline 1.1s" **** v1 CLI TX|param.set pipe_task_deadline 1.1s **** dT 4.032 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 -run ** c1 Starting client ** c1 Waiting for client ** c1 Started on 127.0.0.1:33069 (1 iterations) *** c1 Connect to 127.0.0.1:33069 *** c1 connected fd 21 from 127.0.0.1 53942 to 127.0.0.1:33069 ** c1 === non_fatal ** c1 === txreq -method PIPE **** c1 txreq|PIPE / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 4.058 *** s1 Accepted socket fd is 4 ** s1 === rxreq **** dT 4.059 **** s1 rxhdr|PIPE / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|X-Varnish: 1007\r **** s1 rxhdr|Connection: close\r **** s1 rxhdr|\r **** s1 rxhdrlen = 143 **** s1 http[ 0] |PIPE **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |X-Varnish: 1007 **** s1 http[ 8] |Connection: close **** s1 bodylen = 0 ** s1 === txresp -hdr "transfer-encoding: chunked" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|transfer-encoding: chunked\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:18 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|\r **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|transfer-encoding: chunked\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:18 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|\r **** c1 rxhdrlen = 96 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |transfer-encoding: chunked **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:58:18 GMT **** c1 http[ 5] |Server: s1 ** s1 === expect_close **** s1 Expecting close (fd = 4) **** dT 4.079 **** v1 vsl| 1006 Begin c sess 0 HTTP/1 **** v1 vsl| 1006 SessOpen c 127.0.0.1 53942 a0 127.0.0.1 33069 1788811098.495682 21 **** v1 vsl| 1006 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1006 Link c req 1007 rxreq **** dT 6.737 **** s1 fd=4 EOF, as expected **** s1 Loop #2 ** s1 === accept **** s1 Accepting **** c1 bodylen = 0 *** c1 closing fd 21 ** c1 Ending ** top === varnish v1 -cliok "param.set pipe_timeout 0s" **** v1 CLI TX|param.set pipe_timeout 0s **** dT 6.784 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set pipe_task_deadline 0s" **** v1 CLI TX|param.set pipe_task_deadline 0s **** dT 6.832 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c2 { ** c2 Starting client ** c2 Waiting for client **** dT 6.836 ** c2 Started on 127.0.0.1:33069 (1 iterations) *** c2 Connect to 127.0.0.1:33069 *** c2 connected fd 21 from 127.0.0.1 36170 to 127.0.0.1:33069 ** c2 === non_fatal ** c2 === txreq -method TMO **** c2 txreq|TMO / HTTP/1.1\r **** c2 txreq|Host: 127.0.0.1\r **** c2 txreq|User-Agent: c2\r **** c2 txreq|\r ** c2 === rxresp **** dT 6.837 *** s1 Accepted socket fd is 4 ** s1 === rxreq **** s1 rxhdr|TMO / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c2\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|X-Varnish: 1010\r **** s1 rxhdr|Connection: close\r **** s1 rxhdr|\r **** s1 rxhdrlen = 142 **** s1 http[ 0] |TMO **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c2 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |X-Varnish: 1010 **** s1 http[ 8] |Connection: close **** s1 bodylen = 0 ** s1 === txresp -hdr "transfer-encoding: chunked" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|transfer-encoding: chunked\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:21 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|\r **** c2 rxhdr|HTTP/1.1 200 OK\r **** c2 rxhdr|transfer-encoding: chunked\r **** c2 rxhdr|Date: Mon, 07 Sep 2026 19:58:21 GMT\r **** c2 rxhdr|Server: s1\r **** c2 rxhdr|\r **** c2 rxhdrlen = 96 **** c2 http[ 0] |HTTP/1.1 **** c2 http[ 1] |200 **** c2 http[ 2] |OK **** c2 http[ 3] |transfer-encoding: chunked **** c2 http[ 4] |Date: Mon, 07 Sep 2026 19:58:21 GMT **** c2 http[ 5] |Server: s1 ** s1 === expect_close **** s1 Expecting close (fd = 4) **** dT 6.928 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811101 1.0 **** v1 vsl| 1008 Begin b bereq 1007 pipe **** v1 vsl| 1008 Timestamp b Start: 1788811098.495797 0.000000 0.000000 **** v1 vsl| 1008 BereqMethod b PIPE **** v1 vsl| 1008 BereqURL b / **** v1 vsl| 1008 BereqProtocol b HTTP/1.1 **** v1 vsl| 1008 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1008 BereqHeader b User-Agent: c1 **** v1 vsl| 1008 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1008 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1008 BereqHeader b X-Varnish: 1007 **** v1 vsl| 1008 BereqHeader b Connection: close **** v1 vsl| 1008 Timestamp b Process: 1788811098.495805 0.000008 0.000008 **** v1 vsl| 1008 Timestamp b Connected: 1788811098.495929 0.000132 0.000124 **** v1 vsl| 1008 BackendOpen b 22 s1 127.0.0.1 37601 127.0.0.1 38380 connect **** v1 vsl| 1008 Timestamp b Bereq: 1788811098.495991 0.000194 0.000062 **** v1 vsl| 1008 BackendClose b 22 s1 close RX_TIMEOUT **** v1 vsl| 1008 BereqAcct b 0 0 0 0 0 0 **** v1 vsl| 1008 End b **** v1 vsl| 1007 Begin c req 1006 rxreq **** v1 vsl| 1007 Timestamp c Start: 1788811098.495744 0.000000 0.000000 **** v1 vsl| 1007 Timestamp c Req: 1788811098.495744 0.000000 0.000000 **** v1 vsl| 1007 VCL_use c vcl1 **** v1 vsl| 1007 ReqStart c 127.0.0.1 53942 a0 **** v1 vsl| 1007 ReqMethod c PIPE **** v1 vsl| 1007 ReqURL c / **** v1 vsl| 1007 ReqProtocol c HTTP/1.1 **** v1 vsl| 1007 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1007 ReqHeader c User-Agent: c1 **** v1 vsl| 1007 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1007 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1007 VCL_call c RECV **** v1 vsl| 1007 VCL_return c pipe **** v1 vsl| 1007 VCL_call c HASH **** v1 vsl| 1007 VCL_return c lookup **** v1 vsl| 1007 Link c bereq 1008 pipe **** v1 vsl| 1007 VCL_call c PIPE **** v1 vsl| 1007 VCL_return c pipe **** v1 vsl| 1007 Timestamp c Process: 1788811098.495805 0.000061 0.000061 **** v1 vsl| 1007 Timestamp c Pipe: 1788811098.495993 0.000249 0.000187 **** v1 vsl| 1007 Timestamp c PipeSess: 1788811101.195869 2.700125 2.699876 **** v1 vsl| 1007 PipeAcct c 52 143 0 96 **** v1 vsl| 1007 End c **** v1 vsl| 1006 SessClose c RX_TIMEOUT 2.701 **** v1 vsl| 1006 End c **** v1 vsl| 1009 Begin c sess 0 HTTP/1 **** v1 vsl| 1009 SessOpen c 127.0.0.1 36170 a0 127.0.0.1 33069 1788811101.296094 19 **** v1 vsl| 1009 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1009 Link c req 1010 rxreq **** dT 7.940 **** c2 bodylen = 0 *** c2 closing fd 21 ** c2 Ending ** top === varnish v1 -cliok "param.set pipe_timeout 500ms" **** v1 CLI TX|param.set pipe_timeout 500ms **** s1 fd=4 EOF, as expected ** s1 === accept **** s1 Accepting **** dT 7.941 **** l1 match| 1009 SessClose c RX_TIMEOUT 1.104 *** l1 test | expect 1009 * SessClose ^RX_TIMEOUT 1\\. **** dT 7.952 **** v1 vsl| 1011 Begin b bereq 1010 pipe **** v1 vsl| 1011 Timestamp b Start: 1788811101.296218 0.000000 0.000000 **** v1 vsl| 1011 BereqMethod b TMO **** v1 vsl| 1011 BereqURL b / **** v1 vsl| 1011 BereqProtocol b HTTP/1.1 **** v1 vsl| 1011 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1011 BereqHeader b User-Agent: c2 **** v1 vsl| 1011 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1011 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1011 BereqHeader b X-Varnish: 1010 **** v1 vsl| 1011 BereqHeader b Connection: close **** v1 vsl| 1011 Timestamp b Process: 1788811101.296227 0.000009 0.000009 **** v1 vsl| 1011 Timestamp b Connected: 1788811101.296303 0.000085 0.000076 **** v1 vsl| 1011 BackendOpen b 21 s1 127.0.0.1 37601 127.0.0.1 55816 connect **** v1 vsl| 1011 Timestamp b Bereq: 1788811101.296338 0.000120 0.000035 **** v1 vsl| 1011 BackendClose b 21 s1 close RX_TIMEOUT **** v1 vsl| 1011 BereqAcct b 0 0 0 0 0 0 **** v1 vsl| 1011 End b **** v1 vsl| 1010 Begin c req 1009 rxreq **** v1 vsl| 1010 Timestamp c Start: 1788811101.296165 0.000000 0.000000 **** v1 vsl| 1010 Timestamp c Req: 1788811101.296165 0.000000 0.000000 **** v1 vsl| 1010 VCL_use c vcl1 **** v1 vsl| 1010 ReqStart c 127.0.0.1 36170 a0 **** v1 vsl| 1010 ReqMethod c TMO **** v1 vsl| 1010 ReqURL c / **** v1 vsl| 1010 ReqProtocol c HTTP/1.1 **** v1 vsl| 1010 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1010 ReqHeader c User-Agent: c2 **** v1 vsl| 1010 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1010 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1010 VCL_call c RECV **** v1 vsl| 1010 VCL_return c pipe **** v1 vsl| 1010 VCL_call c HASH **** v1 vsl| 1010 VCL_return c lookup **** v1 vsl| 1010 Link c bereq 1011 pipe **** v1 vsl| 1010 VCL_call c PIPE **** v1 vsl| 1010 VCL_return c pipe **** v1 vsl| 1010 Timestamp c Process: 1788811101.296227 0.000061 0.000061 **** v1 vsl| 1010 Timestamp c Pipe: 1788811101.296340 0.000174 0.000113 **** v1 vsl| 1010 Timestamp c PipeSess: 1788811102.399657 1.103491 1.103316 **** v1 vsl| 1010 PipeAcct c 51 142 0 96 **** v1 vsl| 1010 End c **** v1 vsl| 1009 SessClose c RX_TIMEOUT 1.104 **** v1 vsl| 1009 End c **** dT 7.988 *** v1 CLI RX 200 ** v1 CLI 200 ** top === varnish v1 -cliok "param.set pipe_task_deadline 1.1s" **** v1 CLI TX|param.set pipe_task_deadline 1.1s **** dT 8.036 *** v1 CLI RX 200 ** v1 CLI 200 ** top === client c1 -run ** c1 Starting client ** c1 Waiting for client ** c1 Started on 127.0.0.1:33069 (1 iterations) *** c1 Connect to 127.0.0.1:33069 *** c1 connected fd 21 from 127.0.0.1 36186 to 127.0.0.1:33069 ** c1 === non_fatal ** c1 === txreq -method PIPE **** c1 txreq|PIPE / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 8.038 *** s1 Accepted socket fd is 4 ** s1 === non_fatal ** s1 === rxreq **** dT 8.039 **** s1 rxhdr|PIPE / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|X-Varnish: 1013\r **** s1 rxhdr|Connection: close\r **** s1 rxhdr|\r **** s1 rxhdrlen = 143 **** s1 http[ 0] |PIPE **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |X-Varnish: 1013 **** s1 http[ 8] |Connection: close **** s1 bodylen = 0 ** s1 === txresp -hdr "transfer-encoding: chunked" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|transfer-encoding: chunked\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:22 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|\r ** s1 === loop 20 { **** s1 Loop #0 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|transfer-encoding: chunked\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:22 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|\r **** c1 rxhdrlen = 96 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |transfer-encoding: chunked **** c1 http[ 4] |Date: Mon, 07 Sep 2026 19:58:22 GMT **** c1 http[ 5] |Server: s1 **** c1 len|1\r **** c1 chunk|0 **** dT 8.052 **** v1 vsl| 1012 Begin c sess 0 HTTP/1 **** v1 vsl| 1012 SessOpen c 127.0.0.1 36186 a0 127.0.0.1 33069 1788811102.496172 20 **** v1 vsl| 1012 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:33069 **** v1 vsl| 1012 Link c req 1013 rxreq **** dT 8.139 **** s1 Loop #1 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 8.143 **** c1 len|1\r **** c1 chunk|0 **** dT 8.239 **** s1 Loop #2 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** c1 len|1\r **** c1 chunk|0 **** dT 8.339 **** s1 Loop #3 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** c1 len|1\r **** c1 chunk|0 **** dT 8.439 **** s1 Loop #4 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r **** dT 8.440 ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** c1 len|1\r **** c1 chunk|0 **** dT 8.540 **** s1 Loop #5 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 8.544 **** c1 len|1\r **** c1 chunk|0 **** dT 8.640 **** s1 Loop #6 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** c1 len|1\r **** c1 chunk|0 **** dT 8.740 **** s1 Loop #7 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 8.743 **** c1 len|1\r **** c1 chunk|0 **** dT 8.840 **** s1 Loop #8 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 8.862 **** c1 len|1\r **** c1 chunk|0 **** dT 8.940 **** s1 Loop #9 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 8.960 **** c1 len|1\r **** c1 chunk|0 **** dT 9.041 **** s1 Loop #10 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** c1 len|1\r **** c1 chunk|0 **** dT 9.140 **** c1 chunked|00000000000 **** c1 bodylen = 11 *** c1 closing fd 21 ** c1 Ending ** top === logexpect l1 -wait ** l1 Waiting for logexp **** dT 9.144 **** s1 Loop #11 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.147 **** l1 match| 1012 SessClose c RX_TIMEOUT 1.104 *** l1 test | expect 1012 * SessClose ^RX_TIMEOUT 1\\. **** dT 9.173 **** v1 vsl| 1014 Begin b bereq 1013 pipe **** v1 vsl| 1014 Timestamp b Start: 1788811102.496285 0.000000 0.000000 **** v1 vsl| 1014 BereqMethod b PIPE **** v1 vsl| 1014 BereqURL b / **** v1 vsl| 1014 BereqProtocol b HTTP/1.1 **** v1 vsl| 1014 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1014 BereqHeader b User-Agent: c1 **** v1 vsl| 1014 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1014 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1014 BereqHeader b X-Varnish: 1013 **** v1 vsl| 1014 BereqHeader b Connection: close **** v1 vsl| 1014 Timestamp b Process: 1788811102.496293 0.000008 0.000008 **** v1 vsl| 1014 Timestamp b Connected: 1788811102.496765 0.000479 0.000471 **** v1 vsl| 1014 BackendOpen b 21 s1 127.0.0.1 37601 127.0.0.1 55818 connect **** v1 vsl| 1014 Timestamp b Bereq: 1788811102.497000 0.000714 0.000235 **** v1 vsl| 1014 BackendClose b 21 s1 close RX_TIMEOUT **** v1 vsl| 1014 BereqAcct b 0 0 0 0 0 0 **** v1 vsl| 1014 End b **** v1 vsl| 1013 Begin c req 1012 rxreq **** v1 vsl| 1013 Timestamp c Start: 1788811102.496232 0.000000 0.000000 **** v1 vsl| 1013 Timestamp c Req: 1788811102.496232 0.000000 0.000000 **** v1 vsl| 1013 VCL_use c vcl1 **** v1 vsl| 1013 ReqStart c 127.0.0.1 36186 a0 **** v1 vsl| 1013 ReqMethod c PIPE **** v1 vsl| 1013 ReqURL c / **** v1 vsl| 1013 ReqProtocol c HTTP/1.1 **** v1 vsl| 1013 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1013 ReqHeader c User-Agent: c1 **** v1 vsl| 1013 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1013 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1013 VCL_call c RECV **** v1 vsl| 1013 VCL_return c pipe **** v1 vsl| 1013 VCL_call c HASH **** v1 vsl| 1013 VCL_return c lookup **** v1 vsl| 1013 Link c bereq 1014 pipe **** v1 vsl| 1013 VCL_call c PIPE **** v1 vsl| 1013 VCL_return c pipe **** v1 vsl| 1013 Timestamp c Process: 1788811102.496293 0.000061 0.000061 **** v1 vsl| 1013 Timestamp c Pipe: 1788811102.497003 0.000770 0.000709 **** v1 vsl| 1013 Timestamp c PipeSess: 1788811103.599623 1.103391 1.102620 **** v1 vsl| 1013 PipeAcct c 52 143 0 162 **** v1 vsl| 1013 End c **** v1 vsl| 1012 SessClose c RX_TIMEOUT 1.104 **** v1 vsl| 1012 End c **** dT 9.244 **** s1 Loop #12 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.344 **** s1 Loop #13 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.444 **** s1 Loop #14 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.544 **** s1 Loop #15 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.645 **** s1 Loop #16 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.745 **** s1 Loop #17 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.773 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811104 1.0 **** dT 9.845 **** s1 Loop #18 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 9.945 **** s1 Loop #19 ** s1 === chunkedlen 1 **** s1 chunked|1\r **** s1 chunked|0\r ** s1 === delay 0.1 *** s1 delaying 0.1 second(s) **** dT 10.045 *** s1 shutting fd 4 ** s1 Ending **** dT 12.808 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811107 1.0 **** dT 16.316 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811110 1.0 **** dT 19.325 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811113 1.0 **** dT 24.096 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811118 1.0 **** dT 27.089 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811121 1.0 **** dT 30.093 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811124 1.0 **** dT 34.536 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811128 1.0 **** dT 37.456 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811131 1.0 **** dT 42.436 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811134 1.0 **** dT 43.445 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811137 1.0 **** dT 46.456 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811140 1.0 **** dT 52.320 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811143 1.0 **** dT 52.520 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811146 1.0 **** dT 55.525 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811149 1.0 **** dT 58.512 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811152 1.0 # top TEST ./tests/s00013.vtc TIMED OUT (kill -9) # top TEST ./tests/s00013.vtc FAILED (60.103) signal=9 FAIL tests/s00013.vtc (exit status: 2) FAIL: tests/v00014 ================== **** dT 0.000 * top TEST ./tests/v00014.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:41359 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3704721.3a6c7f37 **** top macro def vtcid=vtc.3704721.3a6c7f37 ** top === varnishtest "Check req.backend.healthy" * top VTEST Check req.backend.healthy ** top === barrier b1 cond 2 ** top === barrier b2 cond 2 ** top === barrier b3 cond 2 ** top === barrier b4 cond 2 ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=33727 **** s1 macro def s1_sock=127.0.0.1:33727 * s1 Listen on 127.0.0.1:33727 ** top === varnish v1 -vcl { **** dT 0.003 ** s1 Started on 127.0.0.1:33727 (1 iterations) **** dT 0.018 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3704721.3a6c7f37/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 34933' -P /tmp/vtc.3704721.3a6c7f37/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3704721.3a6c7f37/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 34933' -P /tmp/vtc.3704721.3a6c7f37/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 PID: 3704916 **** v1 macro def v1_pid=3704916 **** v1 macro def v1_name=/tmp/vtc.3704721.3a6c7f37/v1 **** dT 0.054 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.154 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 6 *** v1 CLI RX 107 **** v1 CLI RX|vrbbosksgtrfmuynrrhuyemqvnlugohv **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** v1 CLI TX|auth 7e7499c1e8ec3c34444d36b7c7f4339b7044157b0c0374033a4931efbf0989a4 **** dT 0.155 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX| **** v1 CLI TX| **** v1 CLI TX|\timport std; **** v1 CLI TX| **** v1 CLI TX|\tprobe foo { **** v1 CLI TX|\t\t.url = "/"; **** v1 CLI TX|\t\t.timeout = 2s; **** v1 CLI TX|\t\t.interval = 2s; **** v1 CLI TX|\t\t.window = 3; **** v1 CLI TX|\t\t.threshold = 2; **** v1 CLI TX|\t\t.initial = 0; **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|\tbackend default { **** v1 CLI TX|\t\t.host = "127.0.0.1"; **** v1 CLI TX|\t\t.port = "33727"; **** v1 CLI TX|\t\t.max_connections = 1; **** v1 CLI TX|\t\t.probe = foo; **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_recv { **** v1 CLI TX|\t\tif (std.healthy(default)) { **** v1 CLI TX|\t\t\treturn(synth(200,"Backend healthy " + req.url)); **** v1 CLI TX|\t\t} else { **** v1 CLI TX|\t\t\treturn(synth(500,"Backend sick " + req.url)); **** v1 CLI TX|\t\t} **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.258 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.358 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.461 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.561 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.661 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.761 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.862 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.962 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.062 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.164 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.264 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.364 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.464 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.565 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.665 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.739 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 **** dT 1.743 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 1.765 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.794 *** v1 debug|Debug: Child (3707444) Started **** dT 1.838 *** v1 debug|Child launched OK **** dT 1.839 *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status *** v1 debug|Info: Child (3707444) said Child starts *** s1 accepted fd 4 127.0.0.1 56724 ** s1 === rxreq *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** s1 rxhdr|GET / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|Connection: close\r **** s1 rxhdr|\r **** s1 rxhdrlen = 54 **** s1 http[ 0] |GET **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |Connection: close **** s1 bodylen = 0 ** s1 === barrier b1 sync **** s1 Barrier(b1) wait 1 of 2 **** dT 1.865 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811104.931465/vgc.so 1auto **** v1 vsl| 0 Backend_health - default Went sick -------- 0 2 3 0.000000 0.000000 "" **** v1 vsl| 0 Backend_health - default Still sick -------- 0 2 3 0.000000 0.000000 "" **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811104.931465/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:45847 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:45847 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:45847 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:45847 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:45847 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:45847 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:45847 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:45847 **** v1 vsl| 0 CLI - Wr 200 0 **** dT 1.884 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 45847 **** v1 CLI TX|debug.xid 1000 **** dT 1.931 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 1.967 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 45847 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** dT 1.980 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 45847 ** v1 Listen on 127.0.0.1 45847 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=45847 **** v1 macro def v1_sock=127.0.0.1:45847 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=45847 **** v1 macro def v1_a0_sock=127.0.0.1:45847 ** top === varnish v1 -cliok "backend.list -p" **** v1 CLI TX|backend.list -p **** dT 2.026 *** v1 CLI RX 200 **** v1 CLI RX|Backend name Admin Probe Health Last change **** v1 CLI RX|vcl1.default probe 0/3 sick Mon, 07 Sep 2026 19:58:26 GMT **** v1 CLI RX| Current states good: 0 threshold: 2 window: 3 **** v1 CLI RX| Average response time of good probes: 0.000000 **** v1 CLI RX| Oldest ================================================== Newest **** v1 CLI RX| ---------------------------------------------------------------4 Good IPv4 **** v1 CLI RX| ---------------------------------------------------------------X Good Xmit **** v1 CLI RX| ---------------------------------------------------------------- Happy **** v1 CLI RX| ** v1 CLI 200 ** top === varnish v1 -clijson "backend.list -j -p" **** v1 CLI TX|backend.list -j -p **** dT 2.068 *** v1 CLI RX 200 **** v1 CLI RX|[ 3, ["backend.list", "-j", "-p"], 1788811106.844, **** v1 CLI RX| { **** v1 CLI RX| "vcl1.default": { **** v1 CLI RX| "type": "backend", **** v1 CLI RX| "admin_health": "probe", **** v1 CLI RX| "probe_message": [0, 3, "sick"], **** v1 CLI RX| "probe_details": { **** v1 CLI RX| "bits_4": 1, **** v1 CLI RX| "bits_6": 0, **** v1 CLI RX| "bits_U": 0, **** v1 CLI RX| "bits_x": 0, **** v1 CLI RX| "bits_X": 1, **** v1 CLI RX| "bits_r": 0, **** v1 CLI RX| "bits_R": 0, **** v1 CLI RX| "bits_H": 0, **** v1 CLI RX| "good": 0, **** v1 CLI RX| "threshold": 2, **** v1 CLI RX| "window": 3 **** v1 CLI RX| }, **** v1 CLI RX| "ipv4": "127.0.0.1", **** v1 CLI RX| "last_change": 1788811106.614 **** v1 CLI RX| } **** v1 CLI RX| } **** v1 CLI RX|] ** v1 CLI 200 ** top === client c1 { ** c1 Starting client ** c1 Waiting for client ** c1 Started on 127.0.0.1:45847 (1 iterations) *** c1 Connect to 127.0.0.1:45847 *** c1 connected fd 16 from 127.0.0.1 57740 to 127.0.0.1:45847 ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 2.070 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 45847 **** v1 vsl| 0 CLI - Rd backend.list -p **** v1 vsl| 0 CLI - Wr 200 517 Backend name Admin Probe Health Last change vcl1.default probe 0/3 sick Mon, 07 Sep 2026 19:58:26 GMT Current states good: 0 threshold: 2 window: 3 Average response time of good probes: 0.000000 Oldest ============ **** v1 vsl| 0 CLI - Rd backend.list -j -p **** v1 vsl| 0 CLI - Wr 200 512 [ 3, ["backend.list", "-j", "-p"], 1788811106.844, { "vcl1.default": { "type": "backend", "admin_health": "probe", "probe_message": [0, 3, "sick"], "probe_details": { "bits_4": 1, "bits_6": 0, **** dT 2.076 **** c1 rxhdr|HTTP/1.1 500 Backend sick /\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:26 GMT\r **** c1 rxhdr|Server: Varnish\r **** c1 rxhdr|X-Varnish: 1001\r **** c1 rxhdr|Content-Type: text/html; charset=utf-8\r **** c1 rxhdr|Retry-After: 5\r **** c1 rxhdr|Content-Length: 263\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 203 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |500 **** c1 http[ 2] |Backend sick / **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:58:26 GMT **** c1 http[ 4] |Server: Varnish **** c1 http[ 5] |X-Varnish: 1001 **** c1 http[ 6] |Content-Type: text/html; charset=utf-8 **** c1 http[ 7] |Retry-After: 5 **** c1 http[ 8] |Content-Length: 263 **** c1 http[ 9] |Connection: keep-alive **** c1 c-l| **** c1 c-l| **** c1 c-l| **** c1 c-l| 500 Backend sick / **** c1 c-l| **** c1 c-l| **** c1 c-l|

Error 500 Backend sick /

**** c1 c-l|

Backend sick /

**** c1 c-l|

Guru Meditation:

**** c1 c-l|

XID: 1001

**** c1 c-l|
**** c1 c-l|

Varnish cache server

**** c1 c-l| **** c1 c-l| **** c1 bodylen = 263 ** c1 === expect resp.status == 500 **** c1 EXPECT resp.status (500) == "500" match ** c1 === barrier b1 sync **** c1 Barrier(b1) wake 2 ** c1 === barrier b2 sync **** c1 Barrier(b2) wait 1 of 2 **** dT 2.078 ** s1 === expect req.url == "/" **** s1 EXPECT req.url (/) == "/" match ** s1 === txresp -body "slash" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:26 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 5\r **** s1 txresp|\r **** s1 txresp|slash ** s1 === accept **** s1 Accepting **** dT 2.170 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 57740 a0 127.0.0.1 45847 1788811106.848239 20 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:45847 **** v1 vsl| 1000 Link c req 1001 rxreq **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811106.848322 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811106.848322 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 57740 a0 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c / **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c synth **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 500 **** v1 vsl| 1001 RespReason c Backend sick / **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:58:26 GMT **** v1 vsl| 1001 RespHeader c Server: Varnish **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 VCL_call c SYNTH **** v1 vsl| 1001 RespHeader c Content-Type: text/html; charset=utf-8 **** v1 vsl| 1001 RespHeader c Retry-After: 5 **** v1 vsl| 1001 VCL_return c deliver **** v1 vsl| 1001 Timestamp c Process: 1788811106.848537 0.000214 0.000214 **** v1 vsl| 1001 RespHeader c Content-Length: 263 **** v1 vsl| 1001 Storage c malloc Transient **** v1 vsl| 1001 Filters c **** v1 vsl| 1001 RespHeader c Connection: keep-alive **** v1 vsl| 1001 Timestamp c Resp: 1788811106.848688 0.000365 0.000151 **** v1 vsl| 1001 ReqAcct c 51 0 51 203 263 466 **** v1 vsl| 1001 End c **** v1 vsl| 0 Backend_health - default Still sick 4---X-RH 1 2 3 0.239421 0.239421 "HTTP/1.1 200 OK" **** dT 4.112 *** s1 Accepted socket fd is 4 ** s1 === rxreq **** s1 rxhdr|GET / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|Connection: close\r **** s1 rxhdr|\r **** s1 rxhdrlen = 54 **** s1 http[ 0] |GET **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |Connection: close **** s1 bodylen = 0 ** s1 === barrier b2 sync **** s1 Barrier(b2) wake 2 ** s1 === barrier b3 sync **** s1 Barrier(b3) wait 1 of 2 **** dT 5.928 ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 5.944 **** c1 rxhdr|HTTP/1.1 500 Backend sick /\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:30 GMT\r **** c1 rxhdr|Server: Varnish\r **** c1 rxhdr|X-Varnish: 1002\r **** c1 rxhdr|Content-Type: text/html; charset=utf-8\r **** c1 rxhdr|Retry-After: 5\r **** c1 rxhdr|Content-Length: 263\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 203 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |500 **** c1 http[ 2] |Backend sick / **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:58:30 GMT **** c1 http[ 4] |Server: Varnish **** c1 http[ 5] |X-Varnish: 1002 **** c1 http[ 6] |Content-Type: text/html; charset=utf-8 **** c1 http[ 7] |Retry-After: 5 **** c1 http[ 8] |Content-Length: 263 **** c1 http[ 9] |Connection: keep-alive **** c1 c-l| **** c1 c-l| **** c1 c-l| **** c1 c-l| 500 Backend sick / **** c1 c-l| **** c1 c-l| **** c1 c-l|

Error 500 Backend sick /

**** c1 c-l|

Backend sick /

**** c1 c-l|

Guru Meditation:

**** c1 c-l|

XID: 1002

**** c1 c-l|
**** c1 c-l|

Varnish cache server

**** c1 c-l| **** c1 c-l| **** c1 bodylen = 263 ** c1 === expect resp.status == 500 **** c1 EXPECT resp.status (500) == "500" match ** c1 === barrier b3 sync **** c1 Barrier(b3) wake 2 ** c1 === barrier b4 sync **** c1 Barrier(b4) wait 1 of 2 ** s1 === expect req.url == "/" **** s1 EXPECT req.url (/) == "/" match ** s1 === txresp -body "slash" **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:30 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 5\r **** s1 txresp|\r **** s1 txresp|slash ** s1 === accept **** s1 Accepting **** dT 6.000 **** v1 vsl| 1000 Link c req 1002 rxreq **** v1 vsl| 1002 Begin c req 1000 rxreq **** v1 vsl| 1002 Timestamp c Start: 1788811110.719709 0.000000 0.000000 **** v1 vsl| 1002 Timestamp c Req: 1788811110.719709 0.000000 0.000000 **** v1 vsl| 1002 VCL_use c vcl1 **** v1 vsl| 1002 ReqStart c 127.0.0.1 57740 a0 **** v1 vsl| 1002 ReqMethod c GET **** v1 vsl| 1002 ReqURL c / **** v1 vsl| 1002 ReqProtocol c HTTP/1.1 **** v1 vsl| 1002 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1002 ReqHeader c User-Agent: c1 **** v1 vsl| 1002 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 VCL_call c RECV **** v1 vsl| 1002 VCL_return c synth **** v1 vsl| 1002 VCL_call c HASH **** v1 vsl| 1002 VCL_return c lookup **** v1 vsl| 1002 RespProtocol c HTTP/1.1 **** v1 vsl| 1002 RespStatus c 500 **** v1 vsl| 1002 RespReason c Backend sick / **** v1 vsl| 1002 RespHeader c Date: Mon, 07 Sep 2026 19:58:30 GMT **** v1 vsl| 1002 RespHeader c Server: Varnish **** v1 vsl| 1002 RespHeader c X-Varnish: 1002 **** v1 vsl| 1002 VCL_call c SYNTH **** v1 vsl| 1002 RespHeader c Content-Type: text/html; charset=utf-8 **** v1 vsl| 1002 RespHeader c Retry-After: 5 **** v1 vsl| 1002 VCL_return c deliver **** v1 vsl| 1002 Timestamp c Process: 1788811110.719796 0.000086 0.000086 **** v1 vsl| 1002 RespHeader c Content-Length: 263 **** v1 vsl| 1002 Storage c malloc Transient **** v1 vsl| 1002 Filters c **** v1 vsl| 1002 RespHeader c Connection: keep-alive **** v1 vsl| 1002 Timestamp c Resp: 1788811110.719916 0.000206 0.000120 **** v1 vsl| 1002 ReqAcct c 51 0 51 203 263 466 **** v1 vsl| 1002 End c **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811110 1.0 **** dT 6.200 **** v1 vsl| 0 Backend_health - default Still sick 4---Xr-- 1 2 3 0.000000 0.239421 "Poll timeout 2.000s exceeded by 0.032s" **** dT 8.144 *** s1 Accepted socket fd is 4 ** s1 === barrier b4 sync **** s1 Barrier(b4) wake 2 *** s1 shutting fd 4 ** s1 Ending ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 8.148 **** c1 rxhdr|HTTP/1.1 500 Backend sick /\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:32 GMT\r **** c1 rxhdr|Server: Varnish\r **** c1 rxhdr|X-Varnish: 1003\r **** c1 rxhdr|Content-Type: text/html; charset=utf-8\r **** c1 rxhdr|Retry-After: 5\r **** c1 rxhdr|Content-Length: 263\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 203 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |500 **** c1 http[ 2] |Backend sick / **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:58:32 GMT **** c1 http[ 4] |Server: Varnish **** c1 http[ 5] |X-Varnish: 1003 **** c1 http[ 6] |Content-Type: text/html; charset=utf-8 **** c1 http[ 7] |Retry-After: 5 **** c1 http[ 8] |Content-Length: 263 **** c1 http[ 9] |Connection: keep-alive **** c1 c-l| **** c1 c-l| **** c1 c-l| **** c1 c-l| 500 Backend sick / **** c1 c-l| **** c1 c-l| **** c1 c-l|

Error 500 Backend sick /

**** c1 c-l|

Backend sick /

**** c1 c-l|

Guru Meditation:

**** c1 c-l|

XID: 1003

**** c1 c-l|
**** c1 c-l|

Varnish cache server

**** c1 c-l| **** c1 c-l| **** c1 bodylen = 263 ** c1 === expect resp.status == 200 ---- c1 EXPECT resp.status (500) == "200" failed **** dT 8.149 * top RESETTING after ./tests/v00014.vtc ** s1 Waiting for server (3/-1) ** v1 Wait **** v1 CLI TX|panic.show **** dT 8.192 *** v1 CLI RX 300 **** v1 CLI RX|Child has not panicked or panic has been cleared *** v1 debug|Info: manager stopping child *** v1 debug|Debug: Stopping Child **** dT 8.204 **** v1 vsl| 0 Backend_health - default Still sick 4---X--- 1 2 3 0.000000 0.239421 "Empty response" **** v1 vsl| 1000 Link c req 1003 rxreq **** v1 vsl| 1003 Begin c req 1000 rxreq **** v1 vsl| 1003 Timestamp c Start: 1788811112.923661 0.000000 0.000000 **** v1 vsl| 1003 Timestamp c Req: 1788811112.923661 0.000000 0.000000 **** v1 vsl| 1003 VCL_use c vcl1 **** v1 vsl| 1003 ReqStart c 127.0.0.1 57740 a0 **** v1 vsl| 1003 ReqMethod c GET **** v1 vsl| 1003 ReqURL c / **** v1 vsl| 1003 ReqProtocol c HTTP/1.1 **** v1 vsl| 1003 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c User-Agent: c1 **** v1 vsl| 1003 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1003 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1003 VCL_call c RECV **** v1 vsl| 1003 VCL_return c synth **** v1 vsl| 1003 VCL_call c HASH **** v1 vsl| 1003 VCL_return c lookup **** v1 vsl| 1003 RespProtocol c HTTP/1.1 **** v1 vsl| 1003 RespStatus c 500 **** v1 vsl| 1003 RespReason c Backend sick / **** v1 vsl| 1003 RespHeader c Date: Mon, 07 Sep 2026 19:58:32 GMT **** v1 vsl| 1003 RespHeader c Server: Varnish **** v1 vsl| 1003 RespHeader c X-Varnish: 1003 **** v1 vsl| 1003 VCL_call c SYNTH **** v1 vsl| 1003 RespHeader c Content-Type: text/html; charset=utf-8 **** v1 vsl| 1003 RespHeader c Retry-After: 5 **** v1 vsl| 1003 VCL_return c deliver **** v1 vsl| 1003 Timestamp c Process: 1788811112.923977 0.000316 0.000316 **** v1 vsl| 1003 RespHeader c Content-Length: 263 **** v1 vsl| 1003 Storage c malloc Transient **** v1 vsl| 1003 Filters c **** v1 vsl| 1003 RespHeader c Connection: keep-alive **** v1 vsl| 1003 Timestamp c Resp: 1788811112.924103 0.000441 0.000125 **** v1 vsl| 1003 ReqAcct c 51 0 51 203 263 466 **** v1 vsl| 1003 End c **** v1 vsl| 0 CLI - EOF on CLI connection, worker stops **** dT 8.293 *** v1 debug|Info: Child (3707444) said Child dies *** v1 debug|Info: Child (3707444) ended *** v1 debug|Debug: Child cleanup complete *** v1 debug|Info: manager dies **** dT 8.295 **** v1 STDOUT EOF **** dT 8.304 ** v1 WAIT4 pid=3704916 status=0x0000 (user 0.779570 sys 0.077568) * top TEST ./tests/v00014.vtc FAILED # top TEST ./tests/v00014.vtc FAILED (8.309) exit=2 FAIL tests/v00014.vtc (exit status: 2) SKIP: tests/v00022 ================== **** dT 0.000 * top TEST ./tests/v00022.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:46633 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3707164.38f1ab8a **** top macro def vtcid=vtc.3707164.38f1ab8a **** dT 0.003 ** top === varnishtest "Various VCL compiler coverage tests - DNS depen... * top VTEST Various VCL compiler coverage tests - DNS dependent ** top === feature dns * top SKIPPING test, lacking feature: dns * top RESETTING after ./tests/v00022.vtc * top TEST ./tests/v00022.vtc completed # top TEST ./tests/v00022.vtc skipped (0.104) SKIP tests/v00022.vtc (exit status: 77) FAIL: tests/v00072 ================== **** dT 0.000 * top TEST ./tests/v00072.vtc starting **** top extmacro def pkg_version=7.7.0 **** top extmacro def pkg_branch=7.7 **** top extmacro def pwd=/build/reproducible-path/varnish-7.7.0/bin/varnishtest **** top extmacro def date(...) **** top extmacro def string(...) **** top extmacro def localhost=127.0.0.1 **** top extmacro def bad_backend=127.0.0.1:38845 **** top extmacro def listen_addr=127.0.0.1:0 **** top extmacro def bad_ip=192.0.2.255 **** top extmacro def topbuild=/build/reproducible-path/varnish-7.7.0 **** top extmacro def topsrc=/build/reproducible-path/varnish-7.7.0 **** top macro def testdir=/build/reproducible-path/varnish-7.7.0/bin/varnishtest/./tests **** top macro def tmpdir=/tmp/vtc.3712298.4795f98f **** top macro def vtcid=vtc.3712298.4795f98f ** top === varnishtest "Check backend wait limit" * top VTEST Check backend wait limit ** top === barrier b1 cond 2 ** top === server s1 { ** s1 Starting server **** s1 macro def s1_addr=127.0.0.1 **** s1 macro def s1_port=40159 **** s1 macro def s1_sock=127.0.0.1:40159 * s1 Listen on 127.0.0.1:40159 ** top === varnish v1 -vcl { **** dT 0.004 ** s1 Started on 127.0.0.1:40159 (1 iterations) **** dT 0.011 ** v1 Launch *** v1 CMD: cd ${pwd} && exec varnishd -d -n /tmp/vtc.3712298.4795f98f/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 37165' -P /tmp/vtc.3712298.4795f98f/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 CMD: cd /build/reproducible-path/varnish-7.7.0/bin/varnishtest && exec varnishd -d -n /tmp/vtc.3712298.4795f98f/v1 -i v1 -l 2m -p auto_restart=off -p syslog_cli_traffic=off -p thread_pool_min=10 -p debug=+vtc_mode -p vsl_mask=+Debug,+H2RxHdr,+H2RxBody -p h2_initial_window_size=1m -p h2_rx_window_low_water=64k -a '127.0.0.1:0' -M '127.0.0.1 37165' -P /tmp/vtc.3712298.4795f98f/v1/varnishd.pid -p vmod_path=/build/reproducible-path/varnish-7.7.0/vmod/.libs *** v1 PID: 3712474 **** v1 macro def v1_pid=3712474 **** v1 macro def v1_name=/tmp/vtc.3712298.4795f98f/v1 **** dT 0.044 *** v1 debug|Debug: Version: varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug|Debug: Platform: Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|200 320 *** v1 debug|----------------------------- *** v1 debug|Varnish Cache CLI 1.0 *** v1 debug|----------------------------- *** v1 debug|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit *** v1 debug|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 *** v1 debug| *** v1 debug|Type 'help' for command list. *** v1 debug|Type 'quit' to close CLI session. *** v1 debug|Type 'start' to launch worker process. *** v1 debug| **** dT 0.144 **** v1 CLIPOLL 1 0x1 0x0 0x0 *** v1 CLI connection fd = 6 *** v1 CLI RX 107 **** v1 CLI RX|nnjkqggksbthxamkwusrvhbmedsbnimr **** v1 CLI RX| **** v1 CLI RX|Authentication required. **** v1 CLI TX|auth 1f910d9bfe39c34b78366c16f330079710397ab50afe045b9dc69417451ad8d4 **** dT 0.145 *** v1 CLI RX 200 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Varnish Cache CLI 1.0 **** v1 CLI RX|----------------------------- **** v1 CLI RX|Linux,6.12.33+deb12-amd64,x86_64,-jnone,-sdefault,-sdefault,-hcritbit **** v1 CLI RX|varnish-7.7.0 revision 71fc9d211c471106e4be590f3816a56ba156a833 **** v1 CLI RX| **** v1 CLI RX|Type 'help' for command list. **** v1 CLI RX|Type 'quit' to close CLI session. **** v1 CLI RX|Type 'start' to launch worker process. **** v1 CLI TX|vcl.inline vcl1 << %XJEIFLH|)Xspa8P **** v1 CLI TX|vcl 4.1; **** v1 CLI TX| **** v1 CLI TX|\tbackend s1 { **** v1 CLI TX|\t\t.host = "127.0.0.1"; **** v1 CLI TX|\t\t.port = "40159"; **** v1 CLI TX|\t\t.max_connections = 1; **** v1 CLI TX|\t\t.connect_timeout = 2s; **** v1 CLI TX|\t\t.wait_timeout = 1s; # longer than the s1 'delay 0.2' **** v1 CLI TX|\t\t.wait_limit = 1; **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|\tsub vcl_recv { **** v1 CLI TX|\t\treturn(pass); **** v1 CLI TX|\t} **** v1 CLI TX| **** v1 CLI TX|%XJEIFLH|)Xspa8P **** dT 0.248 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.348 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.448 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.548 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.652 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.752 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.852 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 0.953 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.054 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.154 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.254 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.354 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.454 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.524 *** v1 CLI RX 200 **** v1 CLI RX|VCL compiled. **** v1 CLI TX|vcl.use vcl1 *** v1 CLI RX 200 **** v1 CLI RX|VCL 'vcl1' now active ** v1 Start **** v1 CLI TX|start **** dT 1.554 *** v1 vsl|No VSL chunk found (child not started ?) **** dT 1.584 *** v1 debug|Debug: Child (3714249) Started **** dT 1.619 *** v1 debug|Child launched OK **** dT 1.625 *** v1 CLI RX 200 *** v1 wait-running **** v1 CLI TX|status *** v1 debug|Info: Child (3714249) said Child starts *** v1 CLI RX 200 **** v1 CLI RX|Child in state running **** v1 CLI TX|debug.listen_address **** dT 1.655 **** v1 vsl| 0 CLI - Rd vcl.load "vcl1" vcl_vcl1.1788811114.592965/vgc.so 1auto **** v1 vsl| 0 CLI - Wr 200 52 Loaded "vcl_vcl1.1788811114.592965/vgc.so" as "vcl1" **** v1 vsl| 0 CLI - Rd vcl.use "vcl1" **** v1 vsl| 0 CLI - Wr 200 0 **** v1 vsl| 0 CLI - Rd start **** v1 vsl| 0 Debug - sockopt: Setting SO_LINGER for a0=127.0.0.1:44083 **** v1 vsl| 0 Debug - sockopt: Setting SO_KEEPALIVE for a0=127.0.0.1:44083 **** v1 vsl| 0 Debug - sockopt: Setting SO_SNDTIMEO for a0=127.0.0.1:44083 **** v1 vsl| 0 Debug - sockopt: Setting SO_RCVTIMEO for a0=127.0.0.1:44083 **** v1 vsl| 0 Debug - sockopt: Setting TCP_NODELAY for a0=127.0.0.1:44083 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPIDLE for a0=127.0.0.1:44083 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPCNT for a0=127.0.0.1:44083 **** v1 vsl| 0 Debug - sockopt: Setting TCP_KEEPINTVL for a0=127.0.0.1:44083 **** v1 vsl| 0 CLI - Wr 200 0 **** dT 1.755 **** v1 vsl| 0 CLI - Rd debug.listen_address **** dT 4.768 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 44083 **** v1 CLI TX|debug.xid 1000 **** dT 4.769 *** v1 CLI RX 200 **** v1 CLI RX|XID is 1000 chunk 1 **** v1 CLI TX|debug.listen_address **** dT 4.820 *** v1 CLI RX 200 **** v1 CLI RX|a0 127.0.0.1 44083 ** v1 Listen on 127.0.0.1 44083 **** v1 macro def v1_addr=127.0.0.1 **** v1 macro def v1_port=44083 **** v1 macro def v1_sock=127.0.0.1:44083 **** v1 macro def v1_a0_addr=127.0.0.1 **** v1 macro def v1_a0_port=44083 **** v1 macro def v1_a0_sock=127.0.0.1:44083 ** top === client c1 -connect ${v1_sock} { ** c1 Starting client ** top === client c2 -connect ${v1_sock} { ** c2 Starting client ** c2 Waiting for client ** c1 Started on 127.0.0.1:44083 (1 iterations) *** c1 Connect to 127.0.0.1:44083 **** dT 4.821 ** c2 Started on 127.0.0.1:44083 (1 iterations) *** c2 Connect to 127.0.0.1:44083 **** dT 5.369 *** c2 connected fd 17 from 127.0.0.1 35328 to 127.0.0.1:44083 ** c2 === barrier b1 sync **** c2 Barrier(b1) wait 1 of 2 *** c1 connected fd 16 from 127.0.0.1 35330 to 127.0.0.1:44083 ** c1 === txreq **** c1 txreq|GET / HTTP/1.1\r **** c1 txreq|Host: 127.0.0.1\r **** c1 txreq|User-Agent: c1\r **** c1 txreq|\r ** c1 === rxresp **** dT 5.370 *** s1 accepted fd 4 127.0.0.1 45036 ** s1 === rxreq **** s1 rxhdr|GET / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c1\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|X-Varnish: 1002\r **** s1 rxhdr|\r **** s1 rxhdrlen = 123 **** s1 http[ 0] |GET **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c1 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |X-Varnish: 1002 **** s1 bodylen = 0 ** s1 === barrier b1 sync **** s1 Barrier(b1) wake 2 ** s1 === delay 0.2 *** s1 delaying 0.2 second(s) ** c2 === txreq **** c2 txreq|GET / HTTP/1.1\r **** c2 txreq|Host: 127.0.0.1\r **** c2 txreq|User-Agent: c2\r **** c2 txreq|\r ** c2 === rxresp **** dT 5.384 **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 44083 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811119 1.0 **** v1 vsl| 0 CLI - Rd debug.xid 1000 **** v1 vsl| 0 CLI - Wr 200 19 XID is 1000 chunk 1 **** v1 vsl| 0 CLI - Rd debug.listen_address **** v1 vsl| 0 CLI - Wr 200 19 a0 127.0.0.1 44083 **** v1 vsl| 1000 Begin c sess 0 HTTP/1 **** v1 vsl| 1000 SessOpen c 127.0.0.1 35330 a0 127.0.0.1 44083 1788811119.816644 20 **** v1 vsl| 1000 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1000 Link c req 1001 rxreq **** dT 5.570 ** s1 === txresp **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:40 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r ** s1 === rxreq **** dT 5.583 **** c1 rxhdr|HTTP/1.1 200 OK\r **** c1 rxhdr|Date: Mon, 07 Sep 2026 19:58:40 GMT\r **** c1 rxhdr|Server: s1\r **** c1 rxhdr|Content-Length: 0\r **** c1 rxhdr|X-Varnish: 1001\r **** c1 rxhdr|Age: 0\r **** c1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c1 rxhdr|Connection: keep-alive\r **** c1 rxhdr|\r **** c1 rxhdrlen = 163 **** c1 http[ 0] |HTTP/1.1 **** c1 http[ 1] |200 **** c1 http[ 2] |OK **** c1 http[ 3] |Date: Mon, 07 Sep 2026 19:58:40 GMT **** c1 http[ 4] |Server: s1 **** c1 http[ 5] |Content-Length: 0 **** c1 http[ 6] |X-Varnish: 1001 **** c1 http[ 7] |Age: 0 **** c1 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c1 http[ 9] |Connection: keep-alive **** c1 bodylen = 0 ** c1 === expect resp.status == 200 **** c1 EXPECT resp.status (200) == "200" match *** c1 closing fd 16 **** dT 5.584 ** c1 Ending **** dT 5.648 **** s1 rxhdr|GET / HTTP/1.1\r **** s1 rxhdr|Host: 127.0.0.1\r **** s1 rxhdr|User-Agent: c2\r **** s1 rxhdr|X-Forwarded-For: 127.0.0.1\r **** s1 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** s1 rxhdr|X-Varnish: 1005\r **** s1 rxhdr|\r **** s1 rxhdrlen = 123 **** s1 http[ 0] |GET **** s1 http[ 1] |/ **** s1 http[ 2] |HTTP/1.1 **** s1 http[ 3] |Host: 127.0.0.1 **** s1 http[ 4] |User-Agent: c2 **** s1 http[ 5] |X-Forwarded-For: 127.0.0.1 **** s1 http[ 6] |Via: 1.1 v1 (Varnish/7.7) **** s1 http[ 7] |X-Varnish: 1005 **** s1 bodylen = 0 ** s1 === txresp **** s1 txresp|HTTP/1.1 200 OK\r **** s1 txresp|Date: Mon, 07 Sep 2026 19:58:40 GMT\r **** s1 txresp|Server: s1\r **** s1 txresp|Content-Length: 0\r **** s1 txresp|\r *** s1 shutting fd 4 ** s1 Ending **** dT 5.656 **** v1 vsl| 1002 Begin b bereq 1001 pass **** v1 vsl| 1002 VCL_use b vcl1 **** v1 vsl| 1002 Timestamp b Start: 1788811119.816831 0.000000 0.000000 **** v1 vsl| 1002 BereqMethod b GET **** v1 vsl| 1002 BereqURL b / **** v1 vsl| 1002 BereqProtocol b HTTP/1.1 **** v1 vsl| 1002 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b User-Agent: c1 **** v1 vsl| 1002 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1002 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1002 BereqHeader b X-Varnish: 1002 **** v1 vsl| 1002 VCL_call b BACKEND_FETCH **** v1 vsl| 1002 VCL_return b fetch **** v1 vsl| 1002 Timestamp b Fetch: 1788811119.816856 0.000024 0.000024 **** v1 vsl| 1002 Timestamp b Connected: 1788811119.817122 0.000290 0.000265 **** v1 vsl| 1002 BackendOpen b 22 s1 127.0.0.1 40159 127.0.0.1 45036 connect **** v1 vsl| 1002 Timestamp b Bereq: 1788811119.817345 0.000513 0.000223 **** v1 vsl| 1002 BerespProtocol b HTTP/1.1 **** v1 vsl| 1002 BerespStatus b 200 **** v1 vsl| 1002 BerespReason b OK **** v1 vsl| 1002 BerespHeader b Date: Mon, 07 Sep 2026 19:58:40 GMT **** v1 vsl| 1002 BerespHeader b Server: s1 **** v1 vsl| 1002 BerespHeader b Content-Length: 0 **** v1 vsl| 1002 Timestamp b Beresp: 1788811120.018052 0.201220 0.200706 **** v1 vsl| 1002 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1002 VCL_return b deliver **** v1 vsl| 1002 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1002 Timestamp b Process: 1788811120.018080 0.201248 0.000028 **** v1 vsl| 1002 Filters b **** v1 vsl| 1002 Storage b malloc Transient **** v1 vsl| 1002 Fetch_Body b 0 none - **** v1 vsl| 1002 BackendClose b 22 s1 recycle **** v1 vsl| 1002 Timestamp b BerespBody: 1788811120.028284 0.211452 0.010203 **** v1 vsl| 1002 Length b 0 **** v1 vsl| 1002 BereqAcct b 123 0 123 87 0 87 **** v1 vsl| 1002 End b **** v1 vsl| 1001 Begin c req 1000 rxreq **** v1 vsl| 1001 Timestamp c Start: 1788811119.816715 0.000000 0.000000 **** v1 vsl| 1001 Timestamp c Req: 1788811119.816715 0.000000 0.000000 **** v1 vsl| 1001 VCL_use c vcl1 **** v1 vsl| 1001 ReqStart c 127.0.0.1 35330 a0 **** v1 vsl| 1001 ReqMethod c GET **** v1 vsl| 1001 ReqURL c / **** v1 vsl| 1001 ReqProtocol c HTTP/1.1 **** v1 vsl| 1001 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c User-Agent: c1 **** v1 vsl| 1001 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1001 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c RECV **** v1 vsl| 1001 VCL_return c pass **** v1 vsl| 1001 VCL_call c HASH **** v1 vsl| 1001 VCL_return c lookup **** v1 vsl| 1001 VCL_call c PASS **** v1 vsl| 1001 VCL_return c fetch **** v1 vsl| 1001 Link c bereq 1002 pass **** v1 vsl| 1001 Timestamp c Fetch: 1788811120.028410 0.211694 0.211694 **** v1 vsl| 1001 RespProtocol c HTTP/1.1 **** v1 vsl| 1001 RespStatus c 200 **** v1 vsl| 1001 RespReason c OK **** v1 vsl| 1001 RespHeader c Date: Mon, 07 Sep 2026 19:58:40 GMT **** v1 vsl| 1001 RespHeader c Server: s1 **** v1 vsl| 1001 RespHeader c Content-Length: 0 **** v1 vsl| 1001 RespHeader c X-Varnish: 1001 **** v1 vsl| 1001 RespHeader c Age: 0 **** v1 vsl| 1001 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1001 VCL_call c DELIVER **** v1 vsl| 1001 VCL_return c deliver **** v1 vsl| 1001 Timestamp c Process: 1788811120.028448 0.211733 0.000038 **** v1 vsl| 1001 Filters c **** v1 vsl| 1001 RespHeader c Connection: keep-alive **** v1 vsl| 1001 Timestamp c Resp: 1788811120.028552 0.211837 0.000103 **** v1 vsl| 1001 ReqAcct c 51 0 51 163 0 163 **** v1 vsl| 1001 End c **** v1 vsl| 1000 SessClose c REM_CLOSE 0.219 **** v1 vsl| 1000 End c **** v1 vsl| 1003 Begin c sess 0 HTTP/1 **** v1 vsl| 1003 SessOpen c 127.0.0.1 35328 a0 127.0.0.1 44083 1788811120.087765 19 **** v1 vsl| 1003 Debug c sockopt: SO_LINGER may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Debug c sockopt: SO_KEEPALIVE may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Debug c sockopt: SO_SNDTIMEO may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Debug c sockopt: SO_RCVTIMEO may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Debug c sockopt: TCP_NODELAY may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Debug c sockopt: TCP_KEEPIDLE may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Debug c sockopt: TCP_KEEPCNT may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Debug c sockopt: TCP_KEEPINTVL may be inherited for a0=127.0.0.1:44083 **** v1 vsl| 1003 Link c req 1004 rxreq **** dT 5.660 **** c2 rxhdr|HTTP/1.1 200 OK\r **** c2 rxhdr|Date: Mon, 07 Sep 2026 19:58:40 GMT\r **** c2 rxhdr|Server: s1\r **** c2 rxhdr|Content-Length: 0\r **** c2 rxhdr|X-Varnish: 1004\r **** c2 rxhdr|Age: 0\r **** c2 rxhdr|Via: 1.1 v1 (Varnish/7.7)\r **** c2 rxhdr|Connection: keep-alive\r **** c2 rxhdr|\r **** c2 rxhdrlen = 163 **** c2 http[ 0] |HTTP/1.1 **** c2 http[ 1] |200 **** c2 http[ 2] |OK **** c2 http[ 3] |Date: Mon, 07 Sep 2026 19:58:40 GMT **** c2 http[ 4] |Server: s1 **** c2 http[ 5] |Content-Length: 0 **** c2 http[ 6] |X-Varnish: 1004 **** c2 http[ 7] |Age: 0 **** c2 http[ 8] |Via: 1.1 v1 (Varnish/7.7) **** c2 http[ 9] |Connection: keep-alive **** c2 bodylen = 0 ** c2 === expect resp.status == 200 **** c2 EXPECT resp.status (200) == "200" match *** c2 closing fd 17 ** c2 Ending ** top === client c1 -wait ** c1 Waiting for client ** top === varnish v1 -expect backend_wait == 1 **** dT 5.756 **** v1 vsl| 1005 Begin b bereq 1004 pass **** v1 vsl| 1005 VCL_use b vcl1 **** v1 vsl| 1005 Timestamp b Start: 1788811120.091623 0.000000 0.000000 **** v1 vsl| 1005 BereqMethod b GET **** v1 vsl| 1005 BereqURL b / **** v1 vsl| 1005 BereqProtocol b HTTP/1.1 **** v1 vsl| 1005 BereqHeader b Host: 127.0.0.1 **** v1 vsl| 1005 BereqHeader b User-Agent: c2 **** v1 vsl| 1005 BereqHeader b X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1005 BereqHeader b Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1005 BereqHeader b X-Varnish: 1005 **** v1 vsl| 1005 VCL_call b BACKEND_FETCH **** v1 vsl| 1005 VCL_return b fetch **** v1 vsl| 1005 Timestamp b Fetch: 1788811120.091675 0.000051 0.000051 **** v1 vsl| 1005 Timestamp b Connected: 1788811120.091684 0.000060 0.000008 **** v1 vsl| 1005 BackendOpen b 22 s1 127.0.0.1 40159 127.0.0.1 45036 reuse **** v1 vsl| 1005 Timestamp b Bereq: 1788811120.091776 0.000152 0.000091 **** v1 vsl| 1005 BerespProtocol b HTTP/1.1 **** v1 vsl| 1005 BerespStatus b 200 **** v1 vsl| 1005 BerespReason b OK **** v1 vsl| 1005 BerespHeader b Date: Mon, 07 Sep 2026 19:58:40 GMT **** v1 vsl| 1005 BerespHeader b Server: s1 **** v1 vsl| 1005 BerespHeader b Content-Length: 0 **** v1 vsl| 1005 Timestamp b Beresp: 1788811120.096252 0.004628 0.004476 **** v1 vsl| 1005 VCL_call b BACKEND_RESPONSE **** v1 vsl| 1005 VCL_return b deliver **** v1 vsl| 1005 Debug b Missing content-range header or unknown range unit **** v1 vsl| 1005 Timestamp b Process: 1788811120.096270 0.004646 0.000018 **** v1 vsl| 1005 Filters b **** v1 vsl| 1005 Storage b malloc Transient **** v1 vsl| 1005 Fetch_Body b 0 none - **** v1 vsl| 1005 BackendClose b 22 s1 recycle **** v1 vsl| 1005 Timestamp b BerespBody: 1788811120.106632 0.015008 0.010362 **** v1 vsl| 1005 Length b 0 **** v1 vsl| 1005 BereqAcct b 123 0 123 87 0 87 **** v1 vsl| 1005 End b **** v1 vsl| 1004 Begin c req 1003 rxreq **** v1 vsl| 1004 Timestamp c Start: 1788811120.087834 0.000000 0.000000 **** v1 vsl| 1004 Timestamp c Req: 1788811120.087834 0.000000 0.000000 **** dT 5.757 **** v1 vsl| 1004 VCL_use c vcl1 **** v1 vsl| 1004 ReqStart c 127.0.0.1 35328 a0 **** v1 vsl| 1004 ReqMethod c GET **** v1 vsl| 1004 ReqURL c / **** v1 vsl| 1004 ReqProtocol c HTTP/1.1 **** v1 vsl| 1004 ReqHeader c Host: 127.0.0.1 **** v1 vsl| 1004 ReqHeader c User-Agent: c2 **** v1 vsl| 1004 ReqHeader c X-Forwarded-For: 127.0.0.1 **** v1 vsl| 1004 ReqHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 VCL_call c RECV **** v1 vsl| 1004 VCL_return c pass **** v1 vsl| 1004 VCL_call c HASH **** v1 vsl| 1004 VCL_return c lookup **** v1 vsl| 1004 VCL_call c PASS **** v1 vsl| 1004 VCL_return c fetch **** v1 vsl| 1004 Link c bereq 1005 pass **** v1 vsl| 1004 Timestamp c Fetch: 1788811120.106655 0.018820 0.018820 **** v1 vsl| 1004 RespProtocol c HTTP/1.1 **** v1 vsl| 1004 RespStatus c 200 **** v1 vsl| 1004 RespReason c OK **** v1 vsl| 1004 RespHeader c Date: Mon, 07 Sep 2026 19:58:40 GMT **** v1 vsl| 1004 RespHeader c Server: s1 **** v1 vsl| 1004 RespHeader c Content-Length: 0 **** v1 vsl| 1004 RespHeader c X-Varnish: 1004 **** v1 vsl| 1004 RespHeader c Age: 0 **** v1 vsl| 1004 RespHeader c Via: 1.1 v1 (Varnish/7.7) **** v1 vsl| 1004 VCL_call c DELIVER **** v1 vsl| 1004 VCL_return c deliver **** v1 vsl| 1004 Timestamp c Process: 1788811120.106687 0.018853 0.000032 **** v1 vsl| 1004 Filters c **** v1 vsl| 1004 RespHeader c Connection: keep-alive **** v1 vsl| 1004 Timestamp c Resp: 1788811120.106805 0.018970 0.000117 **** v1 vsl| 1004 ReqAcct c 51 0 51 163 0 163 **** v1 vsl| 1004 End c **** v1 vsl| 1003 SessClose c REM_CLOSE 0.020 **** v1 vsl| 1003 End c **** dT 7.866 **** v1 vsl| 0 CLI - Rd ping **** v1 vsl| 0 CLI - Wr 200 19 PONG 1788811122 1.0 **** dT 10.698 ---- v1 Not true: backend_wait (0) == 1 (1) * top RESETTING after ./tests/v00072.vtc ** s1 Waiting for server (3/-1) ** v1 Wait **** v1 CLI TX|panic.show **** dT 10.744 *** v1 CLI RX 300 **** v1 CLI RX|Child has not panicked or panic has been cleared *** v1 debug|Info: manager stopping child *** v1 debug|Debug: Stopping Child **** dT 10.848 *** v1 debug|Info: Child (3714249) said Child dies **** dT 12.104 **** v1 vsl| 0 CLI - EOF on CLI connection, worker stops **** dT 14.542 *** v1 debug|Info: Child (3714249) ended *** v1 debug|Debug: Child cleanup complete **** dT 14.543 *** v1 debug|Info: manager dies **** dT 15.091 **** v1 STDOUT EOF ** v1 WAIT4 pid=3712474 status=0x0000 (user 0.694686 sys 3.374919) **** dT 15.092 * top TEST ./tests/v00072.vtc FAILED # top TEST ./tests/v00072.vtc FAILED (15.093) exit=2 FAIL tests/v00072.vtc (exit status: 2) ============================================================================ Testsuite summary for Varnish 7.7.0 ============================================================================ # TOTAL: 892 # PASS: 847 # SKIP: 36 # XFAIL: 0 # FAIL: 9 # XPASS: 0 # ERROR: 0 ============================================================================ See bin/varnishtest/test-suite.log for debugging. Some test(s) failed. Please report this to varnish-dev@varnish-cache.org, together with the test-suite.log file (gzipped) and your system information. Thanks. ============================================================================ make[7]: *** [Makefile:1231: test-suite.log] Error 1 make[7]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[6]: *** [Makefile:1366: check-TESTS] Error 2 make[6]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[5]: *** [Makefile:1419: check-am] Error 2 make[5]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[4]: *** [Makefile:1421: check] Error 2 make[4]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin/varnishtest' make[3]: *** [Makefile:426: check-recursive] Error 1 make[3]: Leaving directory '/build/reproducible-path/varnish-7.7.0/bin' make[2]: *** [Makefile:764: check-recursive] Error 1 make[2]: Leaving directory '/build/reproducible-path/varnish-7.7.0' dh_auto_test: error: make -j42 check "TESTSUITEFLAGS=-j42 --verbose" VERBOSE=1 returned exit code 2 make[1]: *** [debian/rules:48: override_dh_auto_test] Error 25 make[1]: Leaving directory '/build/reproducible-path/varnish-7.7.0' make: *** [debian/rules:43: binary] Error 2 dpkg-buildpackage: error: debian/rules binary subprocess returned exit status 2 I: copying local configuration E: Failed autobuilding of package I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/3540360 and its subdirectories