I: pbuilder: network access will be disabled during build I: Current time: Mon Jan 20 14:08:55 -12 2025 I: pbuilder-time-stamp: 1737425335 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/unstable-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: unsupported subcommand dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/3669716/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build/reproducible-path' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='arm64' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=12 ' DISTRIBUTION='unstable' HOME='/root' HOST_ARCH='arm64' IFS=' ' INVOCATION_ID='daf5e5ec758140fea2b9d4c683df6bce' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='3669716' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.Vj8QxTFd/pbuilderrc_2XbE --distribution unstable --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/unstable-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.Vj8QxTFd/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='109' SUDO_UID='104' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://192.168.101.4:3128' I: uname -a Linux codethink02-arm64 6.1.0-30-cloud-arm64 #1 SMP Debian 6.1.124-1 (2025-01-12) aarch64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Nov 22 14:40 /bin -> usr/bin I: user script /srv/workspace/pbuilder/3669716/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: arm64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19965 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dbus{a} dbus-bin{a} dbus-daemon{a} dbus-session-bus-common{a} dbus-system-bus-common{a} dbus-user-session{a} dconf-gsettings-backend{a} dconf-service{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gpg{a} gpg-agent{a} gpgconf{a} gpgsm{a} gpgv{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libapparmor1{a} libarchive-zip-perl{a} libasm-java{a} libasound2-data{a} libasound2t64{a} libassuan9{a} libatinject-jsr330-api-java{a} libatk-bridge2.0-0t64{a} libatk1.0-0t64{a} libatspi2.0-0t64{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo-gobject2{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcloudproviders0{a} libcolord2{a} libcom-err2{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2t64{a} libdatrie1{a} libdbus-1-3{a} libdconf1{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1t64{a} libencode-locale-perl{a} libepoxy0{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libffi8{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgbm1{a} libgcrypt20{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0t64{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgnutls30t64{a} libgoogle-gson-java{a} libgpg-error0{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgssapi-krb5-2{a} libgtk-3-0t64{a} libgtk-3-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libidn2-0{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjunixsocket-java{a} libjunixsocket-jni{a} libjzlib-java{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap2{a} liblerc4{a} liblightcouch-java{a} libllvm19{a} liblog4j2-java{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1t64{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmongodb-java{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0t64{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libp11-kit0{a} libpam-systemd{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16t64{a} libpolyglot-maven-java{a} libproc2-0{a} libpython3-stdlib{a} libpython3.13-minimal{a} libpython3.13-stdlib{a} libqdox-java{a} libreadline8t64{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-quote-perl{a} libsystemd-shared{a} libtasn1-6{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} libunistring5{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwayland-client0{a} libwayland-cursor0{a} libwayland-egl1{a} libwayland-server0{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxkbcommon0{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} mesa-libgallium{a} netbase{a} openjdk-21-jdk{a} openjdk-21-jdk-headless{a} openjdk-21-jre{a} openjdk-21-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} procps{a} python3{a} python3-minimal{a} python3.13{a} python3.13-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} sopv-gpgv{a} systemd{a} systemd-sysv{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} xkb-data{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf at-spi2-core chrony curl debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra gnupg-utils gpg-wks-client javascript-common krb5-locales libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpg-error-l10n libgtk-3-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libkmod2 libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libnss-systemd libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian linux-sysctl-defaults lynx mesa-vulkan-drivers ntpsec openntpd pristine-tar psmisc python3-apt python3-argcomplete python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace systemd-cryptsetup systemd-timesyncd wget xdg-user-dirs 0 packages upgraded, 385 newly installed, 0 to remove and 0 not upgraded. Need to get 331 MB of archives. After unpacking 926 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian unstable/main arm64 libsystemd-shared arm64 257.2-2 [1907 kB] Get: 2 http://deb.debian.org/debian unstable/main arm64 libapparmor1 arm64 3.1.7-1+b3 [41.8 kB] Get: 3 http://deb.debian.org/debian unstable/main arm64 systemd arm64 257.2-2 [2922 kB] Get: 4 http://deb.debian.org/debian unstable/main arm64 systemd-sysv arm64 257.2-2 [60.8 kB] Get: 5 http://deb.debian.org/debian unstable/main arm64 libdbus-1-3 arm64 1.16.0-1 [168 kB] Get: 6 http://deb.debian.org/debian unstable/main arm64 dbus-bin arm64 1.16.0-1 [77.7 kB] Get: 7 http://deb.debian.org/debian unstable/main arm64 dbus-session-bus-common all 1.16.0-1 [51.1 kB] Get: 8 http://deb.debian.org/debian unstable/main arm64 libexpat1 arm64 2.6.4-1 [90.7 kB] Get: 9 http://deb.debian.org/debian unstable/main arm64 dbus-daemon arm64 1.16.0-1 [150 kB] Get: 10 http://deb.debian.org/debian unstable/main arm64 dbus-system-bus-common all 1.16.0-1 [52.2 kB] Get: 11 http://deb.debian.org/debian unstable/main arm64 dbus arm64 1.16.0-1 [69.4 kB] Get: 12 http://deb.debian.org/debian unstable/main arm64 libpipeline1 arm64 1.5.8-1 [40.2 kB] Get: 13 http://deb.debian.org/debian unstable/main arm64 binfmt-support arm64 2.2.2-7+b1 [68.2 kB] Get: 14 http://deb.debian.org/debian unstable/main arm64 libpython3.13-minimal arm64 3.13.1-3 [852 kB] Get: 15 http://deb.debian.org/debian unstable/main arm64 python3.13-minimal arm64 3.13.1-3 [1990 kB] Get: 16 http://deb.debian.org/debian unstable/main arm64 python3-minimal arm64 3.13.1-2 [27.0 kB] Get: 17 http://deb.debian.org/debian unstable/main arm64 media-types all 10.1.0 [26.9 kB] Get: 18 http://deb.debian.org/debian unstable/main arm64 netbase all 6.4 [12.8 kB] Get: 19 http://deb.debian.org/debian unstable/main arm64 tzdata all 2025a-1 [259 kB] Get: 20 http://deb.debian.org/debian unstable/main arm64 libffi8 arm64 3.4.6-1 [20.9 kB] Get: 21 http://deb.debian.org/debian unstable/main arm64 readline-common all 8.2-6 [69.4 kB] Get: 22 http://deb.debian.org/debian unstable/main arm64 libreadline8t64 arm64 8.2-6 [159 kB] Get: 23 http://deb.debian.org/debian unstable/main arm64 libpython3.13-stdlib arm64 3.13.1-3 [1912 kB] Get: 24 http://deb.debian.org/debian unstable/main arm64 python3.13 arm64 3.13.1-3 [740 kB] Get: 25 http://deb.debian.org/debian unstable/main arm64 libpython3-stdlib arm64 3.13.1-2 [9952 B] Get: 26 http://deb.debian.org/debian unstable/main arm64 python3 arm64 3.13.1-2 [28.0 kB] Get: 27 http://deb.debian.org/debian unstable/main arm64 libproc2-0 arm64 2:4.0.4-6 [62.3 kB] Get: 28 http://deb.debian.org/debian unstable/main arm64 procps arm64 2:4.0.4-6 [872 kB] Get: 29 http://deb.debian.org/debian unstable/main arm64 sensible-utils all 0.0.24 [24.8 kB] Get: 30 http://deb.debian.org/debian unstable/main arm64 openssl arm64 3.4.0-2 [1385 kB] Get: 31 http://deb.debian.org/debian unstable/main arm64 ca-certificates all 20241223 [164 kB] Get: 32 http://deb.debian.org/debian unstable/main arm64 libmagic-mgc arm64 1:5.45-3+b1 [314 kB] Get: 33 http://deb.debian.org/debian unstable/main arm64 libmagic1t64 arm64 1:5.45-3+b1 [102 kB] Get: 34 http://deb.debian.org/debian unstable/main arm64 file arm64 1:5.45-3+b1 [43.4 kB] Get: 35 http://deb.debian.org/debian unstable/main arm64 gettext-base arm64 0.23.1-1 [241 kB] Get: 36 http://deb.debian.org/debian unstable/main arm64 libuchardet0 arm64 0.0.8-1+b2 [69.2 kB] Get: 37 http://deb.debian.org/debian unstable/main arm64 groff-base arm64 1.23.0-7 [1129 kB] Get: 38 http://deb.debian.org/debian unstable/main arm64 libpam-systemd arm64 257.2-2 [272 kB] Get: 39 http://deb.debian.org/debian unstable/main arm64 bsdextrautils arm64 2.40.4-1 [91.6 kB] Get: 40 http://deb.debian.org/debian unstable/main arm64 man-db arm64 2.13.0-1 [1404 kB] Get: 41 http://deb.debian.org/debian unstable/main arm64 libgdk-pixbuf2.0-common all 2.42.12+dfsg-1 [311 kB] Get: 42 http://deb.debian.org/debian unstable/main arm64 libglib2.0-0t64 arm64 2.82.4-2 [1413 kB] Get: 43 http://deb.debian.org/debian unstable/main arm64 libicu72 arm64 72.1-6 [9239 kB] Get: 44 http://deb.debian.org/debian unstable/main arm64 libxml2 arm64 2.12.7+dfsg+really2.9.14-0.2+b1 [630 kB] Get: 45 http://deb.debian.org/debian unstable/main arm64 shared-mime-info arm64 2.4-5+b1 [755 kB] Get: 46 http://deb.debian.org/debian unstable/main arm64 libjpeg62-turbo arm64 1:2.1.5-3+b1 [173 kB] Get: 47 http://deb.debian.org/debian unstable/main arm64 libpng16-16t64 arm64 1.6.45-1 [273 kB] Get: 48 http://deb.debian.org/debian unstable/main arm64 libdeflate0 arm64 1.23-1+b1 [42.5 kB] Get: 49 http://deb.debian.org/debian unstable/main arm64 libjbig0 arm64 2.1-6.1+b2 [30.4 kB] Get: 50 http://deb.debian.org/debian unstable/main arm64 liblerc4 arm64 4.0.0+ds-5 [146 kB] Get: 51 http://deb.debian.org/debian unstable/main arm64 libsharpyuv0 arm64 1.5.0-0.1 [114 kB] Get: 52 http://deb.debian.org/debian unstable/main arm64 libwebp7 arm64 1.5.0-0.1 [271 kB] Get: 53 http://deb.debian.org/debian unstable/main arm64 libtiff6 arm64 4.5.1+git230720-5 [309 kB] Get: 54 http://deb.debian.org/debian unstable/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.12+dfsg-1+b1 [131 kB] Get: 55 http://deb.debian.org/debian unstable/main arm64 gtk-update-icon-cache arm64 4.16.12+ds-1 [50.2 kB] Get: 56 http://deb.debian.org/debian unstable/main arm64 hicolor-icon-theme all 0.18-1 [12.0 kB] Get: 57 http://deb.debian.org/debian unstable/main arm64 adwaita-icon-theme all 47.0-2 [463 kB] Get: 58 http://deb.debian.org/debian unstable/main arm64 ca-certificates-java all 20240118 [11.6 kB] Get: 59 http://deb.debian.org/debian unstable/main arm64 java-common all 0.76 [6776 B] Get: 60 http://deb.debian.org/debian unstable/main arm64 liblcms2-2 arm64 2.16-2 [151 kB] Get: 61 http://deb.debian.org/debian unstable/main arm64 libnspr4 arm64 2:4.36-1 [102 kB] Get: 62 http://deb.debian.org/debian unstable/main arm64 libnss3 arm64 2:3.107-1 [1289 kB] Get: 63 http://deb.debian.org/debian unstable/main arm64 libpcsclite1 arm64 2.3.1-1 [55.3 kB] Get: 64 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jre-headless arm64 21.0.6~6ea-1 [40.6 MB] Get: 65 http://deb.debian.org/debian unstable/main arm64 default-jre-headless arm64 2:1.21-76 [3192 B] Get: 66 http://deb.debian.org/debian unstable/main arm64 ant all 1.10.15-1 [2163 kB] Get: 67 http://deb.debian.org/debian unstable/main arm64 ant-optional all 1.10.15-1 [456 kB] Get: 68 http://deb.debian.org/debian unstable/main arm64 libantlr-java all 2.7.7+dfsg-14 [458 kB] Get: 69 http://deb.debian.org/debian unstable/main arm64 antlr all 2.7.7+dfsg-14 [8376 B] Get: 70 http://deb.debian.org/debian unstable/main arm64 at-spi2-common all 2.55.0.1-1 [170 kB] Get: 71 http://deb.debian.org/debian unstable/main arm64 m4 arm64 1.4.19-5 [284 kB] Get: 72 http://deb.debian.org/debian unstable/main arm64 autoconf all 2.72-3 [493 kB] Get: 73 http://deb.debian.org/debian unstable/main arm64 autotools-dev all 20220109.1 [51.6 kB] Get: 74 http://deb.debian.org/debian unstable/main arm64 automake all 1:1.16.5-1.3 [823 kB] Get: 75 http://deb.debian.org/debian unstable/main arm64 autopoint all 0.23.1-1 [770 kB] Get: 76 http://deb.debian.org/debian unstable/main arm64 unzip arm64 6.0-28+b1 [158 kB] Get: 77 http://deb.debian.org/debian unstable/main arm64 java-wrappers all 0.5 [8848 B] Get: 78 http://deb.debian.org/debian unstable/main arm64 libhamcrest-java all 2.2-2 [121 kB] Get: 79 http://deb.debian.org/debian unstable/main arm64 junit4 all 4.13.2-5 [350 kB] Get: 80 http://deb.debian.org/debian unstable/main arm64 libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 81 http://deb.debian.org/debian unstable/main arm64 libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 82 http://deb.debian.org/debian unstable/main arm64 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 83 http://deb.debian.org/debian unstable/main arm64 libosgi-core-java all 8.0.0-2 [182 kB] Get: 84 http://deb.debian.org/debian unstable/main arm64 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 85 http://deb.debian.org/debian unstable/main arm64 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 86 http://deb.debian.org/debian unstable/main arm64 libjansi-native-java all 1.8-2 [26.0 kB] Get: 87 http://deb.debian.org/debian unstable/main arm64 libjansi1-java all 1.18-3.1 [66.6 kB] Get: 88 http://deb.debian.org/debian unstable/main arm64 libjline2-java all 2.14.6-5 [151 kB] Get: 89 http://deb.debian.org/debian unstable/main arm64 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 90 http://deb.debian.org/debian unstable/main arm64 libslf4j-java all 1.7.32-1 [144 kB] Get: 91 http://deb.debian.org/debian unstable/main arm64 libxz-java all 1.9-1 [143 kB] Get: 92 http://deb.debian.org/debian unstable/main arm64 libyaml-snake-java all 1.33-2 [321 kB] Get: 93 http://deb.debian.org/debian unstable/main arm64 bnd all 5.0.1-5 [10.1 MB] Get: 94 http://deb.debian.org/debian unstable/main arm64 dbus-user-session arm64 1.16.0-1 [51.0 kB] Get: 95 http://deb.debian.org/debian unstable/main arm64 libdconf1 arm64 0.40.0-5 [40.4 kB] Get: 96 http://deb.debian.org/debian unstable/main arm64 dconf-service arm64 0.40.0-5 [30.9 kB] Get: 97 http://deb.debian.org/debian unstable/main arm64 dconf-gsettings-backend arm64 0.40.0-5 [27.3 kB] Get: 98 http://deb.debian.org/debian unstable/main arm64 dctrl-tools arm64 2.24-3+b1 [125 kB] Get: 99 http://deb.debian.org/debian unstable/main arm64 libdebhelper-perl all 13.24.1 [90.9 kB] Get: 100 http://deb.debian.org/debian unstable/main arm64 libtool all 2.5.4-2 [539 kB] Get: 101 http://deb.debian.org/debian unstable/main arm64 dh-autoreconf all 20 [17.1 kB] Get: 102 http://deb.debian.org/debian unstable/main arm64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 103 http://deb.debian.org/debian unstable/main arm64 libfile-stripnondeterminism-perl all 1.14.0-1 [19.5 kB] Get: 104 http://deb.debian.org/debian unstable/main arm64 dh-strip-nondeterminism all 1.14.0-1 [8448 B] Get: 105 http://deb.debian.org/debian unstable/main arm64 libelf1t64 arm64 0.192-4 [189 kB] Get: 106 http://deb.debian.org/debian unstable/main arm64 dwz arm64 0.15-1+b1 [102 kB] Get: 107 http://deb.debian.org/debian unstable/main arm64 libunistring5 arm64 1.3-1 [449 kB] Get: 108 http://deb.debian.org/debian unstable/main arm64 gettext arm64 0.23.1-1 [1610 kB] Get: 109 http://deb.debian.org/debian unstable/main arm64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 110 http://deb.debian.org/debian unstable/main arm64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 111 http://deb.debian.org/debian unstable/main arm64 debhelper all 13.24.1 [920 kB] Get: 112 http://deb.debian.org/debian unstable/main arm64 libatk1.0-0t64 arm64 2.55.0.1-1 [49.7 kB] Get: 113 http://deb.debian.org/debian unstable/main arm64 libxau6 arm64 1:1.0.11-1 [20.6 kB] Get: 114 http://deb.debian.org/debian unstable/main arm64 libxdmcp6 arm64 1:1.1.5-1 [27.8 kB] Get: 115 http://deb.debian.org/debian unstable/main arm64 libxcb1 arm64 1.17.0-2+b1 [143 kB] Get: 116 http://deb.debian.org/debian unstable/main arm64 libx11-data all 2:1.8.10-2 [337 kB] Get: 117 http://deb.debian.org/debian unstable/main arm64 libx11-6 arm64 2:1.8.10-2 [789 kB] Get: 118 http://deb.debian.org/debian unstable/main arm64 libxext6 arm64 2:1.3.4-1+b3 [49.2 kB] Get: 119 http://deb.debian.org/debian unstable/main arm64 libxi6 arm64 2:1.8.2-1 [77.8 kB] Get: 120 http://deb.debian.org/debian unstable/main arm64 libatspi2.0-0t64 arm64 2.55.0.1-1 [73.2 kB] Get: 121 http://deb.debian.org/debian unstable/main arm64 libatk-bridge2.0-0t64 arm64 2.55.0.1-1 [64.4 kB] Get: 122 http://deb.debian.org/debian unstable/main arm64 libbrotli1 arm64 1.1.0-2+b6 [297 kB] Get: 123 http://deb.debian.org/debian unstable/main arm64 libfreetype6 arm64 2.13.3+dfsg-1 [422 kB] Get: 124 http://deb.debian.org/debian unstable/main arm64 fonts-dejavu-mono all 2.37-8 [489 kB] Get: 125 http://deb.debian.org/debian unstable/main arm64 fonts-dejavu-core all 2.37-8 [840 kB] Get: 126 http://deb.debian.org/debian unstable/main arm64 fontconfig-config arm64 2.15.0-2 [317 kB] Get: 127 http://deb.debian.org/debian unstable/main arm64 libfontconfig1 arm64 2.15.0-2 [386 kB] Get: 128 http://deb.debian.org/debian unstable/main arm64 libpixman-1-0 arm64 0.44.0-3 [168 kB] Get: 129 http://deb.debian.org/debian unstable/main arm64 libxcb-render0 arm64 1.17.0-2+b1 [115 kB] Get: 130 http://deb.debian.org/debian unstable/main arm64 libxcb-shm0 arm64 1.17.0-2+b1 [105 kB] Get: 131 http://deb.debian.org/debian unstable/main arm64 libxrender1 arm64 1:0.9.10-1.1+b3 [27.2 kB] Get: 132 http://deb.debian.org/debian unstable/main arm64 libcairo2 arm64 1.18.2-2 [483 kB] Get: 133 http://deb.debian.org/debian unstable/main arm64 libcairo-gobject2 arm64 1.18.2-2 [130 kB] Get: 134 http://deb.debian.org/debian unstable/main arm64 libcloudproviders0 arm64 0.3.6-1+b1 [27.7 kB] Get: 135 http://deb.debian.org/debian unstable/main arm64 libcolord2 arm64 1.4.7-1+b2 [130 kB] Get: 136 http://deb.debian.org/debian unstable/main arm64 libavahi-common-data arm64 0.8-16 [112 kB] Get: 137 http://deb.debian.org/debian unstable/main arm64 libavahi-common3 arm64 0.8-16 [43.3 kB] Get: 138 http://deb.debian.org/debian unstable/main arm64 libavahi-client3 arm64 0.8-16 [46.7 kB] Get: 139 http://deb.debian.org/debian unstable/main arm64 libidn2-0 arm64 2.3.7-2+b1 [127 kB] Get: 140 http://deb.debian.org/debian unstable/main arm64 libp11-kit0 arm64 0.25.5-3 [409 kB] Get: 141 http://deb.debian.org/debian unstable/main arm64 libtasn1-6 arm64 4.19.0-3+b3 [46.9 kB] Get: 142 http://deb.debian.org/debian unstable/main arm64 libgnutls30t64 arm64 3.8.8-2 [1363 kB] Get: 143 http://deb.debian.org/debian unstable/main arm64 libkrb5support0 arm64 1.21.3-4 [32.2 kB] Get: 144 http://deb.debian.org/debian unstable/main arm64 libcom-err2 arm64 1.47.2-1 [23.9 kB] Get: 145 http://deb.debian.org/debian unstable/main arm64 libk5crypto3 arm64 1.21.3-4 [81.5 kB] Get: 146 http://deb.debian.org/debian unstable/main arm64 libkeyutils1 arm64 1.6.3-4 [9352 B] Get: 147 http://deb.debian.org/debian unstable/main arm64 libkrb5-3 arm64 1.21.3-4 [308 kB] Get: 148 http://deb.debian.org/debian unstable/main arm64 libgssapi-krb5-2 arm64 1.21.3-4 [127 kB] Get: 149 http://deb.debian.org/debian unstable/main arm64 libcups2t64 arm64 2.4.10-2+b1 [236 kB] Get: 150 http://deb.debian.org/debian unstable/main arm64 libepoxy0 arm64 1.5.10-2 [200 kB] Get: 151 http://deb.debian.org/debian unstable/main arm64 libfribidi0 arm64 1.0.16-1 [26.5 kB] Get: 152 http://deb.debian.org/debian unstable/main arm64 libgraphite2-3 arm64 1.3.14-2+b1 [70.4 kB] Get: 153 http://deb.debian.org/debian unstable/main arm64 libharfbuzz0b arm64 10.2.0-1 [443 kB] Get: 154 http://deb.debian.org/debian unstable/main arm64 fontconfig arm64 2.15.0-2 [462 kB] Get: 155 http://deb.debian.org/debian unstable/main arm64 libthai-data all 0.1.29-2 [168 kB] Get: 156 http://deb.debian.org/debian unstable/main arm64 libdatrie1 arm64 0.2.13-3+b1 [37.6 kB] Get: 157 http://deb.debian.org/debian unstable/main arm64 libthai0 arm64 0.1.29-2+b1 [48.4 kB] Get: 158 http://deb.debian.org/debian unstable/main arm64 libpango-1.0-0 arm64 1.56.1-1 [213 kB] Get: 159 http://deb.debian.org/debian unstable/main arm64 libpangoft2-1.0-0 arm64 1.56.1-1 [52.8 kB] Get: 160 http://deb.debian.org/debian unstable/main arm64 libpangocairo-1.0-0 arm64 1.56.1-1 [33.8 kB] Get: 161 http://deb.debian.org/debian unstable/main arm64 libwayland-client0 arm64 1.23.0-1+b1 [26.0 kB] Get: 162 http://deb.debian.org/debian unstable/main arm64 libwayland-cursor0 arm64 1.23.0-1+b1 [11.5 kB] Get: 163 http://deb.debian.org/debian unstable/main arm64 libwayland-egl1 arm64 1.23.0-1+b1 [5768 B] Get: 164 http://deb.debian.org/debian unstable/main arm64 libxcomposite1 arm64 1:0.4.6-1 [16.4 kB] Get: 165 http://deb.debian.org/debian unstable/main arm64 libxfixes3 arm64 1:6.0.0-2+b3 [20.4 kB] Get: 166 http://deb.debian.org/debian unstable/main arm64 libxcursor1 arm64 1:1.2.3-1 [39.3 kB] Get: 167 http://deb.debian.org/debian unstable/main arm64 libxdamage1 arm64 1:1.1.6-1+b2 [15.6 kB] Get: 168 http://deb.debian.org/debian unstable/main arm64 libxinerama1 arm64 2:1.1.4-3+b3 [16.1 kB] Get: 169 http://deb.debian.org/debian unstable/main arm64 xkb-data all 2.42-1 [790 kB] Get: 170 http://deb.debian.org/debian unstable/main arm64 libxkbcommon0 arm64 1.7.0-2 [106 kB] Get: 171 http://deb.debian.org/debian unstable/main arm64 libxrandr2 arm64 2:1.5.4-1+b2 [36.0 kB] Get: 172 http://deb.debian.org/debian unstable/main arm64 libgtk-3-common all 3.24.43-5 [4655 kB] Get: 173 http://deb.debian.org/debian unstable/main arm64 libgtk-3-0t64 arm64 3.24.43-5 [2551 kB] Get: 174 http://deb.debian.org/debian unstable/main arm64 libglvnd0 arm64 1.7.0-1+b2 [41.6 kB] Get: 175 http://deb.debian.org/debian unstable/main arm64 libdrm-common all 2.4.123-1 [8084 B] Get: 176 http://deb.debian.org/debian unstable/main arm64 libdrm2 arm64 2.4.123-1 [38.0 kB] Get: 177 http://deb.debian.org/debian unstable/main arm64 libglapi-mesa arm64 24.3.3-1 [47.9 kB] Get: 178 http://deb.debian.org/debian unstable/main arm64 libx11-xcb1 arm64 2:1.8.10-2 [241 kB] Get: 179 http://deb.debian.org/debian unstable/main arm64 libxcb-dri3-0 arm64 1.17.0-2+b1 [107 kB] Get: 180 http://deb.debian.org/debian unstable/main arm64 libxcb-glx0 arm64 1.17.0-2+b1 [123 kB] Get: 181 http://deb.debian.org/debian unstable/main arm64 libxcb-present0 arm64 1.17.0-2+b1 [106 kB] Get: 182 http://deb.debian.org/debian unstable/main arm64 libxcb-xfixes0 arm64 1.17.0-2+b1 [110 kB] Get: 183 http://deb.debian.org/debian unstable/main arm64 libxxf86vm1 arm64 1:1.1.4-1+b4 [19.2 kB] Get: 184 http://deb.debian.org/debian unstable/main arm64 libdrm-amdgpu1 arm64 2.4.123-1 [21.6 kB] Get: 185 http://deb.debian.org/debian unstable/main arm64 libdrm-radeon1 arm64 2.4.123-1 [21.3 kB] Get: 186 http://deb.debian.org/debian unstable/main arm64 libedit2 arm64 3.1-20250104-1 [89.3 kB] Get: 187 http://deb.debian.org/debian unstable/main arm64 libz3-4 arm64 4.13.3-1 [7507 kB] Get: 188 http://deb.debian.org/debian unstable/main arm64 libllvm19 arm64 1:19.1.7-1 [23.3 MB] Get: 189 http://deb.debian.org/debian unstable/main arm64 libsensors-config all 1:3.6.0-10 [14.6 kB] Get: 190 http://deb.debian.org/debian unstable/main arm64 libsensors5 arm64 1:3.6.0-10+b1 [34.3 kB] Get: 191 http://deb.debian.org/debian unstable/main arm64 libxcb-randr0 arm64 1.17.0-2+b1 [117 kB] Get: 192 http://deb.debian.org/debian unstable/main arm64 libxcb-sync1 arm64 1.17.0-2+b1 [109 kB] Get: 193 http://deb.debian.org/debian unstable/main arm64 libxshmfence1 arm64 1.3-1+b3 [9104 B] Get: 194 http://deb.debian.org/debian unstable/main arm64 mesa-libgallium arm64 24.3.3-1 [7904 kB] Get: 195 http://deb.debian.org/debian unstable/main arm64 libvulkan1 arm64 1.4.304.0-1 [126 kB] Get: 196 http://deb.debian.org/debian unstable/main arm64 libwayland-server0 arm64 1.23.0-1+b1 [33.4 kB] Get: 197 http://deb.debian.org/debian unstable/main arm64 libgbm1 arm64 24.3.3-1 [42.9 kB] Get: 198 http://deb.debian.org/debian unstable/main arm64 libgl1-mesa-dri arm64 24.3.3-1 [44.6 kB] Get: 199 http://deb.debian.org/debian unstable/main arm64 libglx-mesa0 arm64 24.3.3-1 [142 kB] Get: 200 http://deb.debian.org/debian unstable/main arm64 libglx0 arm64 1.7.0-1+b2 [31.1 kB] Get: 201 http://deb.debian.org/debian unstable/main arm64 libgl1 arm64 1.7.0-1+b2 [90.9 kB] Get: 202 http://deb.debian.org/debian unstable/main arm64 libasound2-data all 1.2.13-1 [21.1 kB] Get: 203 http://deb.debian.org/debian unstable/main arm64 libasound2t64 arm64 1.2.13-1+b1 [338 kB] Get: 204 http://deb.debian.org/debian unstable/main arm64 libgif7 arm64 5.2.2-1+b1 [44.2 kB] Get: 205 http://deb.debian.org/debian unstable/main arm64 x11-common all 1:7.7+23.2 [216 kB] Get: 206 http://deb.debian.org/debian unstable/main arm64 libxtst6 arm64 2:1.2.3-1.1+b3 [26.0 kB] Get: 207 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jre arm64 21.0.6~6ea-1 [193 kB] Get: 208 http://deb.debian.org/debian unstable/main arm64 default-jre arm64 2:1.21-76 [1068 B] Get: 209 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jdk-headless arm64 21.0.6~6ea-1 [81.8 MB] Get: 210 http://deb.debian.org/debian unstable/main arm64 default-jdk-headless arm64 2:1.21-76 [1124 B] Get: 211 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jdk arm64 21.0.6~6ea-1 [3435 kB] Get: 212 http://deb.debian.org/debian unstable/main arm64 default-jdk arm64 2:1.21-76 [1076 B] Get: 213 http://deb.debian.org/debian unstable/main arm64 libgpg-error0 arm64 1.51-3 [78.5 kB] Get: 214 http://deb.debian.org/debian unstable/main arm64 libassuan9 arm64 3.0.1-2 [58.1 kB] Get: 215 http://deb.debian.org/debian unstable/main arm64 libgcrypt20 arm64 1.11.0-7 [742 kB] Get: 216 http://deb.debian.org/debian unstable/main arm64 gpgconf arm64 2.2.46-1+b1 [115 kB] Get: 217 http://deb.debian.org/debian unstable/main arm64 libksba8 arm64 1.6.7-2+b1 [125 kB] Get: 218 http://deb.debian.org/debian unstable/main arm64 libsasl2-modules-db arm64 2.1.28+dfsg1-8+b1 [20.3 kB] Get: 219 http://deb.debian.org/debian unstable/main arm64 libsasl2-2 arm64 2.1.28+dfsg1-8+b1 [55.7 kB] Get: 220 http://deb.debian.org/debian unstable/main arm64 libldap2 arm64 2.6.9+dfsg-1 [179 kB] Get: 221 http://deb.debian.org/debian unstable/main arm64 libnpth0t64 arm64 1.8-2 [22.8 kB] Get: 222 http://deb.debian.org/debian unstable/main arm64 dirmngr arm64 2.2.46-1+b1 [344 kB] Get: 223 http://deb.debian.org/debian unstable/main arm64 gnupg-l10n all 2.2.46-1 [702 kB] Get: 224 http://deb.debian.org/debian unstable/main arm64 gpg arm64 2.2.46-1+b1 [481 kB] Get: 225 http://deb.debian.org/debian unstable/main arm64 pinentry-curses arm64 1.3.1-2 [83.5 kB] Get: 226 http://deb.debian.org/debian unstable/main arm64 gpg-agent arm64 2.2.46-1+b1 [231 kB] Get: 227 http://deb.debian.org/debian unstable/main arm64 gpgsm arm64 2.2.46-1+b1 [232 kB] Get: 228 http://deb.debian.org/debian unstable/main arm64 gnupg all 2.2.46-1 [376 kB] Get: 229 http://deb.debian.org/debian unstable/main arm64 gpgv arm64 2.2.46-1+b1 [200 kB] Get: 230 http://deb.debian.org/debian unstable/main arm64 sopv-gpgv all 0.1.1-1 [10.7 kB] Get: 231 http://deb.debian.org/debian unstable/main arm64 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 232 http://deb.debian.org/debian unstable/main arm64 libfile-which-perl all 1.27-2 [15.1 kB] Get: 233 http://deb.debian.org/debian unstable/main arm64 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 234 http://deb.debian.org/debian unstable/main arm64 libfile-touch-perl all 0.12-2 [8816 B] Get: 235 http://deb.debian.org/debian unstable/main arm64 libio-pty-perl arm64 1:1.20-1+b2 [34.0 kB] Get: 236 http://deb.debian.org/debian unstable/main arm64 libipc-run-perl all 20231003.0-2 [101 kB] Get: 237 http://deb.debian.org/debian unstable/main arm64 libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 238 http://deb.debian.org/debian unstable/main arm64 libclass-xsaccessor-perl arm64 1.19-4+b4 [34.9 kB] Get: 239 http://deb.debian.org/debian unstable/main arm64 libb-hooks-op-check-perl arm64 0.22-3+b2 [10.6 kB] Get: 240 http://deb.debian.org/debian unstable/main arm64 libdynaloader-functions-perl all 0.004-1 [12.1 kB] Get: 241 http://deb.debian.org/debian unstable/main arm64 libdevel-callchecker-perl arm64 0.009-1+b1 [16.3 kB] Get: 242 http://deb.debian.org/debian unstable/main arm64 libparams-classify-perl arm64 0.015-2+b4 [22.3 kB] Get: 243 http://deb.debian.org/debian unstable/main arm64 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 244 http://deb.debian.org/debian unstable/main arm64 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 245 http://deb.debian.org/debian unstable/main arm64 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 246 http://deb.debian.org/debian unstable/main arm64 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 247 http://deb.debian.org/debian unstable/main arm64 libmoo-perl all 2.005005-1 [58.0 kB] Get: 248 http://deb.debian.org/debian unstable/main arm64 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 249 http://deb.debian.org/debian unstable/main arm64 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 250 http://deb.debian.org/debian unstable/main arm64 libhttp-date-perl all 6.06-1 [10.7 kB] Get: 251 http://deb.debian.org/debian unstable/main arm64 libfile-listing-perl all 6.16-1 [12.4 kB] Get: 252 http://deb.debian.org/debian unstable/main arm64 libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 253 http://deb.debian.org/debian unstable/main arm64 liburi-perl all 5.30-1 [105 kB] Get: 254 http://deb.debian.org/debian unstable/main arm64 libhtml-parser-perl arm64 3.83-1+b2 [97.5 kB] Get: 255 http://deb.debian.org/debian unstable/main arm64 libhtml-tree-perl all 5.07-3 [211 kB] Get: 256 http://deb.debian.org/debian unstable/main arm64 libclone-perl arm64 0.47-1+b1 [13.7 kB] Get: 257 http://deb.debian.org/debian unstable/main arm64 libio-html-perl all 1.004-3 [16.2 kB] Get: 258 http://deb.debian.org/debian unstable/main arm64 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 259 http://deb.debian.org/debian unstable/main arm64 libhttp-message-perl all 7.00-2 [79.8 kB] Get: 260 http://deb.debian.org/debian unstable/main arm64 libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 261 http://deb.debian.org/debian unstable/main arm64 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 262 http://deb.debian.org/debian unstable/main arm64 perl-openssl-defaults arm64 7+b2 [6712 B] Get: 263 http://deb.debian.org/debian unstable/main arm64 libnet-ssleay-perl arm64 1.94-2 [323 kB] Get: 264 http://deb.debian.org/debian unstable/main arm64 libio-socket-ssl-perl all 2.089-1 [223 kB] Get: 265 http://deb.debian.org/debian unstable/main arm64 libnet-http-perl all 6.23-1 [23.9 kB] Get: 266 http://deb.debian.org/debian unstable/main arm64 liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 267 http://deb.debian.org/debian unstable/main arm64 libtry-tiny-perl all 0.32-1 [22.9 kB] Get: 268 http://deb.debian.org/debian unstable/main arm64 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 269 http://deb.debian.org/debian unstable/main arm64 libwww-perl all 6.77-1 [183 kB] Get: 270 http://deb.debian.org/debian unstable/main arm64 patchutils arm64 0.4.2-1+b1 [71.3 kB] Get: 271 http://deb.debian.org/debian unstable/main arm64 wdiff arm64 1.2.2-7 [121 kB] Get: 272 http://deb.debian.org/debian unstable/main arm64 devscripts all 2.25.1 [1053 kB] Get: 273 http://deb.debian.org/debian unstable/main arm64 fastjar arm64 2:0.98-7+b1 [74.9 kB] Get: 274 http://deb.debian.org/debian unstable/main arm64 ivy all 2.5.2-1 [1295 kB] Get: 275 http://deb.debian.org/debian unstable/main arm64 libasm-java all 9.7.1-1 [391 kB] Get: 276 http://deb.debian.org/debian unstable/main arm64 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 277 http://deb.debian.org/debian unstable/main arm64 libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 278 http://deb.debian.org/debian unstable/main arm64 libapache-pom-java all 33-2 [5852 B] Get: 279 http://deb.debian.org/debian unstable/main arm64 libcommons-parent-java all 56-1 [10.8 kB] Get: 280 http://deb.debian.org/debian unstable/main arm64 libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 281 http://deb.debian.org/debian unstable/main arm64 libjansi-java all 2.4.1-2 [100 kB] Get: 282 http://deb.debian.org/debian unstable/main arm64 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 283 http://deb.debian.org/debian unstable/main arm64 libqdox-java all 1.12.1-4 [173 kB] Get: 284 http://deb.debian.org/debian unstable/main arm64 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 285 http://deb.debian.org/debian unstable/main arm64 libxpp3-java all 1.1.4c-3 [292 kB] Get: 286 http://deb.debian.org/debian unstable/main arm64 libxstream-java all 1.4.21-1 [567 kB] Get: 287 http://deb.debian.org/debian unstable/main arm64 groovy all 2.4.21-10 [12.8 MB] Get: 288 http://deb.debian.org/debian unstable/main arm64 libatinject-jsr330-api-java all 1.0+ds1-6 [5112 B] Get: 289 http://deb.debian.org/debian unstable/main arm64 libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 290 http://deb.debian.org/debian unstable/main arm64 libcommons-codec-java all 1.17.1-1 [303 kB] Get: 291 http://deb.debian.org/debian unstable/main arm64 libcommons-io-java all 2.17.0-1 [488 kB] Get: 292 http://deb.debian.org/debian unstable/main arm64 libcommons-compress-java all 1.27.1-2 [641 kB] Get: 293 http://deb.debian.org/debian unstable/main arm64 libcommons-lang-java all 2.6-10 [273 kB] Get: 294 http://deb.debian.org/debian unstable/main arm64 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 295 http://deb.debian.org/debian unstable/main arm64 libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 296 http://deb.debian.org/debian unstable/main arm64 libguava-java all 32.0.1-1 [2708 kB] Get: 297 http://deb.debian.org/debian unstable/main arm64 libhttpcore-java all 4.4.16-1 [636 kB] Get: 298 http://deb.debian.org/debian unstable/main arm64 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 299 http://deb.debian.org/debian unstable/main arm64 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 300 http://deb.debian.org/debian unstable/main arm64 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 301 http://deb.debian.org/debian unstable/main arm64 libjna-jni arm64 5.15.0-1 [62.4 kB] Get: 302 http://deb.debian.org/debian unstable/main arm64 libjna-java all 5.15.0-1 [238 kB] Get: 303 http://deb.debian.org/debian unstable/main arm64 libbcprov-java all 1.77-1 [5300 kB] Get: 304 http://deb.debian.org/debian unstable/main arm64 libjunixsocket-jni arm64 2.6.1-1+b1 [18.3 kB] Get: 305 http://deb.debian.org/debian unstable/main arm64 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.29-2 [25.5 kB] Get: 306 http://deb.debian.org/debian unstable/main arm64 libjunixsocket-java all 2.6.1-1 [264 kB] Get: 307 http://deb.debian.org/debian unstable/main arm64 libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 308 http://deb.debian.org/debian unstable/main arm64 liblightcouch-java all 0.2.0-1 [75.0 kB] Get: 309 http://deb.debian.org/debian unstable/main arm64 libmongodb-java all 3.6.3-2 [1901 kB] Get: 310 http://deb.debian.org/debian unstable/main arm64 liblog4j2-java all 2.19.0-2 [2310 kB] Get: 311 http://deb.debian.org/debian unstable/main arm64 libjzlib-java all 1.1.3-3 [79.4 kB] Get: 312 http://deb.debian.org/debian unstable/main arm64 libjsch-java all 0.2.19-1 [513 kB] Get: 313 http://deb.debian.org/debian unstable/main arm64 libminlog-java all 1.3.1-1 [7808 B] Get: 314 http://deb.debian.org/debian unstable/main arm64 libobjenesis-java all 3.3-3 [41.3 kB] Get: 315 http://deb.debian.org/debian unstable/main arm64 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 316 http://deb.debian.org/debian unstable/main arm64 libkryo-java all 2.20-7 [158 kB] Get: 317 http://deb.debian.org/debian unstable/main arm64 liblogback-java all 1:1.2.11-6 [701 kB] Get: 318 http://deb.debian.org/debian unstable/main arm64 libnative-platform-jni arm64 0.14-6+b1 [11.7 kB] Get: 319 http://deb.debian.org/debian unstable/main arm64 libnative-platform-java all 0.14-6 [69.8 kB] Get: 320 http://deb.debian.org/debian unstable/main arm64 libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 321 http://deb.debian.org/debian unstable/main arm64 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 322 http://deb.debian.org/debian unstable/main arm64 libxerces2-java all 2.12.2-1 [1440 kB] Get: 323 http://deb.debian.org/debian unstable/main arm64 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 324 http://deb.debian.org/debian unstable/main arm64 libxbean-reflect-java all 4.5-9 [132 kB] Get: 325 http://deb.debian.org/debian unstable/main arm64 libgradle-core-java all 4.4.1-22 [4318 kB] Get: 326 http://deb.debian.org/debian unstable/main arm64 libbcpg-java all 1.77-1 [428 kB] Get: 327 http://deb.debian.org/debian unstable/main arm64 libbsh-java all 2.0b4-20 [291 kB] Get: 328 http://deb.debian.org/debian unstable/main arm64 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 329 http://deb.debian.org/debian unstable/main arm64 libjaxen-java all 1.1.6-5 [214 kB] Get: 330 http://deb.debian.org/debian unstable/main arm64 libdom4j-java all 2.1.4-1 [312 kB] Get: 331 http://deb.debian.org/debian unstable/main arm64 libcommons-lang3-java all 3.17.0-1 [641 kB] Get: 332 http://deb.debian.org/debian unstable/main arm64 libbcel-java all 6.10.0-1 [674 kB] Get: 333 http://deb.debian.org/debian unstable/main arm64 libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 334 http://deb.debian.org/debian unstable/main arm64 libfindbugs-java all 3.1.0~preview2-4 [3535 kB] Get: 335 http://deb.debian.org/debian unstable/main arm64 libaopalliance-java all 20070526-7 [8572 B] Get: 336 http://deb.debian.org/debian unstable/main arm64 libguice-java all 5.1.0-1 [932 kB] Get: 337 http://deb.debian.org/debian unstable/main arm64 libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 338 http://deb.debian.org/debian unstable/main arm64 libjcifs-java all 1.3.19-2 [394 kB] Get: 339 http://deb.debian.org/debian unstable/main arm64 libjavaewah-java all 1.2.3-1 [159 kB] Get: 340 http://deb.debian.org/debian unstable/main arm64 libel-api-java all 3.0.0-3 [64.9 kB] Get: 341 http://deb.debian.org/debian unstable/main arm64 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 342 http://deb.debian.org/debian unstable/main arm64 libjetty9-java all 9.4.56-1 [2964 kB] Get: 343 http://deb.debian.org/debian unstable/main arm64 libjgit-java all 6.7.0-2 [3152 kB] Get: 344 http://deb.debian.org/debian unstable/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 345 http://deb.debian.org/debian unstable/main arm64 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 346 http://deb.debian.org/debian unstable/main arm64 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 347 http://deb.debian.org/debian unstable/main arm64 libmaven-resolver-java all 1.9.22-1 [729 kB] Get: 348 http://deb.debian.org/debian unstable/main arm64 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 349 http://deb.debian.org/debian unstable/main arm64 libmaven-parent-java all 43-2 [6252 B] Get: 350 http://deb.debian.org/debian unstable/main arm64 libmaven-shared-utils-java all 3.4.2-1 [137 kB] Get: 351 http://deb.debian.org/debian unstable/main arm64 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 352 http://deb.debian.org/debian unstable/main arm64 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 353 http://deb.debian.org/debian unstable/main arm64 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 354 http://deb.debian.org/debian unstable/main arm64 libplexus-interpolation-java all 1.27-1 [76.8 kB] Get: 355 http://deb.debian.org/debian unstable/main arm64 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 356 http://deb.debian.org/debian unstable/main arm64 libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 357 http://deb.debian.org/debian unstable/main arm64 libcdi-api-java all 1.2-4 [55.3 kB] Get: 358 http://deb.debian.org/debian unstable/main arm64 libsisu-inject-java all 0.3.5-1 [352 kB] Get: 359 http://deb.debian.org/debian unstable/main arm64 libsisu-plexus-java all 0.3.5-1 [183 kB] Get: 360 http://deb.debian.org/debian unstable/main arm64 libmaven3-core-java all 3.9.9-1 [1661 kB] Get: 361 http://deb.debian.org/debian unstable/main arm64 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 362 http://deb.debian.org/debian unstable/main arm64 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 363 http://deb.debian.org/debian unstable/main arm64 librhino-java all 1.7.15-1 [1382 kB] Get: 364 http://deb.debian.org/debian unstable/main arm64 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 365 http://deb.debian.org/debian unstable/main arm64 libwagon-file-java all 3.5.3-1 [8388 B] Get: 366 http://deb.debian.org/debian unstable/main arm64 libjsoup-java all 1.15.3-1 [431 kB] Get: 367 http://deb.debian.org/debian unstable/main arm64 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 368 http://deb.debian.org/debian unstable/main arm64 libjcommander-java all 1.71-4 [73.0 kB] Get: 369 http://deb.debian.org/debian unstable/main arm64 testng all 6.9.12-4 [795 kB] Get: 370 http://deb.debian.org/debian unstable/main arm64 libgradle-plugins-java all 4.4.1-22 [5245 kB] Get: 371 http://deb.debian.org/debian unstable/main arm64 gradle all 4.4.1-22 [400 kB] Get: 372 http://deb.debian.org/debian unstable/main arm64 maven-repo-helper all 1.11 [142 kB] Get: 373 http://deb.debian.org/debian unstable/main arm64 gradle-debian-helper all 2.4 [24.5 kB] Get: 374 http://deb.debian.org/debian unstable/main arm64 jarwrapper all 0.80 [9692 B] Get: 375 http://deb.debian.org/debian unstable/main arm64 javahelper all 0.80 [80.4 kB] Get: 376 http://deb.debian.org/debian unstable/main arm64 libbyte-buddy-java all 1.14.19-1 [4756 kB] Get: 377 http://deb.debian.org/debian unstable/main arm64 libcommons-math3-java all 3.6.1-4 [2040 kB] Get: 378 http://deb.debian.org/debian unstable/main arm64 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 379 http://deb.debian.org/debian unstable/main arm64 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 380 http://deb.debian.org/debian unstable/main arm64 libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 381 http://deb.debian.org/debian unstable/main arm64 liblz4-jni arm64 1.8.0-4+b1 [10.4 kB] Get: 382 http://deb.debian.org/debian unstable/main arm64 liblz4-java all 1.8.0-4 [116 kB] Get: 383 http://deb.debian.org/debian unstable/main arm64 libmockito-java all 3.3.0-2 [510 kB] Get: 384 http://deb.debian.org/debian unstable/main arm64 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 385 http://deb.debian.org/debian unstable/main arm64 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 331 MB in 6s (58.3 MB/s) Preconfiguring packages ... Selecting previously unselected package libsystemd-shared:arm64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19965 files and directories currently installed.) Preparing to unpack .../libsystemd-shared_257.2-2_arm64.deb ... Unpacking libsystemd-shared:arm64 (257.2-2) ... Selecting previously unselected package libapparmor1:arm64. Preparing to unpack .../libapparmor1_3.1.7-1+b3_arm64.deb ... Unpacking libapparmor1:arm64 (3.1.7-1+b3) ... Setting up libsystemd-shared:arm64 (257.2-2) ... Selecting previously unselected package systemd. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19979 files and directories currently installed.) Preparing to unpack .../systemd_257.2-2_arm64.deb ... Unpacking systemd (257.2-2) ... Setting up libapparmor1:arm64 (3.1.7-1+b3) ... Setting up systemd (257.2-2) ... Created symlink '/etc/systemd/system/getty.target.wants/getty@tty1.service' -> '/usr/lib/systemd/system/getty@.service'. Created symlink '/etc/systemd/system/multi-user.target.wants/remote-fs.target' -> '/usr/lib/systemd/system/remote-fs.target'. Created symlink '/etc/systemd/system/sysinit.target.wants/systemd-pstore.service' -> '/usr/lib/systemd/system/systemd-pstore.service'. Initializing machine ID from random generator. Creating group 'systemd-journal' with GID 999. Creating group 'systemd-network' with GID 998. Creating user 'systemd-network' (systemd Network Management) with UID 998 and GID 998. /usr/lib/tmpfiles.d/legacy.conf:14: Duplicate line for path "/run/lock", ignoring. Selecting previously unselected package systemd-sysv. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20922 files and directories currently installed.) Preparing to unpack .../00-systemd-sysv_257.2-2_arm64.deb ... Unpacking systemd-sysv (257.2-2) ... Selecting previously unselected package libdbus-1-3:arm64. Preparing to unpack .../01-libdbus-1-3_1.16.0-1_arm64.deb ... Unpacking libdbus-1-3:arm64 (1.16.0-1) ... Selecting previously unselected package dbus-bin. Preparing to unpack .../02-dbus-bin_1.16.0-1_arm64.deb ... Unpacking dbus-bin (1.16.0-1) ... Selecting previously unselected package dbus-session-bus-common. Preparing to unpack .../03-dbus-session-bus-common_1.16.0-1_all.deb ... Unpacking dbus-session-bus-common (1.16.0-1) ... Selecting previously unselected package libexpat1:arm64. Preparing to unpack .../04-libexpat1_2.6.4-1_arm64.deb ... Unpacking libexpat1:arm64 (2.6.4-1) ... Selecting previously unselected package dbus-daemon. Preparing to unpack .../05-dbus-daemon_1.16.0-1_arm64.deb ... Unpacking dbus-daemon (1.16.0-1) ... Selecting previously unselected package dbus-system-bus-common. Preparing to unpack .../06-dbus-system-bus-common_1.16.0-1_all.deb ... Unpacking dbus-system-bus-common (1.16.0-1) ... Selecting previously unselected package dbus. Preparing to unpack .../07-dbus_1.16.0-1_arm64.deb ... Unpacking dbus (1.16.0-1) ... Selecting previously unselected package libpipeline1:arm64. Preparing to unpack .../08-libpipeline1_1.5.8-1_arm64.deb ... Unpacking libpipeline1:arm64 (1.5.8-1) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../09-binfmt-support_2.2.2-7+b1_arm64.deb ... Unpacking binfmt-support (2.2.2-7+b1) ... Selecting previously unselected package libpython3.13-minimal:arm64. Preparing to unpack .../10-libpython3.13-minimal_3.13.1-3_arm64.deb ... Unpacking libpython3.13-minimal:arm64 (3.13.1-3) ... Selecting previously unselected package python3.13-minimal. Preparing to unpack .../11-python3.13-minimal_3.13.1-3_arm64.deb ... Unpacking python3.13-minimal (3.13.1-3) ... Setting up libpython3.13-minimal:arm64 (3.13.1-3) ... Setting up libexpat1:arm64 (2.6.4-1) ... Setting up python3.13-minimal (3.13.1-3) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 21371 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.13.1-2_arm64.deb ... Unpacking python3-minimal (3.13.1-2) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2025a-1_all.deb ... Unpacking tzdata (2025a-1) ... Selecting previously unselected package libffi8:arm64. Preparing to unpack .../4-libffi8_3.4.6-1_arm64.deb ... Unpacking libffi8:arm64 (3.4.6-1) ... Selecting previously unselected package readline-common. Preparing to unpack .../5-readline-common_8.2-6_all.deb ... Unpacking readline-common (8.2-6) ... Selecting previously unselected package libreadline8t64:arm64. Preparing to unpack .../6-libreadline8t64_8.2-6_arm64.deb ... Adding 'diversion of /lib/aarch64-linux-gnu/libhistory.so.8 to /lib/aarch64-linux-gnu/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libhistory.so.8.2 to /lib/aarch64-linux-gnu/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libreadline.so.8 to /lib/aarch64-linux-gnu/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libreadline.so.8.2 to /lib/aarch64-linux-gnu/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:arm64 (8.2-6) ... Selecting previously unselected package libpython3.13-stdlib:arm64. Preparing to unpack .../7-libpython3.13-stdlib_3.13.1-3_arm64.deb ... Unpacking libpython3.13-stdlib:arm64 (3.13.1-3) ... Selecting previously unselected package python3.13. Preparing to unpack .../8-python3.13_3.13.1-3_arm64.deb ... Unpacking python3.13 (3.13.1-3) ... Selecting previously unselected package libpython3-stdlib:arm64. Preparing to unpack .../9-libpython3-stdlib_3.13.1-2_arm64.deb ... Unpacking libpython3-stdlib:arm64 (3.13.1-2) ... Setting up python3-minimal (3.13.1-2) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 22381 files and directories currently installed.) Preparing to unpack .../000-python3_3.13.1-2_arm64.deb ... Unpacking python3 (3.13.1-2) ... Selecting previously unselected package libproc2-0:arm64. Preparing to unpack .../001-libproc2-0_2%3a4.0.4-6_arm64.deb ... Unpacking libproc2-0:arm64 (2:4.0.4-6) ... Selecting previously unselected package procps. Preparing to unpack .../002-procps_2%3a4.0.4-6_arm64.deb ... Unpacking procps (2:4.0.4-6) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../003-sensible-utils_0.0.24_all.deb ... Unpacking sensible-utils (0.0.24) ... Selecting previously unselected package openssl. Preparing to unpack .../004-openssl_3.4.0-2_arm64.deb ... Unpacking openssl (3.4.0-2) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../005-ca-certificates_20241223_all.deb ... Unpacking ca-certificates (20241223) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../006-libmagic-mgc_1%3a5.45-3+b1_arm64.deb ... Unpacking libmagic-mgc (1:5.45-3+b1) ... Selecting previously unselected package libmagic1t64:arm64. Preparing to unpack .../007-libmagic1t64_1%3a5.45-3+b1_arm64.deb ... Unpacking libmagic1t64:arm64 (1:5.45-3+b1) ... Selecting previously unselected package file. Preparing to unpack .../008-file_1%3a5.45-3+b1_arm64.deb ... Unpacking file (1:5.45-3+b1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../009-gettext-base_0.23.1-1_arm64.deb ... Unpacking gettext-base (0.23.1-1) ... Selecting previously unselected package libuchardet0:arm64. Preparing to unpack .../010-libuchardet0_0.0.8-1+b2_arm64.deb ... Unpacking libuchardet0:arm64 (0.0.8-1+b2) ... Selecting previously unselected package groff-base. Preparing to unpack .../011-groff-base_1.23.0-7_arm64.deb ... Unpacking groff-base (1.23.0-7) ... Selecting previously unselected package libpam-systemd:arm64. Preparing to unpack .../012-libpam-systemd_257.2-2_arm64.deb ... Unpacking libpam-systemd:arm64 (257.2-2) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../013-bsdextrautils_2.40.4-1_arm64.deb ... Unpacking bsdextrautils (2.40.4-1) ... Selecting previously unselected package man-db. Preparing to unpack .../014-man-db_2.13.0-1_arm64.deb ... Unpacking man-db (2.13.0-1) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.12+dfsg-1_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... Selecting previously unselected package libglib2.0-0t64:arm64. Preparing to unpack .../016-libglib2.0-0t64_2.82.4-2_arm64.deb ... Unpacking libglib2.0-0t64:arm64 (2.82.4-2) ... Selecting previously unselected package libicu72:arm64. Preparing to unpack .../017-libicu72_72.1-6_arm64.deb ... Unpacking libicu72:arm64 (72.1-6) ... Selecting previously unselected package libxml2:arm64. Preparing to unpack .../018-libxml2_2.12.7+dfsg+really2.9.14-0.2+b1_arm64.deb ... Unpacking libxml2:arm64 (2.12.7+dfsg+really2.9.14-0.2+b1) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.4-5+b1_arm64.deb ... Unpacking shared-mime-info (2.4-5+b1) ... Selecting previously unselected package libjpeg62-turbo:arm64. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-3+b1_arm64.deb ... Unpacking libjpeg62-turbo:arm64 (1:2.1.5-3+b1) ... Selecting previously unselected package libpng16-16t64:arm64. Preparing to unpack .../021-libpng16-16t64_1.6.45-1_arm64.deb ... Unpacking libpng16-16t64:arm64 (1.6.45-1) ... Selecting previously unselected package libdeflate0:arm64. Preparing to unpack .../022-libdeflate0_1.23-1+b1_arm64.deb ... Unpacking libdeflate0:arm64 (1.23-1+b1) ... Selecting previously unselected package libjbig0:arm64. Preparing to unpack .../023-libjbig0_2.1-6.1+b2_arm64.deb ... Unpacking libjbig0:arm64 (2.1-6.1+b2) ... Selecting previously unselected package liblerc4:arm64. Preparing to unpack .../024-liblerc4_4.0.0+ds-5_arm64.deb ... Unpacking liblerc4:arm64 (4.0.0+ds-5) ... Selecting previously unselected package libsharpyuv0:arm64. Preparing to unpack .../025-libsharpyuv0_1.5.0-0.1_arm64.deb ... Unpacking libsharpyuv0:arm64 (1.5.0-0.1) ... Selecting previously unselected package libwebp7:arm64. Preparing to unpack .../026-libwebp7_1.5.0-0.1_arm64.deb ... Unpacking libwebp7:arm64 (1.5.0-0.1) ... Selecting previously unselected package libtiff6:arm64. Preparing to unpack .../027-libtiff6_4.5.1+git230720-5_arm64.deb ... Unpacking libtiff6:arm64 (4.5.1+git230720-5) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64. Preparing to unpack .../028-libgdk-pixbuf-2.0-0_2.42.12+dfsg-1+b1_arm64.deb ... Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.12+dfsg-1+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../029-gtk-update-icon-cache_4.16.12+ds-1_arm64.deb ... No diversion 'diversion of /usr/sbin/update-icon-caches to /usr/sbin/update-icon-caches.gtk2 by libgtk-3-bin', none removed. No diversion 'diversion of /usr/share/man/man8/update-icon-caches.8.gz to /usr/share/man/man8/update-icon-caches.gtk2.8.gz by libgtk-3-bin', none removed. Unpacking gtk-update-icon-cache (4.16.12+ds-1) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../030-hicolor-icon-theme_0.18-1_all.deb ... Unpacking hicolor-icon-theme (0.18-1) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../031-adwaita-icon-theme_47.0-2_all.deb ... Unpacking adwaita-icon-theme (47.0-2) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../032-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../033-java-common_0.76_all.deb ... Unpacking java-common (0.76) ... Selecting previously unselected package liblcms2-2:arm64. Preparing to unpack .../034-liblcms2-2_2.16-2_arm64.deb ... Unpacking liblcms2-2:arm64 (2.16-2) ... Selecting previously unselected package libnspr4:arm64. Preparing to unpack .../035-libnspr4_2%3a4.36-1_arm64.deb ... Unpacking libnspr4:arm64 (2:4.36-1) ... Selecting previously unselected package libnss3:arm64. Preparing to unpack .../036-libnss3_2%3a3.107-1_arm64.deb ... Unpacking libnss3:arm64 (2:3.107-1) ... Selecting previously unselected package libpcsclite1:arm64. Preparing to unpack .../037-libpcsclite1_2.3.1-1_arm64.deb ... Unpacking libpcsclite1:arm64 (2.3.1-1) ... Selecting previously unselected package openjdk-21-jre-headless:arm64. Preparing to unpack .../038-openjdk-21-jre-headless_21.0.6~6ea-1_arm64.deb ... Unpacking openjdk-21-jre-headless:arm64 (21.0.6~6ea-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../039-default-jre-headless_2%3a1.21-76_arm64.deb ... Unpacking default-jre-headless (2:1.21-76) ... Selecting previously unselected package ant. Preparing to unpack .../040-ant_1.10.15-1_all.deb ... Unpacking ant (1.10.15-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../041-ant-optional_1.10.15-1_all.deb ... Unpacking ant-optional (1.10.15-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../042-libantlr-java_2.7.7+dfsg-14_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-14) ... Selecting previously unselected package antlr. Preparing to unpack .../043-antlr_2.7.7+dfsg-14_all.deb ... Unpacking antlr (2.7.7+dfsg-14) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../044-at-spi2-common_2.55.0.1-1_all.deb ... Unpacking at-spi2-common (2.55.0.1-1) ... Selecting previously unselected package m4. Preparing to unpack .../045-m4_1.4.19-5_arm64.deb ... Unpacking m4 (1.4.19-5) ... Selecting previously unselected package autoconf. Preparing to unpack .../046-autoconf_2.72-3_all.deb ... Unpacking autoconf (2.72-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../047-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../048-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../049-autopoint_0.23.1-1_all.deb ... Unpacking autopoint (0.23.1-1) ... Selecting previously unselected package unzip. Preparing to unpack .../050-unzip_6.0-28+b1_arm64.deb ... Unpacking unzip (6.0-28+b1) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../051-java-wrappers_0.5_all.deb ... Unpacking java-wrappers (0.5) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../052-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../053-junit4_4.13.2-5_all.deb ... Unpacking junit4 (4.13.2-5) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../054-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../055-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../056-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../057-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../058-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../059-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../060-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../061-libjansi1-java_1.18-3.1_all.deb ... Unpacking libjansi1-java (1.18-3.1) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../062-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../063-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../064-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../065-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../066-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../067-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dbus-user-session. Preparing to unpack .../068-dbus-user-session_1.16.0-1_arm64.deb ... Unpacking dbus-user-session (1.16.0-1) ... Selecting previously unselected package libdconf1:arm64. Preparing to unpack .../069-libdconf1_0.40.0-5_arm64.deb ... Unpacking libdconf1:arm64 (0.40.0-5) ... Selecting previously unselected package dconf-service. Preparing to unpack .../070-dconf-service_0.40.0-5_arm64.deb ... Unpacking dconf-service (0.40.0-5) ... Selecting previously unselected package dconf-gsettings-backend:arm64. Preparing to unpack .../071-dconf-gsettings-backend_0.40.0-5_arm64.deb ... Unpacking dconf-gsettings-backend:arm64 (0.40.0-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../072-dctrl-tools_2.24-3+b1_arm64.deb ... Unpacking dctrl-tools (2.24-3+b1) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../073-libdebhelper-perl_13.24.1_all.deb ... Unpacking libdebhelper-perl (13.24.1) ... Selecting previously unselected package libtool. Preparing to unpack .../074-libtool_2.5.4-2_all.deb ... Unpacking libtool (2.5.4-2) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../075-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../076-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../077-libfile-stripnondeterminism-perl_1.14.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.14.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../078-dh-strip-nondeterminism_1.14.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.14.0-1) ... Selecting previously unselected package libelf1t64:arm64. Preparing to unpack .../079-libelf1t64_0.192-4_arm64.deb ... Unpacking libelf1t64:arm64 (0.192-4) ... Selecting previously unselected package dwz. Preparing to unpack .../080-dwz_0.15-1+b1_arm64.deb ... Unpacking dwz (0.15-1+b1) ... Selecting previously unselected package libunistring5:arm64. Preparing to unpack .../081-libunistring5_1.3-1_arm64.deb ... Unpacking libunistring5:arm64 (1.3-1) ... Selecting previously unselected package gettext. Preparing to unpack .../082-gettext_0.23.1-1_arm64.deb ... Unpacking gettext (0.23.1-1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../083-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../084-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../085-debhelper_13.24.1_all.deb ... Unpacking debhelper (13.24.1) ... Selecting previously unselected package libatk1.0-0t64:arm64. Preparing to unpack .../086-libatk1.0-0t64_2.55.0.1-1_arm64.deb ... Unpacking libatk1.0-0t64:arm64 (2.55.0.1-1) ... Selecting previously unselected package libxau6:arm64. Preparing to unpack .../087-libxau6_1%3a1.0.11-1_arm64.deb ... Unpacking libxau6:arm64 (1:1.0.11-1) ... Selecting previously unselected package libxdmcp6:arm64. Preparing to unpack .../088-libxdmcp6_1%3a1.1.5-1_arm64.deb ... Unpacking libxdmcp6:arm64 (1:1.1.5-1) ... Selecting previously unselected package libxcb1:arm64. Preparing to unpack .../089-libxcb1_1.17.0-2+b1_arm64.deb ... Unpacking libxcb1:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../090-libx11-data_2%3a1.8.10-2_all.deb ... Unpacking libx11-data (2:1.8.10-2) ... Selecting previously unselected package libx11-6:arm64. Preparing to unpack .../091-libx11-6_2%3a1.8.10-2_arm64.deb ... Unpacking libx11-6:arm64 (2:1.8.10-2) ... Selecting previously unselected package libxext6:arm64. Preparing to unpack .../092-libxext6_2%3a1.3.4-1+b3_arm64.deb ... Unpacking libxext6:arm64 (2:1.3.4-1+b3) ... Selecting previously unselected package libxi6:arm64. Preparing to unpack .../093-libxi6_2%3a1.8.2-1_arm64.deb ... Unpacking libxi6:arm64 (2:1.8.2-1) ... Selecting previously unselected package libatspi2.0-0t64:arm64. Preparing to unpack .../094-libatspi2.0-0t64_2.55.0.1-1_arm64.deb ... Unpacking libatspi2.0-0t64:arm64 (2.55.0.1-1) ... Selecting previously unselected package libatk-bridge2.0-0t64:arm64. Preparing to unpack .../095-libatk-bridge2.0-0t64_2.55.0.1-1_arm64.deb ... Unpacking libatk-bridge2.0-0t64:arm64 (2.55.0.1-1) ... Selecting previously unselected package libbrotli1:arm64. Preparing to unpack .../096-libbrotli1_1.1.0-2+b6_arm64.deb ... Unpacking libbrotli1:arm64 (1.1.0-2+b6) ... Selecting previously unselected package libfreetype6:arm64. Preparing to unpack .../097-libfreetype6_2.13.3+dfsg-1_arm64.deb ... Unpacking libfreetype6:arm64 (2.13.3+dfsg-1) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../098-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../099-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../100-fontconfig-config_2.15.0-2_arm64.deb ... Unpacking fontconfig-config (2.15.0-2) ... Selecting previously unselected package libfontconfig1:arm64. Preparing to unpack .../101-libfontconfig1_2.15.0-2_arm64.deb ... Unpacking libfontconfig1:arm64 (2.15.0-2) ... Selecting previously unselected package libpixman-1-0:arm64. Preparing to unpack .../102-libpixman-1-0_0.44.0-3_arm64.deb ... Unpacking libpixman-1-0:arm64 (0.44.0-3) ... Selecting previously unselected package libxcb-render0:arm64. Preparing to unpack .../103-libxcb-render0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-render0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-shm0:arm64. Preparing to unpack .../104-libxcb-shm0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-shm0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxrender1:arm64. Preparing to unpack .../105-libxrender1_1%3a0.9.10-1.1+b3_arm64.deb ... Unpacking libxrender1:arm64 (1:0.9.10-1.1+b3) ... Selecting previously unselected package libcairo2:arm64. Preparing to unpack .../106-libcairo2_1.18.2-2_arm64.deb ... Unpacking libcairo2:arm64 (1.18.2-2) ... Selecting previously unselected package libcairo-gobject2:arm64. Preparing to unpack .../107-libcairo-gobject2_1.18.2-2_arm64.deb ... Unpacking libcairo-gobject2:arm64 (1.18.2-2) ... Selecting previously unselected package libcloudproviders0:arm64. Preparing to unpack .../108-libcloudproviders0_0.3.6-1+b1_arm64.deb ... Unpacking libcloudproviders0:arm64 (0.3.6-1+b1) ... Selecting previously unselected package libcolord2:arm64. Preparing to unpack .../109-libcolord2_1.4.7-1+b2_arm64.deb ... Unpacking libcolord2:arm64 (1.4.7-1+b2) ... Selecting previously unselected package libavahi-common-data:arm64. Preparing to unpack .../110-libavahi-common-data_0.8-16_arm64.deb ... Unpacking libavahi-common-data:arm64 (0.8-16) ... Selecting previously unselected package libavahi-common3:arm64. Preparing to unpack .../111-libavahi-common3_0.8-16_arm64.deb ... Unpacking libavahi-common3:arm64 (0.8-16) ... Selecting previously unselected package libavahi-client3:arm64. Preparing to unpack .../112-libavahi-client3_0.8-16_arm64.deb ... Unpacking libavahi-client3:arm64 (0.8-16) ... Selecting previously unselected package libidn2-0:arm64. Preparing to unpack .../113-libidn2-0_2.3.7-2+b1_arm64.deb ... Unpacking libidn2-0:arm64 (2.3.7-2+b1) ... Selecting previously unselected package libp11-kit0:arm64. Preparing to unpack .../114-libp11-kit0_0.25.5-3_arm64.deb ... Unpacking libp11-kit0:arm64 (0.25.5-3) ... Selecting previously unselected package libtasn1-6:arm64. Preparing to unpack .../115-libtasn1-6_4.19.0-3+b3_arm64.deb ... Unpacking libtasn1-6:arm64 (4.19.0-3+b3) ... Selecting previously unselected package libgnutls30t64:arm64. Preparing to unpack .../116-libgnutls30t64_3.8.8-2_arm64.deb ... Unpacking libgnutls30t64:arm64 (3.8.8-2) ... Selecting previously unselected package libkrb5support0:arm64. Preparing to unpack .../117-libkrb5support0_1.21.3-4_arm64.deb ... Unpacking libkrb5support0:arm64 (1.21.3-4) ... Selecting previously unselected package libcom-err2:arm64. Preparing to unpack .../118-libcom-err2_1.47.2-1_arm64.deb ... Unpacking libcom-err2:arm64 (1.47.2-1) ... Selecting previously unselected package libk5crypto3:arm64. Preparing to unpack .../119-libk5crypto3_1.21.3-4_arm64.deb ... Unpacking libk5crypto3:arm64 (1.21.3-4) ... Selecting previously unselected package libkeyutils1:arm64. Preparing to unpack .../120-libkeyutils1_1.6.3-4_arm64.deb ... Unpacking libkeyutils1:arm64 (1.6.3-4) ... Selecting previously unselected package libkrb5-3:arm64. Preparing to unpack .../121-libkrb5-3_1.21.3-4_arm64.deb ... Unpacking libkrb5-3:arm64 (1.21.3-4) ... Selecting previously unselected package libgssapi-krb5-2:arm64. Preparing to unpack .../122-libgssapi-krb5-2_1.21.3-4_arm64.deb ... Unpacking libgssapi-krb5-2:arm64 (1.21.3-4) ... Selecting previously unselected package libcups2t64:arm64. Preparing to unpack .../123-libcups2t64_2.4.10-2+b1_arm64.deb ... Unpacking libcups2t64:arm64 (2.4.10-2+b1) ... Selecting previously unselected package libepoxy0:arm64. Preparing to unpack .../124-libepoxy0_1.5.10-2_arm64.deb ... Unpacking libepoxy0:arm64 (1.5.10-2) ... Selecting previously unselected package libfribidi0:arm64. Preparing to unpack .../125-libfribidi0_1.0.16-1_arm64.deb ... Unpacking libfribidi0:arm64 (1.0.16-1) ... Selecting previously unselected package libgraphite2-3:arm64. Preparing to unpack .../126-libgraphite2-3_1.3.14-2+b1_arm64.deb ... Unpacking libgraphite2-3:arm64 (1.3.14-2+b1) ... Selecting previously unselected package libharfbuzz0b:arm64. Preparing to unpack .../127-libharfbuzz0b_10.2.0-1_arm64.deb ... Unpacking libharfbuzz0b:arm64 (10.2.0-1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../128-fontconfig_2.15.0-2_arm64.deb ... Unpacking fontconfig (2.15.0-2) ... Selecting previously unselected package libthai-data. Preparing to unpack .../129-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:arm64. Preparing to unpack .../130-libdatrie1_0.2.13-3+b1_arm64.deb ... Unpacking libdatrie1:arm64 (0.2.13-3+b1) ... Selecting previously unselected package libthai0:arm64. Preparing to unpack .../131-libthai0_0.1.29-2+b1_arm64.deb ... Unpacking libthai0:arm64 (0.1.29-2+b1) ... Selecting previously unselected package libpango-1.0-0:arm64. Preparing to unpack .../132-libpango-1.0-0_1.56.1-1_arm64.deb ... Unpacking libpango-1.0-0:arm64 (1.56.1-1) ... Selecting previously unselected package libpangoft2-1.0-0:arm64. Preparing to unpack .../133-libpangoft2-1.0-0_1.56.1-1_arm64.deb ... Unpacking libpangoft2-1.0-0:arm64 (1.56.1-1) ... Selecting previously unselected package libpangocairo-1.0-0:arm64. Preparing to unpack .../134-libpangocairo-1.0-0_1.56.1-1_arm64.deb ... Unpacking libpangocairo-1.0-0:arm64 (1.56.1-1) ... Selecting previously unselected package libwayland-client0:arm64. Preparing to unpack .../135-libwayland-client0_1.23.0-1+b1_arm64.deb ... Unpacking libwayland-client0:arm64 (1.23.0-1+b1) ... Selecting previously unselected package libwayland-cursor0:arm64. Preparing to unpack .../136-libwayland-cursor0_1.23.0-1+b1_arm64.deb ... Unpacking libwayland-cursor0:arm64 (1.23.0-1+b1) ... Selecting previously unselected package libwayland-egl1:arm64. Preparing to unpack .../137-libwayland-egl1_1.23.0-1+b1_arm64.deb ... Unpacking libwayland-egl1:arm64 (1.23.0-1+b1) ... Selecting previously unselected package libxcomposite1:arm64. Preparing to unpack .../138-libxcomposite1_1%3a0.4.6-1_arm64.deb ... Unpacking libxcomposite1:arm64 (1:0.4.6-1) ... Selecting previously unselected package libxfixes3:arm64. Preparing to unpack .../139-libxfixes3_1%3a6.0.0-2+b3_arm64.deb ... Unpacking libxfixes3:arm64 (1:6.0.0-2+b3) ... Selecting previously unselected package libxcursor1:arm64. Preparing to unpack .../140-libxcursor1_1%3a1.2.3-1_arm64.deb ... Unpacking libxcursor1:arm64 (1:1.2.3-1) ... Selecting previously unselected package libxdamage1:arm64. Preparing to unpack .../141-libxdamage1_1%3a1.1.6-1+b2_arm64.deb ... Unpacking libxdamage1:arm64 (1:1.1.6-1+b2) ... Selecting previously unselected package libxinerama1:arm64. Preparing to unpack .../142-libxinerama1_2%3a1.1.4-3+b3_arm64.deb ... Unpacking libxinerama1:arm64 (2:1.1.4-3+b3) ... Selecting previously unselected package xkb-data. Preparing to unpack .../143-xkb-data_2.42-1_all.deb ... Unpacking xkb-data (2.42-1) ... Selecting previously unselected package libxkbcommon0:arm64. Preparing to unpack .../144-libxkbcommon0_1.7.0-2_arm64.deb ... Unpacking libxkbcommon0:arm64 (1.7.0-2) ... Selecting previously unselected package libxrandr2:arm64. Preparing to unpack .../145-libxrandr2_2%3a1.5.4-1+b2_arm64.deb ... Unpacking libxrandr2:arm64 (2:1.5.4-1+b2) ... Selecting previously unselected package libgtk-3-common. Preparing to unpack .../146-libgtk-3-common_3.24.43-5_all.deb ... Unpacking libgtk-3-common (3.24.43-5) ... Selecting previously unselected package libgtk-3-0t64:arm64. Preparing to unpack .../147-libgtk-3-0t64_3.24.43-5_arm64.deb ... Unpacking libgtk-3-0t64:arm64 (3.24.43-5) ... Selecting previously unselected package libglvnd0:arm64. Preparing to unpack .../148-libglvnd0_1.7.0-1+b2_arm64.deb ... Unpacking libglvnd0:arm64 (1.7.0-1+b2) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../149-libdrm-common_2.4.123-1_all.deb ... Unpacking libdrm-common (2.4.123-1) ... Selecting previously unselected package libdrm2:arm64. Preparing to unpack .../150-libdrm2_2.4.123-1_arm64.deb ... Unpacking libdrm2:arm64 (2.4.123-1) ... Selecting previously unselected package libglapi-mesa:arm64. Preparing to unpack .../151-libglapi-mesa_24.3.3-1_arm64.deb ... Unpacking libglapi-mesa:arm64 (24.3.3-1) ... Selecting previously unselected package libx11-xcb1:arm64. Preparing to unpack .../152-libx11-xcb1_2%3a1.8.10-2_arm64.deb ... Unpacking libx11-xcb1:arm64 (2:1.8.10-2) ... Selecting previously unselected package libxcb-dri3-0:arm64. Preparing to unpack .../153-libxcb-dri3-0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-dri3-0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-glx0:arm64. Preparing to unpack .../154-libxcb-glx0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-glx0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-present0:arm64. Preparing to unpack .../155-libxcb-present0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-present0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-xfixes0:arm64. Preparing to unpack .../156-libxcb-xfixes0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-xfixes0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxxf86vm1:arm64. Preparing to unpack .../157-libxxf86vm1_1%3a1.1.4-1+b4_arm64.deb ... Unpacking libxxf86vm1:arm64 (1:1.1.4-1+b4) ... Selecting previously unselected package libdrm-amdgpu1:arm64. Preparing to unpack .../158-libdrm-amdgpu1_2.4.123-1_arm64.deb ... Unpacking libdrm-amdgpu1:arm64 (2.4.123-1) ... Selecting previously unselected package libdrm-radeon1:arm64. Preparing to unpack .../159-libdrm-radeon1_2.4.123-1_arm64.deb ... Unpacking libdrm-radeon1:arm64 (2.4.123-1) ... Selecting previously unselected package libedit2:arm64. Preparing to unpack .../160-libedit2_3.1-20250104-1_arm64.deb ... Unpacking libedit2:arm64 (3.1-20250104-1) ... Selecting previously unselected package libz3-4:arm64. Preparing to unpack .../161-libz3-4_4.13.3-1_arm64.deb ... Unpacking libz3-4:arm64 (4.13.3-1) ... Selecting previously unselected package libllvm19:arm64. Preparing to unpack .../162-libllvm19_1%3a19.1.7-1_arm64.deb ... Unpacking libllvm19:arm64 (1:19.1.7-1) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../163-libsensors-config_1%3a3.6.0-10_all.deb ... Unpacking libsensors-config (1:3.6.0-10) ... Selecting previously unselected package libsensors5:arm64. Preparing to unpack .../164-libsensors5_1%3a3.6.0-10+b1_arm64.deb ... Unpacking libsensors5:arm64 (1:3.6.0-10+b1) ... Selecting previously unselected package libxcb-randr0:arm64. Preparing to unpack .../165-libxcb-randr0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-randr0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-sync1:arm64. Preparing to unpack .../166-libxcb-sync1_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-sync1:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxshmfence1:arm64. Preparing to unpack .../167-libxshmfence1_1.3-1+b3_arm64.deb ... Unpacking libxshmfence1:arm64 (1.3-1+b3) ... Selecting previously unselected package mesa-libgallium:arm64. Preparing to unpack .../168-mesa-libgallium_24.3.3-1_arm64.deb ... Unpacking mesa-libgallium:arm64 (24.3.3-1) ... Selecting previously unselected package libvulkan1:arm64. Preparing to unpack .../169-libvulkan1_1.4.304.0-1_arm64.deb ... Unpacking libvulkan1:arm64 (1.4.304.0-1) ... Selecting previously unselected package libwayland-server0:arm64. Preparing to unpack .../170-libwayland-server0_1.23.0-1+b1_arm64.deb ... Unpacking libwayland-server0:arm64 (1.23.0-1+b1) ... Selecting previously unselected package libgbm1:arm64. Preparing to unpack .../171-libgbm1_24.3.3-1_arm64.deb ... Unpacking libgbm1:arm64 (24.3.3-1) ... Selecting previously unselected package libgl1-mesa-dri:arm64. Preparing to unpack .../172-libgl1-mesa-dri_24.3.3-1_arm64.deb ... Unpacking libgl1-mesa-dri:arm64 (24.3.3-1) ... Selecting previously unselected package libglx-mesa0:arm64. Preparing to unpack .../173-libglx-mesa0_24.3.3-1_arm64.deb ... Unpacking libglx-mesa0:arm64 (24.3.3-1) ... Selecting previously unselected package libglx0:arm64. Preparing to unpack .../174-libglx0_1.7.0-1+b2_arm64.deb ... Unpacking libglx0:arm64 (1.7.0-1+b2) ... Selecting previously unselected package libgl1:arm64. Preparing to unpack .../175-libgl1_1.7.0-1+b2_arm64.deb ... Unpacking libgl1:arm64 (1.7.0-1+b2) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../176-libasound2-data_1.2.13-1_all.deb ... Unpacking libasound2-data (1.2.13-1) ... Selecting previously unselected package libasound2t64:arm64. Preparing to unpack .../177-libasound2t64_1.2.13-1+b1_arm64.deb ... Unpacking libasound2t64:arm64 (1.2.13-1+b1) ... Selecting previously unselected package libgif7:arm64. Preparing to unpack .../178-libgif7_5.2.2-1+b1_arm64.deb ... Unpacking libgif7:arm64 (5.2.2-1+b1) ... Selecting previously unselected package x11-common. Preparing to unpack .../179-x11-common_1%3a7.7+23.2_all.deb ... Unpacking x11-common (1:7.7+23.2) ... Selecting previously unselected package libxtst6:arm64. Preparing to unpack .../180-libxtst6_2%3a1.2.3-1.1+b3_arm64.deb ... Unpacking libxtst6:arm64 (2:1.2.3-1.1+b3) ... Selecting previously unselected package openjdk-21-jre:arm64. Preparing to unpack .../181-openjdk-21-jre_21.0.6~6ea-1_arm64.deb ... Unpacking openjdk-21-jre:arm64 (21.0.6~6ea-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../182-default-jre_2%3a1.21-76_arm64.deb ... Unpacking default-jre (2:1.21-76) ... Selecting previously unselected package openjdk-21-jdk-headless:arm64. Preparing to unpack .../183-openjdk-21-jdk-headless_21.0.6~6ea-1_arm64.deb ... Unpacking openjdk-21-jdk-headless:arm64 (21.0.6~6ea-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../184-default-jdk-headless_2%3a1.21-76_arm64.deb ... Unpacking default-jdk-headless (2:1.21-76) ... Selecting previously unselected package openjdk-21-jdk:arm64. Preparing to unpack .../185-openjdk-21-jdk_21.0.6~6ea-1_arm64.deb ... Unpacking openjdk-21-jdk:arm64 (21.0.6~6ea-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../186-default-jdk_2%3a1.21-76_arm64.deb ... Unpacking default-jdk (2:1.21-76) ... Selecting previously unselected package libgpg-error0:arm64. Preparing to unpack .../187-libgpg-error0_1.51-3_arm64.deb ... Unpacking libgpg-error0:arm64 (1.51-3) ... Selecting previously unselected package libassuan9:arm64. Preparing to unpack .../188-libassuan9_3.0.1-2_arm64.deb ... Unpacking libassuan9:arm64 (3.0.1-2) ... Selecting previously unselected package libgcrypt20:arm64. Preparing to unpack .../189-libgcrypt20_1.11.0-7_arm64.deb ... Unpacking libgcrypt20:arm64 (1.11.0-7) ... Selecting previously unselected package gpgconf. Preparing to unpack .../190-gpgconf_2.2.46-1+b1_arm64.deb ... Unpacking gpgconf (2.2.46-1+b1) ... Selecting previously unselected package libksba8:arm64. Preparing to unpack .../191-libksba8_1.6.7-2+b1_arm64.deb ... Unpacking libksba8:arm64 (1.6.7-2+b1) ... Selecting previously unselected package libsasl2-modules-db:arm64. Preparing to unpack .../192-libsasl2-modules-db_2.1.28+dfsg1-8+b1_arm64.deb ... Unpacking libsasl2-modules-db:arm64 (2.1.28+dfsg1-8+b1) ... Selecting previously unselected package libsasl2-2:arm64. Preparing to unpack .../193-libsasl2-2_2.1.28+dfsg1-8+b1_arm64.deb ... Unpacking libsasl2-2:arm64 (2.1.28+dfsg1-8+b1) ... Selecting previously unselected package libldap2:arm64. Preparing to unpack .../194-libldap2_2.6.9+dfsg-1_arm64.deb ... Unpacking libldap2:arm64 (2.6.9+dfsg-1) ... Selecting previously unselected package libnpth0t64:arm64. Preparing to unpack .../195-libnpth0t64_1.8-2_arm64.deb ... Unpacking libnpth0t64:arm64 (1.8-2) ... Selecting previously unselected package dirmngr. Preparing to unpack .../196-dirmngr_2.2.46-1+b1_arm64.deb ... Unpacking dirmngr (2.2.46-1+b1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../197-gnupg-l10n_2.2.46-1_all.deb ... Unpacking gnupg-l10n (2.2.46-1) ... Selecting previously unselected package gpg. Preparing to unpack .../198-gpg_2.2.46-1+b1_arm64.deb ... Unpacking gpg (2.2.46-1+b1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../199-pinentry-curses_1.3.1-2_arm64.deb ... Unpacking pinentry-curses (1.3.1-2) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../200-gpg-agent_2.2.46-1+b1_arm64.deb ... Unpacking gpg-agent (2.2.46-1+b1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../201-gpgsm_2.2.46-1+b1_arm64.deb ... Unpacking gpgsm (2.2.46-1+b1) ... Selecting previously unselected package gnupg. Preparing to unpack .../202-gnupg_2.2.46-1_all.deb ... Unpacking gnupg (2.2.46-1) ... Selecting previously unselected package gpgv. Preparing to unpack .../203-gpgv_2.2.46-1+b1_arm64.deb ... Unpacking gpgv (2.2.46-1+b1) ... Selecting previously unselected package sopv-gpgv. Preparing to unpack .../204-sopv-gpgv_0.1.1-1_all.deb ... Unpacking sopv-gpgv (0.1.1-1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../205-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../206-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../207-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../208-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../209-libio-pty-perl_1%3a1.20-1+b2_arm64.deb ... Unpacking libio-pty-perl (1:1.20-1+b2) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../210-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../211-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../212-libclass-xsaccessor-perl_1.19-4+b4_arm64.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b4) ... Selecting previously unselected package libb-hooks-op-check-perl:arm64. Preparing to unpack .../213-libb-hooks-op-check-perl_0.22-3+b2_arm64.deb ... Unpacking libb-hooks-op-check-perl:arm64 (0.22-3+b2) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../214-libdynaloader-functions-perl_0.004-1_all.deb ... Unpacking libdynaloader-functions-perl (0.004-1) ... Selecting previously unselected package libdevel-callchecker-perl:arm64. Preparing to unpack .../215-libdevel-callchecker-perl_0.009-1+b1_arm64.deb ... Unpacking libdevel-callchecker-perl:arm64 (0.009-1+b1) ... Selecting previously unselected package libparams-classify-perl:arm64. Preparing to unpack .../216-libparams-classify-perl_0.015-2+b4_arm64.deb ... Unpacking libparams-classify-perl:arm64 (0.015-2+b4) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../217-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../218-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../219-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../220-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../221-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../222-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../223-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../224-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../225-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../226-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../227-liburi-perl_5.30-1_all.deb ... Unpacking liburi-perl (5.30-1) ... Selecting previously unselected package libhtml-parser-perl:arm64. Preparing to unpack .../228-libhtml-parser-perl_3.83-1+b2_arm64.deb ... Unpacking libhtml-parser-perl:arm64 (3.83-1+b2) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../229-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:arm64. Preparing to unpack .../230-libclone-perl_0.47-1+b1_arm64.deb ... Unpacking libclone-perl:arm64 (0.47-1+b1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../231-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../232-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../233-libhttp-message-perl_7.00-2_all.deb ... Unpacking libhttp-message-perl (7.00-2) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../234-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../235-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:arm64. Preparing to unpack .../236-perl-openssl-defaults_7+b2_arm64.deb ... Unpacking perl-openssl-defaults:arm64 (7+b2) ... Selecting previously unselected package libnet-ssleay-perl:arm64. Preparing to unpack .../237-libnet-ssleay-perl_1.94-2_arm64.deb ... Unpacking libnet-ssleay-perl:arm64 (1.94-2) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../238-libio-socket-ssl-perl_2.089-1_all.deb ... Unpacking libio-socket-ssl-perl (2.089-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../239-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../240-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../241-libtry-tiny-perl_0.32-1_all.deb ... Unpacking libtry-tiny-perl (0.32-1) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../242-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../243-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../244-patchutils_0.4.2-1+b1_arm64.deb ... Unpacking patchutils (0.4.2-1+b1) ... Selecting previously unselected package wdiff. Preparing to unpack .../245-wdiff_1.2.2-7_arm64.deb ... Unpacking wdiff (1.2.2-7) ... Selecting previously unselected package devscripts. Preparing to unpack .../246-devscripts_2.25.1_all.deb ... Unpacking devscripts (2.25.1) ... Selecting previously unselected package fastjar. Preparing to unpack .../247-fastjar_2%3a0.98-7+b1_arm64.deb ... Unpacking fastjar (2:0.98-7+b1) ... Selecting previously unselected package ivy. Preparing to unpack .../248-ivy_2.5.2-1_all.deb ... Unpacking ivy (2.5.2-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../249-libasm-java_9.7.1-1_all.deb ... Unpacking libasm-java (9.7.1-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../250-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../251-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../252-libapache-pom-java_33-2_all.deb ... Unpacking libapache-pom-java (33-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../253-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../254-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../255-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../256-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../257-libqdox-java_1.12.1-4_all.deb ... Unpacking libqdox-java (1.12.1-4) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../258-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../259-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../260-libxstream-java_1.4.21-1_all.deb ... Unpacking libxstream-java (1.4.21-1) ... Selecting previously unselected package groovy. Preparing to unpack .../261-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../262-libatinject-jsr330-api-java_1.0+ds1-6_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-6) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../263-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../264-libcommons-codec-java_1.17.1-1_all.deb ... Unpacking libcommons-codec-java (1.17.1-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../265-libcommons-io-java_2.17.0-1_all.deb ... Unpacking libcommons-io-java (2.17.0-1) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../266-libcommons-compress-java_1.27.1-2_all.deb ... Unpacking libcommons-compress-java (1.27.1-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../267-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../268-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../269-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../270-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../271-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../272-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../273-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../274-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../275-libjna-jni_5.15.0-1_arm64.deb ... Unpacking libjna-jni (5.15.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../276-libjna-java_5.15.0-1_all.deb ... Unpacking libjna-java (5.15.0-1) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../277-libbcprov-java_1.77-1_all.deb ... Unpacking libbcprov-java (1.77-1) ... Selecting previously unselected package libjunixsocket-jni. Preparing to unpack .../278-libjunixsocket-jni_2.6.1-1+b1_arm64.deb ... Unpacking libjunixsocket-jni (2.6.1-1+b1) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../279-libeclipse-jdt-annotation-java_2.2.700+eclipse4.29-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ... Selecting previously unselected package libjunixsocket-java. Preparing to unpack .../280-libjunixsocket-java_2.6.1-1_all.deb ... Unpacking libjunixsocket-java (2.6.1-1) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../281-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package liblightcouch-java. Preparing to unpack .../282-liblightcouch-java_0.2.0-1_all.deb ... Unpacking liblightcouch-java (0.2.0-1) ... Selecting previously unselected package libmongodb-java. Preparing to unpack .../283-libmongodb-java_3.6.3-2_all.deb ... Unpacking libmongodb-java (3.6.3-2) ... Selecting previously unselected package liblog4j2-java. Preparing to unpack .../284-liblog4j2-java_2.19.0-2_all.deb ... Unpacking liblog4j2-java (2.19.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../285-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../286-libjsch-java_0.2.19-1_all.deb ... Unpacking libjsch-java (0.2.19-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../287-libminlog-java_1.3.1-1_all.deb ... Unpacking libminlog-java (1.3.1-1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../288-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../289-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../290-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../291-liblogback-java_1%3a1.2.11-6_all.deb ... Unpacking liblogback-java (1:1.2.11-6) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../292-libnative-platform-jni_0.14-6+b1_arm64.deb ... Unpacking libnative-platform-jni (0.14-6+b1) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../293-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../294-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../295-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../296-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../297-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../298-libxbean-reflect-java_4.5-9_all.deb ... Unpacking libxbean-reflect-java (4.5-9) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../299-libgradle-core-java_4.4.1-22_all.deb ... Unpacking libgradle-core-java (4.4.1-22) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../300-libbcpg-java_1.77-1_all.deb ... Unpacking libbcpg-java (1.77-1) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../301-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../302-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../303-libjaxen-java_1.1.6-5_all.deb ... Unpacking libjaxen-java (1.1.6-5) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../304-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../305-libcommons-lang3-java_3.17.0-1_all.deb ... Unpacking libcommons-lang3-java (3.17.0-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../306-libbcel-java_6.10.0-1_all.deb ... Unpacking libbcel-java (6.10.0-1) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../307-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../308-libfindbugs-java_3.1.0~preview2-4_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-4) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../309-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../310-libguice-java_5.1.0-1_all.deb ... Unpacking libguice-java (5.1.0-1) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../311-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../312-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../313-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../314-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../315-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../316-libjetty9-java_9.4.56-1_all.deb ... Unpacking libjetty9-java (9.4.56-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../317-libjgit-java_6.7.0-2_all.deb ... Unpacking libjgit-java (6.7.0-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../318-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../319-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../320-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../321-libmaven-resolver-java_1.9.22-1_all.deb ... Unpacking libmaven-resolver-java (1.9.22-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../322-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../323-libmaven-parent-java_43-2_all.deb ... Unpacking libmaven-parent-java (43-2) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../324-libmaven-shared-utils-java_3.4.2-1_all.deb ... Unpacking libmaven-shared-utils-java (3.4.2-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../325-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../326-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../327-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../328-libplexus-interpolation-java_1.27-1_all.deb ... Unpacking libplexus-interpolation-java (1.27-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../329-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../330-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../331-libcdi-api-java_1.2-4_all.deb ... Unpacking libcdi-api-java (1.2-4) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../332-libsisu-inject-java_0.3.5-1_all.deb ... Unpacking libsisu-inject-java (0.3.5-1) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../333-libsisu-plexus-java_0.3.5-1_all.deb ... Unpacking libsisu-plexus-java (0.3.5-1) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../334-libmaven3-core-java_3.9.9-1_all.deb ... Unpacking libmaven3-core-java (3.9.9-1) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../335-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../336-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../337-librhino-java_1.7.15-1_all.deb ... Unpacking librhino-java (1.7.15-1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../338-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../339-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../340-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../341-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../342-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../343-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../344-libgradle-plugins-java_4.4.1-22_all.deb ... Unpacking libgradle-plugins-java (4.4.1-22) ... Selecting previously unselected package gradle. Preparing to unpack .../345-gradle_4.4.1-22_all.deb ... Unpacking gradle (4.4.1-22) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../346-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../347-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../348-jarwrapper_0.80_all.deb ... Unpacking jarwrapper (0.80) ... Selecting previously unselected package javahelper. Preparing to unpack .../349-javahelper_0.80_all.deb ... Unpacking javahelper (0.80) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../350-libbyte-buddy-java_1.14.19-1_all.deb ... Unpacking libbyte-buddy-java (1.14.19-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../351-libcommons-math3-java_3.6.1-4_all.deb ... Unpacking libcommons-math3-java (3.6.1-4) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../352-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../353-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../354-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../355-liblz4-jni_1.8.0-4+b1_arm64.deb ... Unpacking liblz4-jni (1.8.0-4+b1) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../356-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../357-libmockito-java_3.3.0-2_all.deb ... Unpacking libmockito-java (3.3.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../358-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../359-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.77-1) ... Setting up media-types (10.1.0) ... Setting up libpipeline1:arm64 (1.5.8-1) ... Setting up fastjar (2:0.98-7+b1) ... Setting up libgraphite2-3:arm64 (1.3.14-2+b1) ... Setting up liblcms2-2:arm64 (2.16-2) ... Setting up libpixman-1-0:arm64 (0.44.0-3) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-7) ... Setting up libsharpyuv0:arm64 (1.5.0-0.1) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up systemd-sysv (257.2-2) ... Setting up libxau6:arm64 (1:1.0.11-1) ... Setting up libxdmcp6:arm64 (1:1.1.5-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libnpth0t64:arm64 (1.8-2) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libkeyutils1:arm64 (1.6.3-4) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libxcb1:arm64 (1.17.0-2+b1) ... Setting up libqdox-java (1.12.1-4) ... Setting up libicu72:arm64 (72.1-6) ... Setting up libxcb-xfixes0:arm64 (1.17.0-2+b1) ... Setting up liblerc4:arm64 (4.0.0+ds-5) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.40.4-1) ... Setting up hicolor-icon-theme (0.18-1) ... Setting up libgpg-error0:arm64 (1.51-3) ... Setting up java-common (0.76) ... Setting up libdynaloader-functions-perl (0.004-1) ... Setting up libdatrie1:arm64 (0.2.13-3+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1+b2) ... Setting up libmagic-mgc (1:5.45-3+b1) ... Setting up libxcb-render0:arm64 (1.17.0-2+b1) ... Setting up liblogback-java (1:1.2.11-6) ... Setting up libclone-perl:arm64 (0.47-1+b1) ... Setting up libminlog-java (1.3.1-1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglvnd0:arm64 (1.7.0-1+b2) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up libxcb-glx0:arm64 (1.17.0-2+b1) ... Setting up unzip (6.0-28+b1) ... Setting up libdebhelper-perl (13.24.1) ... Setting up libbrotli1:arm64 (1.1.0-2+b6) ... Setting up libedit2:arm64 (3.1-20250104-1) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... Setting up libmagic1t64:arm64 (1:5.45-3+b1) ... Setting up libasm-java (9.7.1-1) ... Setting up x11-common (1:7.7+23.2) ... Running in chroot, ignoring request. Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.32-1) ... Setting up libsensors-config (1:3.6.0-10) ... Setting up libdeflate0:arm64 (1.23-1+b1) ... Setting up perl-openssl-defaults:arm64 (7+b2) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.23.1-1) ... Setting up m4 (1.4.19-5) ... Setting up libel-api-java (3.0.0-3) ... Setting up libgcrypt20:arm64 (1.11.0-7) ... Setting up xkb-data (2.42-1) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libxcb-shm0:arm64 (1.17.0-2+b1) ... Setting up libcom-err2:arm64 (1.47.2-1) ... Setting up file (1:5.45-3+b1) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:arm64 (2.1-6.1+b2) ... Setting up libelf1t64:arm64 (0.192-4) ... Setting up libkrb5support0:arm64 (1.21.3-4) ... Setting up libsasl2-modules-db:arm64 (2.1.28+dfsg1-8+b1) ... Setting up tzdata (2025a-1) ... Current default time zone: 'Etc/UTC' Local time is now: Tue Jan 21 02:11:05 UTC 2025. Universal Time is now: Tue Jan 21 02:11:05 UTC 2025. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libxcb-present0:arm64 (1.17.0-2+b1) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.13-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.15-1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:arm64 (4.13.3-1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libasound2t64:arm64 (1.2.13-1+b1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:arm64 (1:2.1.5-3+b1) ... Setting up libjaxen-java (1.1.6-5) ... Setting up libx11-data (2:1.8.10-2) ... Setting up libepoxy0:arm64 (1.5.10-2) ... Setting up libnspr4:arm64 (2:4.36-1) ... Setting up gnupg-l10n (2.2.46-1) ... Setting up libxcb-sync1:arm64 (1.17.0-2+b1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (33-2) ... Setting up libavahi-common-data:arm64 (0.8-16) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libatinject-jsr330-api-java (1.0+ds1-6) ... Setting up libdbus-1-3:arm64 (1.16.0-1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:arm64 (1.0.16-1) ... Setting up libproc2-0:arm64 (2:4.0.4-6) ... Setting up libplexus-interpolation-java (1.27-1) ... Setting up libunistring5:arm64 (1.3-1) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16t64:arm64 (1.6.45-1) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up autopoint (0.23.1-1) ... Setting up binfmt-support (2.2.2-7+b1) ... Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Created symlink '/etc/systemd/system/multi-user.target.wants/binfmt-support.service' -> '/usr/lib/systemd/system/binfmt-support.service'. Setting up libb-hooks-op-check-perl:arm64 (0.22-3+b2) ... Setting up libjunixsocket-jni (2.6.1-1+b1) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up libpcsclite1:arm64 (2.3.1-1) ... Setting up libsensors5:arm64 (1:3.6.0-10+b1) ... Setting up libmongodb-java (3.6.3-2) ... Setting up libk5crypto3:arm64 (1.21.3-4) ... Setting up libhamcrest-java (2.2-2) ... Setting up libglapi-mesa:arm64 (24.3.3-1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:arm64 (2.1.28+dfsg1-8+b1) ... Setting up libvulkan1:arm64 (1.4.304.0-1) ... Setting up autoconf (2.72-3) ... Setting up libwebp7:arm64 (1.5.0-0.1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libgif7:arm64 (5.2.2-1+b1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libffi8:arm64 (3.4.6-1) ... Setting up libtrove3-java (3.0.3-5) ... Setting up dwz (0.15-1+b1) ... Setting up sensible-utils (0.0.24) ... Setting up libxshmfence1:arm64 (1.3-1+b3) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.55.0.1-1) ... Setting up gpgv (2.2.46-1+b1) ... Setting up libtiff6:arm64 (4.5.1+git230720-5) ... Setting up libxcb-randr0:arm64 (1.17.0-2+b1) ... Setting up dbus-session-bus-common (1.16.0-1) ... Setting up libuchardet0:arm64 (0.0.8-1+b2) ... Setting up libassuan9:arm64 (3.0.1-2) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up procps (2:4.0.4-6) ... Setting up libxbean-reflect-java (4.5-9) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libtasn1-6:arm64 (4.19.0-3+b3) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libx11-6:arm64 (2:1.8.10-2) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-4) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6+b1) ... Setting up libclass-xsaccessor-perl (1.19-4+b4) ... Setting up libkrb5-3:arm64 (1.21.3-4) ... Setting up liblz4-jni (1.8.0-4+b1) ... Setting up libwayland-egl1:arm64 (1.23.0-1+b1) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.77-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up dbus-system-bus-common (1.16.0-1) ... useradd: Warning: missing or non-executable shell '/usr/sbin/nologin' Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-14) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.4.0-2) ... Setting up libdrm-common (2.4.123-1) ... Setting up libcdi-api-java (1.2-4) ... Setting up libxcomposite1:arm64 (1:0.4.6-1) ... Setting up readline-common (8.2-6) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:arm64 (2.12.7+dfsg+really2.9.14-0.2+b1) ... Setting up libldap2:arm64 (2.6.9+dfsg-1) ... Setting up liburi-perl (5.30-1) ... Setting up dbus-bin (1.16.0-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3+b1) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libxkbcommon0:arm64 (1.7.0-2) ... Setting up libwayland-client0:arm64 (1.23.0-1+b1) ... Setting up libnet-ssleay-perl:arm64 (1.94-2) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up libksba8:arm64 (1.6.7-2+b1) ... Setting up pinentry-curses (1.3.1-2) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libfile-stripnondeterminism-perl (1.14.0-1) ... Setting up libxcb-dri3-0:arm64 (1.17.0-2+b1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libllvm19:arm64 (1:19.1.7-1) ... Setting up libwayland-server0:arm64 (1.23.0-1+b1) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libx11-xcb1:arm64 (2:1.8.10-2) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.21-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up liblz4-java (1.8.0-4) ... Setting up gettext (0.23.1-1) ... Setting up libjetty9-java (9.4.56-1) ... Setting up libxdamage1:arm64 (1:1.1.6-1+b2) ... Setting up java-wrappers (0.5) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libxrender1:arm64 (1:0.9.10-1.1+b3) ... Setting up jarwrapper (0.80) ... Setting up libtool (2.5.4-2) ... Setting up fontconfig-config (2.15.0-2) ... Setting up libmaven-parent-java (43-2) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:arm64 (0.8-16) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libxext6:arm64 (2:1.3.4-1+b3) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.5-1) ... Setting up libidn2-0:arm64 (2.3.7-2+b1) ... Setting up libnss3:arm64 (2:3.107-1) ... Setting up dbus-daemon (1.16.0-1) ... Setting up libdevel-callchecker-perl:arm64 (0.009-1+b1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libjunixsocket-java (2.6.1-1) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up libxxf86vm1:arm64 (1:1.1.4-1+b4) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1+b1) ... Setting up libthai0:arm64 (0.1.29-2+b1) ... Setting up ca-certificates (20241223) ... Updating certificates in /etc/ssl/certs... 152 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.5-1) ... Setting up libglib2.0-0t64:arm64 (2.82.4-2) ... Setting up libfreetype6:arm64 (2.13.3+dfsg-1) ... Setting up libxfixes3:arm64 (1:6.0.0-2+b3) ... Setting up testng (6.9.12-4) ... Setting up dbus (1.16.0-1) ... Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Setting up shared-mime-info (2.4-5+b1) ... Setting up libp11-kit0:arm64 (0.25.5-3) ... Setting up libxinerama1:arm64 (2:1.1.4-3+b3) ... Setting up libgssapi-krb5-2:arm64 (1.21.3-4) ... Setting up libxrandr2:arm64 (2:1.5.4-1+b2) ... Setting up libjna-jni (5.15.0-1) ... Setting up libcommons-lang3-java (3.17.0-1) ... Setting up libreadline8t64:arm64 (8.2-6) ... Setting up dh-strip-nondeterminism (1.14.0-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:arm64 (2.4.123-1) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-7) ... Setting up libwayland-cursor0:arm64 (1.23.0-1+b1) ... Setting up libhtml-parser-perl:arm64 (3.83-1+b2) ... Setting up libjna-java (5.15.0-1) ... Setting up gpgconf (2.2.46-1+b1) ... Setting up libpam-systemd:arm64 (257.2-2) ... Setting up libjansi1-java (1.18-3.1) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libharfbuzz0b:arm64 (10.2.0-1) ... Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.12+dfsg-1+b1) ... Setting up libfontconfig1:arm64 (2.15.0-2) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.17.1-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libpython3.13-stdlib:arm64 (3.13.1-3) ... Setting up libavahi-client3:arm64 (0.8-16) ... Setting up libio-socket-ssl-perl (2.089-1) ... Setting up gpg (2.2.46-1+b1) ... Setting up libpython3-stdlib:arm64 (3.13.1-2) ... Setting up libhttp-message-perl (7.00-2) ... Setting up libdrm-amdgpu1:arm64 (2.4.123-1) ... Setting up libgnutls30t64:arm64 (3.8.8-2) ... Setting up gtk-update-icon-cache (4.16.12+ds-1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.15.0-2) ... Regenerating fonts cache... done. Setting up gpg-agent (2.2.46-1+b1) ... Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-browser.socket' -> '/usr/lib/systemd/user/gpg-agent-browser.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-extra.socket' -> '/usr/lib/systemd/user/gpg-agent-extra.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-ssh.socket' -> '/usr/lib/systemd/user/gpg-agent-ssh.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent.socket' -> '/usr/lib/systemd/user/gpg-agent.socket'. Setting up libatk1.0-0t64:arm64 (2.55.0.1-1) ... Setting up openjdk-21-jre-headless:arm64 (21.0.6~6ea-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up libxi6:arm64 (2:1.8.2-1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up python3.13 (3.13.1-3) ... Setting up libcommons-io-java (2.17.0-1) ... Setting up libdrm-radeon1:arm64 (2.4.123-1) ... Setting up libxtst6:arm64 (2:1.2.3-1.1+b3) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libxcursor1:arm64 (1:1.2.3-1) ... Setting up libparams-classify-perl:arm64 (0.015-2+b4) ... Setting up gpgsm (2.2.46-1+b1) ... Setting up libpango-1.0-0:arm64 (1.56.1-1) ... Setting up libcloudproviders0:arm64 (0.3.6-1+b1) ... Setting up python3 (3.13.1-2) ... Setting up sopv-gpgv (0.1.1-1) ... update-alternatives: using /usr/bin/sopv-gpgv to provide /usr/bin/sopv (sopv) in auto mode Setting up man-db (2.13.0-1) ... Not building database; man-db/auto-update is not 'true'. Created symlink '/etc/systemd/system/timers.target.wants/man-db.timer' -> '/usr/lib/systemd/system/man-db.timer'. Setting up libcairo2:arm64 (1.18.2-2) ... Setting up libcolord2:arm64 (1.4.7-1+b2) ... Setting up libdconf1:arm64 (0.40.0-5) ... Setting up dirmngr (2.2.46-1+b1) ... Created symlink '/etc/systemd/user/sockets.target.wants/dirmngr.socket' -> '/usr/lib/systemd/user/dirmngr.socket'. Setting up dbus-user-session (1.16.0-1) ... Setting up libmaven-resolver-java (1.9.22-1) ... Setting up libbcel-java (6.10.0-1) ... Setting up adwaita-icon-theme (47.0-2) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libatspi2.0-0t64:arm64 (2.55.0.1-1) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up gnupg (2.2.46-1) ... Setting up liblightcouch-java (0.2.0-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libcairo-gobject2:arm64 (1.18.2-2) ... Setting up libmaven-shared-utils-java (3.4.2-1) ... Setting up libpangoft2-1.0-0:arm64 (1.56.1-1) ... Setting up libcups2t64:arm64 (2.4.10-2+b1) ... Setting up libpangocairo-1.0-0:arm64 (1.56.1-1) ... Setting up libatk-bridge2.0-0t64:arm64 (2.55.0.1-1) ... Setting up mesa-libgallium:arm64 (24.3.3-1) ... Setting up libfindbugs-java (3.1.0~preview2-4) ... Setting up libcommons-compress-java (1.27.1-2) ... Setting up libgbm1:arm64 (24.3.3-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libmoo-perl (2.005005-1) ... Setting up liblog4j2-java (2.19.0-2) ... Setting up libgl1-mesa-dri:arm64 (24.3.3-1) ... Setting up debhelper (13.24.1) ... Setting up dconf-service (0.40.0-5) ... Setting up libjsch-java (0.2.19-1) ... Setting up libjgit-java (6.7.0-2) ... Setting up libglx-mesa0:arm64 (24.3.3-1) ... Setting up libglx0:arm64 (1.7.0-1+b2) ... Setting up dconf-gsettings-backend:arm64 (0.40.0-5) ... Setting up libgl1:arm64 (1.7.0-1+b2) ... Setting up libgtk-3-common (3.24.43-5) ... Setting up libgtk-3-0t64:arm64 (3.24.43-5) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.77-1) ... Setting up devscripts (2.25.1) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.80) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up libguice-java (5.1.0-1) ... Setting up libmaven3-core-java (3.9.9-1) ... Setting up libbyte-buddy-java (1.14.19-1) ... Setting up libmockito-java (3.3.0-2) ... Processing triggers for libc-bin (2.40-5) ... Processing triggers for systemd (257.2-2) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:FIRMAPROFESIONAL_CA_ROOT-A_WEB.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureSign_Root_CA12.pem Adding debian:SecureSign_Root_CA14.pem Adding debian:SecureSign_Root_CA15.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_CYBER_Root_CA.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:Telekom_Security_TLS_ECC_Root_2020.pem Adding debian:Telekom_Security_TLS_RSA_Root_2023.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up antlr (2.7.7+dfsg-14) ... Setting up openjdk-21-jre:arm64 (21.0.6~6ea-1) ... Setting up ivy (2.5.2-1) ... Setting up ant (1.10.15-1) ... Setting up junit4 (4.13.2-5) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up openjdk-21-jdk-headless:arm64 (21.0.6~6ea-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up default-jre-headless (2:1.21-76) ... Setting up maven-repo-helper (1.11) ... Setting up default-jre (2:1.21-76) ... Setting up ant-optional (1.10.15-1) ... Setting up openjdk-21-jdk:arm64 (21.0.6~6ea-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.21-76) ... Setting up libgradle-core-java (4.4.1-22) ... Setting up libgradle-plugins-java (4.4.1-22) ... Setting up gradle (4.4.1-22) ... Setting up default-jdk (2:1.21-76) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20241223) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture arm64 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean Duplicate specification "u=s" for option "u" dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 jar openjdk version "21.0.6-ea" 2025-01-21 OpenJDK Runtime Environment (build 21.0.6-ea+6-Debian-1) OpenJDK 64-Bit Server VM (build 21.0.6-ea+6-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 2.502 secs. The client will now receive all logging from the daemon (pid: 3699413). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-3699413.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@4fe3a2b Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@4fe3a2b Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@45271cb9 Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@6748cd72 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@4bcbf86d Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@45271cb9 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@732948e0 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@43ed5b43 :compileJava (Thread[#50,Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.017 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@7501c2f9 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through commons-codec:commons-codec:jar:debian Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1144) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:642) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:1583) Up-to-date check for task ':compileJava' took 5.508 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. warning: [options] source value 8 is obsolete and will be removed in a future release warning: [options] target value 8 is obsolete and will be removed in a future release warning: [options] To suppress warnings about obsolete options, use -Xlint:-options. /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1279: warning: [removal] finalize() in Object has been deprecated and marked for removal protected void finalize() throws Throwable { ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1280: warning: [removal] finalize() in Object has been deprecated and marked for removal super.finalize(); ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:108: warning: [removal] finalize() in Object has been deprecated and marked for removal protected void finalize() throws Throwable { ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:116: warning: [removal] finalize() in Object has been deprecated and marked for removal super.finalize(); ^ Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. 7 warnings :compileJava (Thread[#50,Task worker for ':',5,main]) completed. Took 19.872 secs. :processResources (Thread[#50,Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.04 secs. It is not up-to-date because: No history is available. :processResources (Thread[#50,Task worker for ':',5,main]) completed. Took 0.134 secs. :classes (Thread[#50,Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[#50,Task worker for ':',5,main]) completed. Took 0.0 secs. :debianMavenPom (Thread[#50,Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.008 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[#50,Task worker for ':',5,main]) completed. Took 0.262 secs. :jar (Thread[#50,Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.082 secs. It is not up-to-date because: No history is available. :jar (Thread[#50,Task worker for ':',5,main]) completed. Took 0.773 secs. BUILD SUCCESSFUL in 34s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 test openjdk version "21.0.6-ea" 2025-01-21 OpenJDK Runtime Environment (build 21.0.6-ea+6-Debian-1) OpenJDK 64-Bit Server VM (build 21.0.6-ea+6-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 2.812 secs. The client will now receive all logging from the daemon (pid: 3701059). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-3701059.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@2445a605 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@2445a605 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@2b41c8c6 Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@6a8ea5c3 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@1a5b3caf Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@2b41c8c6 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@51f72dd4 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@bfa5b08 :compileJava (Thread[#50,Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.013 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@45da264f Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through commons-codec:commons-codec:jar:debian Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 2.445 secs). :compileJava UP-TO-DATE :compileJava (Thread[#50,Task worker for ':',5,main]) completed. Took 2.526 secs. :processResources (Thread[#50,Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.05 secs). :processResources UP-TO-DATE :processResources (Thread[#50,Task worker for ':',5,main]) completed. Took 0.069 secs. :classes (Thread[#50,Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[#50,Task worker for ':',5,main]) completed. Took 0.0 secs. :compileTestJava (Thread[#50,Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 4.222 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. warning: [options] source value 8 is obsolete and will be removed in a future release warning: [options] target value 8 is obsolete and will be removed in a future release warning: [options] To suppress warnings about obsolete options, use -Xlint:-options. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. 3 warnings :compileTestJava (Thread[#50,Task worker for ':',5,main]) completed. Took 14.557 secs. :processTestResources (Thread[#50,Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.023 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[#50,Task worker for ':',5,main]) completed. Took 0.109 secs. :testClasses (Thread[#50,Task worker for ':',5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[#50,Task worker for ':',5,main]) completed. Took 0.0 secs. :test (Thread[#50,Task worker for ':',5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 1.364 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-21-openjdk-arm64/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath13950704020432798664txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 5608636 Write time: 662.53ms O. Stats: Wall clock time: 666.66ms Total CPU time: 728.95ms User wait time: 414.15ms Serialization time: 189.81ms (26.04%) Checksum calculation time: 52.21ms (7.16%) Compression time: 214.68ms (29.45%) Total IO delay: 309.93ms Concurrency overhead: 166.17ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 17.31MiB/s Concurrency adjusted uncompressed speed: 43.38MiB/s Actual uncompressed speed: 27.68MiB/s Actual speed: 8.03MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 237.71ms Total CPU time: 114.59ms Serialization time: 75ms (65.45%) Checksum calculation time: 5.09ms (4.44%) Compression time: 29.96ms (26.15%) Total IO delay: 190.97ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 28.15MiB/s Concurrency adjusted uncompressed speed: 242.59MiB/s Actual uncompressed speed: 77.79MiB/s Actual speed: 22.57MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 446.71ms Total CPU time: 211.68ms Serialization time: 99.76ms (47.13%) Checksum calculation time: 10.1ms (4.77%) Compression time: 93.97ms (44.39%) Total IO delay: 358.07ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 29.88MiB/s Concurrency adjusted uncompressed speed: 259.67MiB/s Actual uncompressed speed: 82.68MiB/s Actual speed: 23.99MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 5588298 Write time: 129.35ms O. Stats: Wall clock time: 129.79ms Total CPU time: 77.15ms User wait time: 98.3ms Serialization time: 28.42ms (36.83%) Checksum calculation time: 4.99ms (6.47%) Compression time: 42.16ms (54.64%) Total IO delay: 65.18ms Concurrency overhead: 18.55ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 81.99MiB/s Concurrency adjusted uncompressed speed: 341.42MiB/s Actual uncompressed speed: 142.92MiB/s Actual speed: 41.31MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 93.81ms Total CPU time: 71.08ms Serialization time: 32.63ms (45.91%) Checksum calculation time: 7.2ms (10.13%) Compression time: 30.46ms (42.85%) Total IO delay: 64.54ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 83.27MiB/s Concurrency adjusted uncompressed speed: 558.69MiB/s Actual uncompressed speed: 198.25MiB/s Actual speed: 57.31MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 223.7ms Total CPU time: 126.61ms Serialization time: 48.57ms (38.36%) Checksum calculation time: 15.46ms (12.21%) Compression time: 60.79ms (48.01%) Total IO delay: 163.39ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 65.39MiB/s Concurrency adjusted uncompressed speed: 512.14MiB/s Actual uncompressed speed: 165.35MiB/s Actual speed: 47.8MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5608636 Write time: 127.53ms O. Stats: Wall clock time: 128.62ms Total CPU time: 58.39ms User wait time: 103.06ms Serialization time: 23.86ms (40.87%) Checksum calculation time: 5.04ms (8.64%) Compression time: 26.55ms (45.46%) Total IO delay: 30.66ms Concurrency overhead: 15.45ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 178.29MiB/s Concurrency adjusted uncompressed speed: 177.28MiB/s Actual uncompressed speed: 144.04MiB/s Actual speed: 41.79MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 240.26ms Total CPU time: 61.7ms Serialization time: 22.56ms (36.57%) Checksum calculation time: 4.99ms (8.08%) Compression time: 31.06ms (50.34%) Total IO delay: 175.69ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 30.56MiB/s Concurrency adjusted uncompressed speed: 77.79MiB/s Actual uncompressed speed: 76.82MiB/s Actual speed: 22.29MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 390.94ms Total CPU time: 139.98ms Serialization time: 63.26ms (45.19%) Checksum calculation time: 9.92ms (7.08%) Compression time: 61.32ms (43.8%) Total IO delay: 288.49ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 37.14MiB/s Concurrency adjusted uncompressed speed: 86.15MiB/s Actual uncompressed speed: 94.55MiB/s Actual speed: 27.43MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5588298 Write time: 103.48ms O. Stats: Wall clock time: 104.54ms Total CPU time: 54.36ms User wait time: 87.21ms Serialization time: 21.66ms (39.85%) Checksum calculation time: 4.99ms (9.17%) Compression time: 26.21ms (48.2%) Total IO delay: 31.85ms Concurrency overhead: 957.25us Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 171.92MiB/s Concurrency adjusted uncompressed speed: 211.92MiB/s Actual uncompressed speed: 177.28MiB/s Actual speed: 51.24MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 116.28ms Total CPU time: 53.94ms Serialization time: 17.88ms (33.14%) Checksum calculation time: 4.95ms (9.18%) Compression time: 30.42ms (56.39%) Total IO delay: 108.37ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 49.35MiB/s Concurrency adjusted uncompressed speed: 113.81MiB/s Actual uncompressed speed: 158.94MiB/s Actual speed: 45.94MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 221.1ms Total CPU time: 127.34ms Serialization time: 35.14ms (27.59%) Checksum calculation time: 9.87ms (7.75%) Compression time: 81.07ms (63.66%) Total IO delay: 173.96ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 61.61MiB/s Concurrency adjusted uncompressed speed: 122.5MiB/s Actual uncompressed speed: 166.85MiB/s Actual speed: 48.23MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 1 / 2 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 2.36s O. Stats: Wall clock time: 2.36s Total CPU time: 5.88s User wait time: 2.18s Serialization time: 23.37ms (0.4%) Checksum calculation time: 4.99ms (0.08%) Compression time: 5.84s (99.32%) Total IO delay: 245.93ms Concurrency overhead: 120.18ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 16.18MiB/s Concurrency adjusted uncompressed speed: 11.17MiB/s Actual uncompressed speed: 7.82MiB/s Actual speed: 1.68MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 242.18ms Total CPU time: 94.81ms Serialization time: 37.99ms (40.07%) Checksum calculation time: 4.91ms (5.18%) Compression time: 50.01ms (52.75%) Total IO delay: 185.67ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 21.43MiB/s Concurrency adjusted uncompressed speed: 263.38MiB/s Actual uncompressed speed: 76.19MiB/s Actual speed: 16.38MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 522.42ms Total CPU time: 142.02ms Serialization time: 52.25ms (36.79%) Checksum calculation time: 9.8ms (6.9%) Compression time: 76.46ms (53.84%) Total IO delay: 325.62ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 24.39MiB/s Concurrency adjusted uncompressed speed: 317.88MiB/s Actual uncompressed speed: 70.64MiB/s Actual speed: 15.19MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 1 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 3.98s O. Stats: Wall clock time: 3.98s Total CPU time: 6.49s User wait time: 3.54s Serialization time: 24.45ms (0.38%) Checksum calculation time: 4.93ms (0.08%) Compression time: 6.46s (99.53%) Total IO delay: 162.68ms Concurrency overhead: 22.45ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 24.13MiB/s Concurrency adjusted uncompressed speed: 10.94MiB/s Actual uncompressed speed: 4.63MiB/s Actual speed: 1005.68KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 167.06ms Total CPU time: 51.89ms Serialization time: 19.27ms (37.13%) Checksum calculation time: 4.96ms (9.55%) Compression time: 26.72ms (51.49%) Total IO delay: 154.72ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 25.38MiB/s Concurrency adjusted uncompressed speed: 361.51MiB/s Actual uncompressed speed: 110.4MiB/s Actual speed: 23.41MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 366.56ms Total CPU time: 111.57ms Serialization time: 46.63ms (41.79%) Checksum calculation time: 9.91ms (8.88%) Compression time: 53.4ms (47.86%) Total IO delay: 286.54ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 27.33MiB/s Concurrency adjusted uncompressed speed: 372.46MiB/s Actual uncompressed speed: 100.75MiB/s Actual speed: 21.36MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 5.41s O. Stats: Wall clock time: 5.41s Total CPU time: 5.31s User wait time: 5.39s Serialization time: 19.31ms (0.36%) Checksum calculation time: 4.92ms (0.09%) Compression time: 5.27s (99.41%) Total IO delay: 41.35ms Concurrency overhead: 10.21ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 96.68MiB/s Concurrency adjusted uncompressed speed: 3.44MiB/s Actual uncompressed speed: 3.41MiB/s Actual speed: 750.81KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 134.06ms Total CPU time: 45.2ms Serialization time: 12.26ms (27.12%) Checksum calculation time: 4.95ms (10.94%) Compression time: 26.6ms (58.85%) Total IO delay: 119.33ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 33.31MiB/s Concurrency adjusted uncompressed speed: 112.42MiB/s Actual uncompressed speed: 137.59MiB/s Actual speed: 29.58MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 272.15ms Total CPU time: 90.49ms Serialization time: 24.65ms (27.24%) Checksum calculation time: 9.86ms (10.89%) Compression time: 53.24ms (58.83%) Total IO delay: 239.63ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 33.17MiB/s Concurrency adjusted uncompressed speed: 111.74MiB/s Actual uncompressed speed: 135.57MiB/s Actual speed: 29.15MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 5.64s O. Stats: Wall clock time: 5.64s Total CPU time: 5.62s User wait time: 5.63s Serialization time: 17.29ms (0.31%) Checksum calculation time: 12.97ms (0.23%) Compression time: 5.58s (99.3%) Total IO delay: 12.28ms Concurrency overhead: 2.03ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 325.73MiB/s Concurrency adjusted uncompressed speed: 3.27MiB/s Actual uncompressed speed: 3.27MiB/s Actual speed: 709.3KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 118.37ms Total CPU time: 42.64ms Serialization time: 10.78ms (25.27%) Checksum calculation time: 4.94ms (11.57%) Compression time: 26.4ms (61.91%) Total IO delay: 101.91ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 38.7MiB/s Concurrency adjusted uncompressed speed: 128.03MiB/s Actual uncompressed speed: 156.25MiB/s Actual speed: 33.13MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 251.5ms Total CPU time: 89.11ms Serialization time: 25.48ms (28.59%) Checksum calculation time: 9.88ms (11.08%) Compression time: 52.99ms (59.47%) Total IO delay: 169.75ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 46.26MiB/s Concurrency adjusted uncompressed speed: 142.92MiB/s Actual uncompressed speed: 146.91MiB/s Actual speed: 31.15MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 1 / 1 / 1 / 6000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 14000 O. Stats: Wall clock time: 5.58s Total CPU time: 6.12s User wait time: 62.6us Serialization time: 1.45s (23.67%) Checksum calculation time: 1.52s (24.89%) Compression time: 1.51s (24.71%) Total IO delay: 3.9s Concurrency overhead: 69.17ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 488.96MiB/s Concurrency adjusted uncompressed speed: 1.41GiB/s Actual uncompressed speed: 341.65MiB/s Actual speed: 341.65MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 1.01us 2.21us 1.80us com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1680 rTrimmed = 1703 lTrimmed = 2833 rTrimmed = 2880 com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 279.94us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 176.48us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 175.47us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 188.53us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 207.30us C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 218.16us C=2998;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 209.97us C=2997;I=0;M=1;ScE=0;R=0.0 AlignmentTime = 111.31us com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1856 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Q 117 -> T 85 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Q 168 -> T 111 - -57 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1212 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 72 -> T 64 - -8 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 183 -> T 147 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 281 noHits2: 0 noHits3: 0 wrongTopHit: 45 wrongTopHitS: 30 noCorrectHitInList: 21 Timings: DescriptiveStatistics: n: 100000 min: 6440.0 max: 4.9514701E8 mean: 145398.83979000806 std dev: 2823318.6116936766 median: 60800.0 skewness: 124.30302865418082 kurtosis: 18660.782957162904 Clusters basicSize DescriptiveStatistics: n: 99674 min: 1.0 max: 7.0 mean: 2.8609065553705095 std dev: 1.0986277435883456 median: 3.0 skewness: 0.29507202074971917 kurtosis: -0.6692534652494913 Top Delta DescriptiveStatistics: n: 99698 min: -32.0 max: 0.0 mean: -0.0012236955605935006 std dev: 0.14725559496467125 median: 0.0 skewness: -152.70570566762015 kurtosis: 27448.10243244401 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4978 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 849.08us Processed queries: 50 Bad percent: 0.0 False positive percent: 0.5685244207080714 Scoring error percent: 2.0 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT ACGTATGCGGGCGCGTTCTGCTGCAGGGTCTTACCAACTGTGTGTAAGGTTTTAATGATTTGATGCCTTAAATGATGGTTCAGCGTACACACCGTATTCCGACTACGTGGCCAGTCGCAATACAATAAGACTAGCAGTGTGTAGTTATTTCTGGGTCGTGGCGGAATTCCCATGAAGGTTGTTCAAAGTGAACAGTACTTCCGTGGGCTATAGAAAGTCTCACGTCGTAATTTATCTTACCTTGGTCAACCGGCTGTTCTGGCGGCTACACGCCGTGCGACCTTAGGTCAGCTTAGTGTGGTAACGCTACATTCGTGATCGACCGTACACCCGCAGTCAGGTCGCTAACCCCCTGGTTCGAATAGAACCGCAATATAGTACGACCCATTGACTCACCTTGAGCCGCTCCCCCGCCTACGTCTCAC ACGTATGCGGGCGACGTTCTGCTGCAGTGTCTACTCAACTTGTAGTAGGTTTTAATGATTTGATGCCTTAGAATGATTCAGCGTACACACCGTATTCCGCTACGTGCAGCCAATTACAATAGGACTAGCAGTGTGTAGTTATTCTCTGGGTGTGGCGGAATCCCATGAAGGTTGTTCAGAGTGAAGTACTTCCGTGTGGCTATAGAGATCCACGTCGTAATTTATCTTACCTTGGTCAACCGGCTGTTCTGGCGGCTACACGCCGTGCGTCCTTAGGTCAGCTTAGGTGGTACGCTACATTCTGATCGACCTACACCCGCAGTCAGGTCGCTAACCCCCCTGGTTCGAATAACCGCAATATAGTACGACCCATTGCTCACCTTGAGCCGCTCCCCGCTACGTCTTAC ACGTATGCGGGCGACGTGCTTTCGCAGTGTCTATCAACTTGAGTAGTTTAATGATTTGATGCCTTAGAATAGATTCAGCGTACACCCGTATTCCGCTACGTGCACCAATTACAATGGACTAGTGCAGTGTGTAGTTATCTCTGGGTGTGGCGGATCCCCATGAAGGTGTCAGAGTTAGACCCGTGTGGCTATTGAGATCACGTCGTAATTTATCTTACCTTGGTCAACGGCTGTTCTGGCGCTGCACGCGTGCGTCCTTAGGTCAGCTTAGGTGGTACGCTGTCATTCTGATCCACACCCGCAGTCTGTCGCCATAACCCCCCTGGTTCGAATAACGCAATATAGTACGACCCATTGCTCACCTTGAGCCGCTCCCCGCTACGTCTTAC 0 ACGTATGCGGGCGACGTGCT-TTCGCAGTGTC-TATCAACT-TGAGT-A-G-TTTAATGATTTGATGCCTTAGAAT-A-GATTCAGCGTACAC-CCGTATTCCG-CTACGT-G-CA--C-CAATTACAAT-GGACTAGTGCAGTGTGTAGTTATCTCTGGGT-GTGGCGG-ATCCCCATGAAGG-TG-TCAGAGT---TAG-AC--CCGTGTGGCTATTG--AG-ATCACGTCGTAATTTATCTTACCTTGGTCAA-CGGCTGTTCTGGC-GCTGCACG-CGTGCGTCCTTAGGTCAGCTTAG-GTGGT-ACGCTGTCATTC-TGAT---CC--ACACCCGCAGTC-TGTCGCCATAACCCCCCTGGTTCGAAT--AA-CGCAATATAGTACGACCCATTG-CTCACCTTGAGCCGCT-CCCCG-CTACGTCTTAC 388 ||||||||||||| ||| || | |||| ||| || ||||| || || | | |||||||||||||||||||| ||| | | |||||||||||| |||||||||| |||||| | || | ||| |||||| ||||| ||||||||||||||| ||||||| ||||||| || |||||||||| || ||| ||| || || ||||| |||||| | || |||||||||||||||||||||||||||||| ||||||||||||| ||| |||| |||||| |||||||||||||||| ||||| ||||| ||||| |||| || |||||||||||| |||| | ||| ||||||||||||||| || |||||||||||||||||||||| |||||||||||||||| ||||| |||||||| || 0 ACGTATGCGGGCG-CGTTCTGCT-GCAGGGTCTTACCAACTGTGTGTAAGGTTTTAATGATTTGATGCCTTA-AATGATGGTTCAGCGTACACACCGTATTCCGACTACGTGGCCAGTCGCAA-TACAATAAGACTA--GCAGTGTGTAGTTATTTCTGGGTCGTGGCGGAATTCCCATGAAGGTTGTTCAAAGTGAACAGTACTTCCGTG-GGCTATAGAAAGTCTCACGTCGTAATTTATCTTACCTTGGTCAACCGGCTGTTCTGGCGGCTACACGCCGTGCGACCTTAGGTCAGCTTAGTGTGGTAACGCT-ACATTCGTGATCGACCGTACACCCGCAGTCAGGTCG-C-TAA-CCCCCTGGTTCGAATAGAACCGCAATATAGTACGACCCATTGACTCACCTTGAGCCGCTCCCCCGCCTACGTCTCAC 424 [I19:G,S19:G->C,S20:C->T,D21:T,I30:T,D31:T,I45:A,S46:A->G,D47:G,I49:T,D51:T,I73:G,I73:A,I73:T,S74:A->G,D76:G,D77:G,D79:T,I113:G,S113:G->T,D114:T,I164:A,D165:A,D166:T,I168:T,I178:T,D179:T,I181:T,D182:T,I189:G,I189:A,I189:A,S189:G->C,D190:A,D191:A,D192:C,I198:T,D199:T,I213:A,I213:A,S214:A->G,I215:T,S215:A->C,D216:G,D219:T,D220:C,I263:G,D264:G,I302:A,D303:A,I319:C,I319:G,I319:A,D320:G,D321:A,D322:C,I324:G,S324:G->T,D325:T,D348:C,I351:C,I363:A,I363:G,D364:G,D365:A,I407:C,D410:C,I413:C,D414:C] 0 ACGTATGCGGGCGCGTTCT-GCTGCAGGGTC-TTACCAACTGTGTGT-AAGG-TTTTAATGATTTGATGCCTTAAAT---GATGGTTCAGCGTACACACCGTATTCCGACTACGTGGCCA-GTCGCAATACAATAAGACTAGCAGTGTGTAGTTATTTCTGGGTCGTGGCGG-AATT-CCCATGAAGG-TTG-TTCAAAGT---GAACAGTAC-TTCCGTGGGCTATAG--AA-AGTCTCACGTCGTAATTTATCTTACCTTGGTCAACCGGCTGTTCTGGC-GGCTACACGCCGTGCGACCTTAGGTCAGCTTAGTGTGGT-AACGCTACATTCGTGAT---CGACC-GTACACCCGCAGTCAGGTCGCTAACCC-CCTGGTTCGAAT--AGAACCGCAATATAGTACGACCCATTGACTCACCTTGAGCCGCT-CCCCCG-CCTACGTCTCAC 424 ||||||||||||||||||| |||||||| | ||||||||||||| | | || ||||||||||||||||||||| | | | ||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| | | |||||||||| | | | |||||| ||||| | ||||||||||||| | || |||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||||||||||| | ||||||||||||||| | | |||||||||||||||||||||| || |||||||||||| | ||||||||||||||||||||||||||||||||||||||||| ||| || | |||||||||| 0 ACGTATGCGGGCGCGTTCTGCT-GCAGGGTCTT-ACCAACTGTGTGTAAG-GTTT-TAATGATTTGATGCCTTAAATGATGGT--T-CAGCGTACACACCGTATTCCGACTACGTGGCCAGT-CGCAATACAATAAGACTAGCAGTGTGTAGTTATTTCTGGGTCGTGGCGGAA--TTCCCATGAAGGTT-GTT-CAAAGTGAAC---AGTACTT-CCGTGGGCTATAGAAAGTC-TC--ACGTCGTAATTTATCTTACCTTGGTCAACCGGCTGTTCTGGCGG-CTACACGCCGTGCGACCTTAGGTCAGCTTAGTGTGGTAA-CGCTACATTCGTGATCGAC---CGT-ACACCCGCAGTCAGGTCGCTAA-CCCCCTGGTTCGAATAGA--ACCGCAATATAGTACGACCCATTGACTCACCTTGAGCCGCTCCCC-CGCC-TACGTCTCAC 424 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99955 elements with 366.32KiB in raw nucleotide entropy serialized into 273.26KiB com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 50 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 579 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2534 com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_ad7fe21bf49764b9ba37c7157495f89d13d7c5565961206607543181884.fasta: 0% Indexing milib_ad7fe21bf49764b9ba37c7157495f89d13d7c5565961206607543181884.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_ad7fe21bf49764b9ba37c7157495f89d13d7c5565961206607543181884.fasta: 0% Indexing milib_ad7fe21bf49764b9ba37c7157495f89d13d7c5565961206607543181884.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_0f2624adc08e638e182fae2067767c117a3cb1857951612015359408280.tmp: 0% Indexing milib_0f2624adc08e638e182fae2067767c117a3cb1857951612015359408280.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 314ns Addition to hash set (per operation): 795ns Hash set removal (per operation): 369ns a com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_eaf6ba64e9c70c98390de9057afc59868596900b1557923757165646399 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_62976348b95a005ff259132d6bc355706b0317fd3275705386257232537.tmp com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_d4b650656d947e6ea5a1367d16b7a1f396d6ae2a6722153980546355873 timeInCollate: 6.13s timeInCollatorInit: 4.57s timeAwaitingO: 13.76ms timeAwaitingI: 1.14s timeInFinalSorting1: 0ns timeInFinalSorting2: 144.96ms timeInFinalSorting3: 62.77ms /31S (5|27|32): objs=50000 size=3.45MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_bd958c3fe0f89de8efadd9be87b1bfd94f7560c011943163074210619378 timeInCollate: 16.59s timeInCollatorInit: 1.22s timeAwaitingO: 1.42s timeAwaitingI: 4.69s timeInFinalSorting1: 1.06s timeInFinalSorting2: 2.57s timeInFinalSorting3: 480.01ms /0N (5|27|32): objs=161926 size=7.72MiB /1N (5|27|32): objs=149556 size=7.08MiB /2N (5|27|32): objs=166812 size=7.98MiB /3N (5|27|32): objs=153878 size=7.41MiB /4N (5|27|32): objs=151272 size=7.38MiB /5N (5|27|32): objs=153926 size=7.41MiB /6N (5|27|32): objs=156334 size=7.27MiB /7N (5|27|32): objs=156866 size=7.78MiB /8N (5|27|32): objs=156118 size=7.56MiB /9N (5|27|32): objs=150581 size=7.26MiB /10N (5|27|32): objs=159202 size=7.49MiB /11N (5|27|32): objs=160749 size=7.76MiB /12N (5|27|32): objs=158349 size=7.61MiB /13N (5|27|32): objs=156873 size=7.56MiB /14N (5|27|32): objs=142424 size=6.68MiB /15N (5|27|32): objs=158282 size=7.61MiB /16N (5|27|32): objs=159178 size=7.71MiB /17N (5|27|32): objs=153931 size=7.28MiB /18N (5|27|32): objs=155687 size=7.39MiB /19N (5|27|32): objs=153320 size=7.17MiB /20N (5|27|32): objs=162432 size=7.89MiB /21N (5|27|32): objs=158411 size=7.35MiB /22N (5|27|32): objs=155647 size=7.59MiB /23N (5|27|32): objs=159322 size=7.64MiB /24N (5|27|32): objs=158085 size=7.63MiB /25N (5|27|32): objs=159798 size=7.53MiB /26N (5|27|32): objs=158359 size=7.57MiB /27N (5|27|32): objs=155917 size=7.38MiB /28N (5|27|32): objs=157333 size=7.57MiB /29N (5|27|32): objs=159695 size=7.65MiB /30N (5|27|32): objs=147175 size=7.01MiB /31N (5|27|32): objs=152562 size=7.41MiB /0/0N (2|25|36): objs=41245 size=940.3KiB /0/1N (2|25|36): objs=40318 size=855.42KiB /0/2N (2|25|36): objs=35521 size=594.34KiB /0/3S (2|25|36): objs=155 size=114B /0/4N (2|25|36): objs=944 size=3.7KiB /0/5S (2|25|36): objs=153 size=177B /0/6N (2|25|36): objs=307 size=738B /0/7S (2|25|36): objs=172 size=269B /0/8N (2|25|36): objs=1198 size=4.84KiB /0/9S (2|25|36): objs=141 size=295B /0/10N (2|25|36): objs=3986 size=18.64KiB /0/11N (2|25|36): objs=6378 size=31.25KiB /0/12S (2|25|36): objs=141 size=151B /0/13N (2|25|36): objs=288 size=789B /0/14S (2|25|36): objs=151 size=309B /0/15N (2|25|36): objs=1412 size=5.77KiB /0/16S (2|25|36): objs=143 size=94B /0/17N (2|25|36): objs=2943 size=12.75KiB /0/18S (2|25|36): objs=166 size=194B /0/19N (2|25|36): objs=1367 size=5.59KiB /0/20S (2|25|36): objs=177 size=245B /0/22S (2|25|36): objs=145 size=109B /0/23N (2|25|36): objs=9464 size=53.49KiB /0/24S (2|25|36): objs=162 size=120B /0/25N (2|25|36): objs=6057 size=29.01KiB /0/26S (2|25|36): objs=147 size=200B /0/27S (2|25|36): objs=155 size=317B /0/28S (2|25|36): objs=167 size=300B /0/29N (2|25|36): objs=3459 size=14.97KiB /0/30S (2|25|36): objs=167 size=188B /0/31N (2|25|36): objs=420 size=1.51KiB /0/32S (2|25|36): objs=135 size=198B /0/33N (2|25|36): objs=1814 size=7.38KiB /0/34S (2|25|36): objs=142 size=301B /0/35N (2|25|36): objs=2186 size=9.02KiB /1/0N (2|25|36): objs=35387 size=603.45KiB /1/1N (2|25|36): objs=39622 size=869.73KiB /1/2N (2|25|36): objs=41252 size=921.23KiB /1/3N (2|25|36): objs=10375 size=48.06KiB /1/4S (2|25|36): objs=165 size=211B /1/5N (2|25|36): objs=595 size=2.28KiB /1/6S (2|25|36): objs=177 size=157B /1/7N (2|25|36): objs=960 size=3.63KiB /1/8S (2|25|36): objs=146 size=149B /1/10S (2|25|36): objs=142 size=169B /1/11S (2|25|36): objs=157 size=169B /1/12S (2|25|36): objs=163 size=306B /1/13N (2|25|36): objs=1567 size=6.25KiB /1/14S (2|25|36): objs=167 size=195B /1/15N (2|25|36): objs=3501 size=15.71KiB /1/16S (2|25|36): objs=154 size=130B /1/17N (2|25|36): objs=3018 size=14.11KiB /1/18S (2|25|36): objs=161 size=223B /1/19N (2|25|36): objs=1029 size=3.98KiB /1/20S (2|25|36): objs=159 size=199B /1/21S (2|25|36): objs=136 size=146B /1/22S (2|25|36): objs=143 size=186B /1/23N (2|25|36): objs=763 size=3KiB /1/24S (2|25|36): objs=167 size=158B /1/25N (2|25|36): objs=301 size=1007B /1/26S (2|25|36): objs=188 size=246B /1/27N (2|25|36): objs=4506 size=19.44KiB /1/28S (2|25|36): objs=171 size=285B /1/29N (2|25|36): objs=2129 size=8.91KiB /1/30S (2|25|36): objs=151 size=110B /1/31N (2|25|36): objs=612 size=2.45KiB /1/32S (2|25|36): objs=137 size=268B /1/33N (2|25|36): objs=615 size=2.28KiB /1/34S (2|25|36): objs=172 size=208B /1/35N (2|25|36): objs=468 size=1.51KiB /2/0N (2|25|36): objs=41848 size=892.66KiB /2/1N (2|25|36): objs=39953 size=817.66KiB /2/2N (2|25|36): objs=45147 size=1.09MiB /2/3N (2|25|36): objs=10868 size=63.24KiB /2/4S (2|25|36): objs=147 size=249B /2/5N (2|25|36): objs=456 size=1.42KiB /2/6S (2|25|36): objs=167 size=276B /2/7N (2|25|36): objs=1229 size=4.81KiB /2/8S (2|25|36): objs=158 size=222B /2/9N (2|25|36): objs=795 size=2.9KiB /2/10S (2|25|36): objs=130 size=303B /2/12S (2|25|36): objs=131 size=88B /2/13N (2|25|36): objs=1049 size=4KiB /2/14S (2|25|36): objs=136 size=253B /2/15N (2|25|36): objs=3523 size=15.14KiB /2/16S (2|25|36): objs=155 size=250B /2/17N (2|25|36): objs=2863 size=12.54KiB /2/18S (2|25|36): objs=133 size=94B /2/19N (2|25|36): objs=2596 size=10.88KiB /2/20S (2|25|36): objs=163 size=334B /2/21N (2|25|36): objs=712 size=2.74KiB /2/22S (2|25|36): objs=139 size=275B /2/23N (2|25|36): objs=2091 size=8.75KiB /2/24S (2|25|36): objs=165 size=267B /2/25N (2|25|36): objs=777 size=2.86KiB /2/26S (2|25|36): objs=155 size=240B /2/27N (2|25|36): objs=3806 size=17.06KiB /2/28S (2|25|36): objs=141 size=88B /2/29N (2|25|36): objs=1084 size=4.53KiB /2/30S (2|25|36): objs=163 size=179B /2/31N (2|25|36): objs=1176 size=4.75KiB /2/32S (2|25|36): objs=144 size=299B /2/33N (2|25|36): objs=916 size=3.6KiB /2/34S (2|25|36): objs=146 size=150B /2/35N (2|25|36): objs=3550 size=14.93KiB /3/0N (2|25|36): objs=36530 size=629.03KiB /3/1N (2|25|36): objs=38339 size=692.5KiB /3/2N (2|25|36): objs=4195 size=19.75KiB /3/3S (2|25|36): objs=156 size=189B /3/4N (2|25|36): objs=32395 size=519.55KiB /3/5S (2|25|36): objs=146 size=181B /3/6N (2|25|36): objs=1062 size=4.37KiB /3/7N (2|25|36): objs=5406 size=23.82KiB /3/8S (2|25|36): objs=173 size=311B /3/9N (2|25|36): objs=4008 size=18.82KiB /3/10S (2|25|36): objs=160 size=287B /3/11N (2|25|36): objs=631 size=2.18KiB /3/12S (2|25|36): objs=138 size=309B /3/13N (2|25|36): objs=5222 size=24.59KiB /3/14S (2|25|36): objs=151 size=275B /3/15N (2|25|36): objs=889 size=3.32KiB /3/16S (2|25|36): objs=163 size=295B /3/17N (2|25|36): objs=1324 size=5.55KiB /3/18S (2|25|36): objs=150 size=158B /3/19N (2|25|36): objs=5174 size=24.48KiB /3/20S (2|25|36): objs=159 size=218B /3/21N (2|25|36): objs=1522 size=6.1KiB /3/22S (2|25|36): objs=151 size=207B /3/23N (2|25|36): objs=744 size=2.83KiB /3/24S (2|25|36): objs=146 size=163B /3/25N (2|25|36): objs=2595 size=11.14KiB /3/26S (2|25|36): objs=160 size=194B /3/27N (2|25|36): objs=811 size=3.09KiB /3/28S (2|25|36): objs=152 size=243B /3/29N (2|25|36): objs=771 size=2.99KiB /3/30S (2|25|36): objs=139 size=92B /3/31N (2|25|36): objs=1363 size=5.56KiB /3/32S (2|25|36): objs=158 size=187B /3/33N (2|25|36): objs=635 size=2.26KiB /3/34S (2|25|36): objs=145 size=125B /3/35N (2|25|36): objs=7815 size=45.69KiB /4/0N (2|25|36): objs=34586 size=607.31KiB /4/1N (2|25|36): objs=35619 size=720.17KiB /4/2N (2|25|36): objs=40358 size=837.39KiB /4/3N (2|25|36): objs=15833 size=111.36KiB /4/4S (2|25|36): objs=160 size=137B /4/5N (2|25|36): objs=2971 size=12.43KiB /4/6S (2|25|36): objs=141 size=244B /4/7N (2|25|36): objs=9192 size=47.95KiB /4/8S (2|25|36): objs=139 size=253B /4/9N (2|25|36): objs=1378 size=5.56KiB /4/10S (2|25|36): objs=149 size=258B /4/11S (2|25|36): objs=155 size=195B /4/12S (2|25|36): objs=152 size=241B /4/13N (2|25|36): objs=297 size=957B /4/14S (2|25|36): objs=155 size=257B /4/15N (2|25|36): objs=320 size=1.07KiB /4/16S (2|25|36): objs=129 size=156B /4/17N (2|25|36): objs=1164 size=4.9KiB /4/18S (2|25|36): objs=143 size=243B /4/19N (2|25|36): objs=1811 size=7.31KiB /4/20S (2|25|36): objs=156 size=332B /4/21S (2|25|36): objs=169 size=308B /4/22S (2|25|36): objs=144 size=316B /4/23N (2|25|36): objs=441 size=1.48KiB /4/24S (2|25|36): objs=151 size=90B /4/25N (2|25|36): objs=618 size=2.3KiB /4/26S (2|25|36): objs=163 size=269B /4/27N (2|25|36): objs=303 size=780B /4/28S (2|25|36): objs=159 size=98B /4/29N (2|25|36): objs=289 size=882B /4/30S (2|25|36): objs=140 size=137B /4/31N (2|25|36): objs=1248 size=4.85KiB /4/32S (2|25|36): objs=147 size=230B /4/33N (2|25|36): objs=299 size=816B /4/34S (2|25|36): objs=149 size=166B /4/35N (2|25|36): objs=1844 size=7.64KiB /5/0N (2|25|36): objs=39174 size=805.39KiB /5/1N (2|25|36): objs=37345 size=771.98KiB /5/2N (2|25|36): objs=40662 size=916.44KiB /5/3N (2|25|36): objs=3849 size=16.19KiB /5/4S (2|25|36): objs=158 size=191B /5/5N (2|25|36): objs=470 size=1.53KiB /5/6S (2|25|36): objs=148 size=256B /5/7N (2|25|36): objs=1621 size=6.85KiB /5/8S (2|25|36): objs=143 size=138B /5/9N (2|25|36): objs=2048 size=8.51KiB /5/10S (2|25|36): objs=156 size=145B /5/11S (2|25|36): objs=165 size=240B /5/12S (2|25|36): objs=129 size=226B /5/14S (2|25|36): objs=154 size=171B /5/15N (2|25|36): objs=3200 size=15.66KiB /5/16S (2|25|36): objs=150 size=254B /5/17N (2|25|36): objs=2168 size=8.91KiB /5/18S (2|25|36): objs=142 size=332B /5/19N (2|25|36): objs=305 size=1019B /5/20S (2|25|36): objs=152 size=109B /5/21N (2|25|36): objs=2919 size=14.22KiB /5/22S (2|25|36): objs=162 size=250B /5/23N (2|25|36): objs=8183 size=39.17KiB /5/24S (2|25|36): objs=157 size=325B /5/25N (2|25|36): objs=3274 size=14.5KiB /5/26S (2|25|36): objs=157 size=257B /5/27N (2|25|36): objs=2182 size=9.03KiB /5/28S (2|25|36): objs=153 size=167B /5/29N (2|25|36): objs=627 size=2.39KiB /5/30S (2|25|36): objs=143 size=310B /5/32S (2|25|36): objs=188 size=157B /5/33N (2|25|36): objs=2844 size=12.33KiB /5/34S (2|25|36): objs=160 size=343B /5/35N (2|25|36): objs=438 size=1.59KiB /6/0N (2|25|36): objs=40081 size=812.17KiB /6/1N (2|25|36): objs=37929 size=684.59KiB /6/2N (2|25|36): objs=41114 size=811.82KiB /6/3N (2|25|36): objs=2795 size=12.69KiB /6/4S (2|25|36): objs=129 size=180B /6/5N (2|25|36): objs=2023 size=8.32KiB /6/6S (2|25|36): objs=182 size=108B /6/7N (2|25|36): objs=439 size=1.41KiB /6/8S (2|25|36): objs=165 size=87B /6/9S (2|25|36): objs=146 size=159B /6/10S (2|25|36): objs=134 size=292B /6/11N (2|25|36): objs=7944 size=40.89KiB /6/12S (2|25|36): objs=140 size=88B /6/13N (2|25|36): objs=1955 size=8.11KiB /6/14S (2|25|36): objs=160 size=293B /6/15N (2|25|36): objs=1071 size=4.07KiB /6/16S (2|25|36): objs=175 size=148B /6/17N (2|25|36): objs=3103 size=12.89KiB /6/18S (2|25|36): objs=152 size=141B /6/19N (2|25|36): objs=1041 size=4.01KiB /6/20S (2|25|36): objs=139 size=289B /6/21N (2|25|36): objs=301 size=986B /6/22S (2|25|36): objs=175 size=279B /6/23N (2|25|36): objs=1512 size=6.39KiB /6/24S (2|25|36): objs=146 size=142B /6/25S (2|25|36): objs=142 size=131B /6/26S (2|25|36): objs=145 size=211B /6/27N (2|25|36): objs=5082 size=22.88KiB /6/28S (2|25|36): objs=163 size=222B /6/30S (2|25|36): objs=142 size=247B /6/31N (2|25|36): objs=2266 size=9.56KiB /6/32S (2|25|36): objs=146 size=209B /6/33N (2|25|36): objs=2567 size=11.09KiB /6/34S (2|25|36): objs=135 size=232B /6/35N (2|25|36): objs=2395 size=10.11KiB /7/0N (2|25|36): objs=41034 size=988.51KiB /7/1N (2|25|36): objs=37876 size=787.4KiB /7/2N (2|25|36): objs=37544 size=679.15KiB /7/3S (2|25|36): objs=133 size=110B /7/4N (2|25|36): objs=1449 size=5.93KiB /7/5N (2|25|36): objs=2647 size=11.3KiB /7/6S (2|25|36): objs=170 size=187B /7/7N (2|25|36): objs=2315 size=9.66KiB /7/8S (2|25|36): objs=165 size=329B /7/9N (2|25|36): objs=2568 size=10.91KiB /7/10S (2|25|36): objs=162 size=191B /7/11N (2|25|36): objs=3161 size=16.23KiB /7/12S (2|25|36): objs=164 size=101B /7/13N (2|25|36): objs=1540 size=6.13KiB /7/14S (2|25|36): objs=147 size=220B /7/15S (2|25|36): objs=129 size=267B /7/16S (2|25|36): objs=136 size=196B /7/17N (2|25|36): objs=6521 size=34.52KiB /7/18S (2|25|36): objs=173 size=176B /7/19N (2|25|36): objs=914 size=3.57KiB /7/20S (2|25|36): objs=135 size=290B /7/21N (2|25|36): objs=2496 size=10.51KiB /7/22S (2|25|36): objs=165 size=319B /7/23N (2|25|36): objs=5031 size=24.18KiB /7/24S (2|25|36): objs=168 size=206B /7/25N (2|25|36): objs=566 size=2.1KiB /7/26S (2|25|36): objs=139 size=248B /7/27N (2|25|36): objs=472 size=1.58KiB /7/28S (2|25|36): objs=150 size=260B /7/29N (2|25|36): objs=948 size=3.67KiB /7/30S (2|25|36): objs=167 size=282B /7/31N (2|25|36): objs=1577 size=6.57KiB /7/32S (2|25|36): objs=165 size=217B /7/33N (2|25|36): objs=5253 size=24.74KiB /7/34S (2|25|36): objs=174 size=346B /7/35N (2|25|36): objs=312 size=897B /8/0N (2|25|36): objs=36344 size=633.37KiB /8/1N (2|25|36): objs=41794 size=898KiB /8/2N (2|25|36): objs=38169 size=800.38KiB /8/3N (2|25|36): objs=6166 size=26.41KiB /8/4S (2|25|36): objs=155 size=201B /8/5N (2|25|36): objs=2216 size=9.26KiB /8/6S (2|25|36): objs=141 size=311B /8/7N (2|25|36): objs=634 size=2.19KiB /8/8S (2|25|36): objs=154 size=292B /8/9N (2|25|36): objs=2244 size=9.14KiB /8/10S (2|25|36): objs=143 size=335B /8/11N (2|25|36): objs=752 size=2.99KiB /8/12S (2|25|36): objs=136 size=173B /8/13N (2|25|36): objs=1868 size=7.83KiB /8/14S (2|25|36): objs=132 size=312B /8/15N (2|25|36): objs=1775 size=7.33KiB /8/16S (2|25|36): objs=134 size=123B /8/17N (2|25|36): objs=329 size=726B /8/18S (2|25|36): objs=140 size=278B /8/19N (2|25|36): objs=325 size=838B /8/20S (2|25|36): objs=155 size=318B /8/21N (2|25|36): objs=9110 size=42.86KiB /8/22S (2|25|36): objs=146 size=131B /8/23N (2|25|36): objs=468 size=1.54KiB /8/24S (2|25|36): objs=177 size=194B /8/25N (2|25|36): objs=3535 size=16.11KiB /8/26S (2|25|36): objs=161 size=150B /8/27N (2|25|36): objs=1387 size=5.53KiB /8/28S (2|25|36): objs=149 size=236B /8/29N (2|25|36): objs=4836 size=21.61KiB /8/30S (2|25|36): objs=149 size=203B /8/31N (2|25|36): objs=664 size=2.59KiB /8/32S (2|25|36): objs=139 size=150B /8/33N (2|25|36): objs=781 size=3KiB /8/34S (2|25|36): objs=178 size=331B /8/35N (2|25|36): objs=332 size=889B /9/0N (2|25|36): objs=39254 size=835.48KiB /9/1N (2|25|36): objs=35395 size=604.44KiB /9/2N (2|25|36): objs=38259 size=811.04KiB /9/3N (2|25|36): objs=5982 size=26.86KiB /9/4S (2|25|36): objs=154 size=155B /9/6S (2|25|36): objs=155 size=222B /9/7N (2|25|36): objs=2766 size=11.8KiB /9/8S (2|25|36): objs=153 size=256B /9/9N (2|25|36): objs=1208 size=4.8KiB /9/10S (2|25|36): objs=147 size=224B /9/11N (2|25|36): objs=876 size=3.41KiB /9/12S (2|25|36): objs=135 size=173B /9/13N (2|25|36): objs=6682 size=32.75KiB /9/14S (2|25|36): objs=163 size=329B /9/15N (2|25|36): objs=906 size=3.34KiB /9/16S (2|25|36): objs=143 size=152B /9/17N (2|25|36): objs=298 size=803B /9/18S (2|25|36): objs=144 size=146B /9/19N (2|25|36): objs=893 size=3.76KiB /9/20S (2|25|36): objs=153 size=132B /9/21N (2|25|36): objs=1264 size=5.17KiB /9/22S (2|25|36): objs=175 size=210B /9/23S (2|25|36): objs=150 size=90B /9/24S (2|25|36): objs=113 size=226B /9/25N (2|25|36): objs=4730 size=20.73KiB /9/26S (2|25|36): objs=131 size=224B /9/27N (2|25|36): objs=2160 size=9.29KiB /9/28S (2|25|36): objs=167 size=228B /9/29N (2|25|36): objs=1034 size=4.19KiB /9/30S (2|25|36): objs=158 size=147B /9/31N (2|25|36): objs=4641 size=23.67KiB /9/32S (2|25|36): objs=162 size=328B /9/33N (2|25|36): objs=302 size=920B /9/34S (2|25|36): objs=149 size=188B /9/35N (2|25|36): objs=1379 size=5.45KiB /10/0N (2|25|36): objs=41965 size=830.82KiB /10/1N (2|25|36): objs=37807 size=739.7KiB /10/2N (2|25|36): objs=19975 size=144.54KiB /10/3S (2|25|36): objs=188 size=117B /10/4N (2|25|36): objs=20072 size=178.52KiB /10/5S (2|25|36): objs=147 size=174B /10/6N (2|25|36): objs=752 size=2.81KiB /10/7N (2|25|36): objs=1355 size=5.22KiB /10/8S (2|25|36): objs=147 size=157B /10/9N (2|25|36): objs=877 size=3.46KiB /10/10S (2|25|36): objs=168 size=214B /10/11N (2|25|36): objs=5065 size=25.59KiB /10/12S (2|25|36): objs=142 size=205B /10/14S (2|25|36): objs=150 size=190B /10/15N (2|25|36): objs=3131 size=13.43KiB /10/16S (2|25|36): objs=171 size=274B /10/17S (2|25|36): objs=164 size=103B /10/18S (2|25|36): objs=154 size=281B /10/19N (2|25|36): objs=2973 size=13.27KiB /10/20S (2|25|36): objs=149 size=136B /10/21N (2|25|36): objs=2956 size=12.79KiB /10/22S (2|25|36): objs=162 size=348B /10/23N (2|25|36): objs=6815 size=30.64KiB /10/24S (2|25|36): objs=155 size=174B /10/25N (2|25|36): objs=1055 size=4.48KiB /10/26S (2|25|36): objs=168 size=262B /10/28S (2|25|36): objs=139 size=337B /10/29N (2|25|36): objs=289 size=689B /10/30S (2|25|36): objs=162 size=152B /10/31N (2|25|36): objs=3148 size=13.46KiB /10/32S (2|25|36): objs=136 size=213B /10/33N (2|25|36): objs=7511 size=39.37KiB /10/34S (2|25|36): objs=171 size=188B /10/35N (2|25|36): objs=783 size=3KiB /11/0N (2|25|36): objs=37919 size=795.61KiB /11/1N (2|25|36): objs=40310 size=870.16KiB /11/2N (2|25|36): objs=40087 size=728.28KiB /11/3S (2|25|36): objs=164 size=197B /11/4N (2|25|36): objs=2867 size=12.42KiB /11/5N (2|25|36): objs=290 size=721B /11/6S (2|25|36): objs=163 size=303B /11/7N (2|25|36): objs=1431 size=5.92KiB /11/8S (2|25|36): objs=148 size=154B /11/9S (2|25|36): objs=154 size=152B /11/10S (2|25|36): objs=161 size=238B /11/11S (2|25|36): objs=142 size=150B /11/12S (2|25|36): objs=152 size=231B /11/13N (2|25|36): objs=1337 size=5.35KiB /11/14S (2|25|36): objs=140 size=94B /11/15N (2|25|36): objs=314 size=890B /11/16S (2|25|36): objs=163 size=307B /11/17N (2|25|36): objs=9326 size=51.08KiB /11/18S (2|25|36): objs=173 size=252B /11/19N (2|25|36): objs=1126 size=4.42KiB /11/20S (2|25|36): objs=156 size=310B /11/21N (2|25|36): objs=2037 size=8.36KiB /11/22S (2|25|36): objs=168 size=136B /11/23N (2|25|36): objs=323 size=1016B /11/24S (2|25|36): objs=151 size=159B /11/25N (2|25|36): objs=612 size=2.28KiB /11/26S (2|25|36): objs=182 size=329B /11/27N (2|25|36): objs=5766 size=25.64KiB /11/28S (2|25|36): objs=150 size=126B /11/29N (2|25|36): objs=772 size=2.86KiB /11/30S (2|25|36): objs=153 size=200B /11/31N (2|25|36): objs=1660 size=6.82KiB /11/32S (2|25|36): objs=148 size=206B /11/33N (2|25|36): objs=7575 size=35.41KiB /11/34S (2|25|36): objs=164 size=259B /11/35N (2|25|36): objs=4165 size=19.25KiB /12/0N (2|25|36): objs=37557 size=664.78KiB /12/1N (2|25|36): objs=40326 size=952.2KiB /12/2N (2|25|36): objs=26284 size=319.03KiB /12/3S (2|25|36): objs=152 size=223B /12/4N (2|25|36): objs=11615 size=67.25KiB /12/5N (2|25|36): objs=12874 size=73.89KiB /12/6S (2|25|36): objs=163 size=233B /12/7S (2|25|36): objs=135 size=201B /12/8S (2|25|36): objs=161 size=216B /12/9N (2|25|36): objs=300 size=1.02KiB /12/10S (2|25|36): objs=157 size=215B /12/11S (2|25|36): objs=145 size=114B /12/12S (2|25|36): objs=171 size=88B /12/13N (2|25|36): objs=1294 size=5.07KiB /12/14S (2|25|36): objs=146 size=128B /12/15N (2|25|36): objs=1241 size=4.74KiB /12/16S (2|25|36): objs=161 size=199B /12/17N (2|25|36): objs=283 size=840B /12/18S (2|25|36): objs=163 size=251B /12/19S (2|25|36): objs=143 size=245B /12/20S (2|25|36): objs=179 size=169B /12/21N (2|25|36): objs=4691 size=20.52KiB /12/22S (2|25|36): objs=143 size=217B /12/23N (2|25|36): objs=4577 size=23.37KiB /12/24S (2|25|36): objs=139 size=317B /12/25N (2|25|36): objs=3023 size=13.14KiB /12/26S (2|25|36): objs=157 size=290B /12/27N (2|25|36): objs=626 size=2.36KiB /12/28S (2|25|36): objs=134 size=317B /12/29N (2|25|36): objs=438 size=1.38KiB /12/30S (2|25|36): objs=132 size=332B /12/31N (2|25|36): objs=3898 size=17.37KiB /12/32S (2|25|36): objs=161 size=299B /12/33N (2|25|36): objs=2039 size=8.22KiB /12/34S (2|25|36): objs=157 size=131B /12/35N (2|25|36): objs=4384 size=18.55KiB /13/0N (2|25|36): objs=42160 size=982.16KiB /13/1N (2|25|36): objs=38643 size=705.54KiB /13/2N (2|25|36): objs=24262 size=227.9KiB /13/3S (2|25|36): objs=175 size=254B /13/4N (2|25|36): objs=10110 size=56.55KiB /13/5S (2|25|36): objs=155 size=137B /13/6N (2|25|36): objs=4806 size=21.63KiB /13/7N (2|25|36): objs=483 size=1.83KiB /13/8S (2|25|36): objs=133 size=229B /13/9N (2|25|36): objs=2137 size=9.32KiB /13/10S (2|25|36): objs=147 size=102B /13/11N (2|25|36): objs=3796 size=16.07KiB /13/12S (2|25|36): objs=148 size=128B /13/13N (2|25|36): objs=2765 size=11.85KiB /13/14S (2|25|36): objs=155 size=201B /13/15N (2|25|36): objs=3108 size=12.97KiB /13/16S (2|25|36): objs=120 size=305B /13/17S (2|25|36): objs=151 size=96B /13/18S (2|25|36): objs=148 size=229B /13/19N (2|25|36): objs=7418 size=35.76KiB /13/20S (2|25|36): objs=174 size=344B /13/21N (2|25|36): objs=3720 size=16.63KiB /13/22S (2|25|36): objs=157 size=227B /13/23N (2|25|36): objs=719 size=2.76KiB /13/24S (2|25|36): objs=160 size=222B /13/25N (2|25|36): objs=473 size=1.71KiB /13/26S (2|25|36): objs=145 size=158B /13/27N (2|25|36): objs=2027 size=8.43KiB /13/28S (2|25|36): objs=177 size=180B /13/29N (2|25|36): objs=1487 size=6.01KiB /13/30S (2|25|36): objs=157 size=178B /13/31S (2|25|36): objs=138 size=121B /13/32S (2|25|36): objs=160 size=232B /13/33N (2|25|36): objs=1329 size=5.31KiB /13/34S (2|25|36): objs=135 size=167B /13/35N (2|25|36): objs=4695 size=21.82KiB /14/0N (1|26|34): objs=71372 size=2.31MiB /14/1N (1|26|34): objs=44437 size=1.07MiB /14/2S (1|26|34): objs=158 size=106B /14/3N (1|26|34): objs=1608 size=6.47KiB /14/4S (1|26|34): objs=148 size=133B /14/5N (1|26|34): objs=957 size=3.8KiB /14/6S (1|26|34): objs=154 size=339B /14/8S (1|26|34): objs=138 size=123B /14/9N (1|26|34): objs=286 size=825B /14/10S (1|26|34): objs=157 size=304B /14/11N (1|26|34): objs=1207 size=5.09KiB /14/12S (1|26|34): objs=156 size=95B /14/13N (1|26|34): objs=1337 size=5.27KiB /14/14S (1|26|34): objs=131 size=88B /14/15N (1|26|34): objs=789 size=3.01KiB /14/16S (1|26|34): objs=143 size=331B /14/17N (1|26|34): objs=2346 size=9.89KiB /14/18S (1|26|34): objs=152 size=310B /14/19N (1|26|34): objs=425 size=1.47KiB /14/20S (1|26|34): objs=146 size=109B /14/21N (1|26|34): objs=5603 size=27.66KiB /14/22S (1|26|34): objs=159 size=205B /14/23N (1|26|34): objs=5370 size=23.05KiB /14/24S (1|26|34): objs=152 size=123B /14/25N (1|26|34): objs=1222 size=5.03KiB /14/26S (1|26|34): objs=152 size=146B /14/27N (1|26|34): objs=578 size=2.13KiB /14/28S (1|26|34): objs=160 size=101B /14/29N (1|26|34): objs=476 size=1.52KiB /14/30S (1|26|34): objs=142 size=251B /14/31N (1|26|34): objs=1196 size=4.97KiB /14/32S (1|26|34): objs=158 size=317B /14/33N (1|26|34): objs=809 size=2.96KiB /15/0N (2|25|36): objs=39283 size=757.22KiB /15/1N (2|25|36): objs=31004 size=412.79KiB /15/2S (2|25|36): objs=145 size=331B /15/3N (2|25|36): objs=8678 size=44.89KiB /15/4N (2|25|36): objs=36359 size=770.38KiB /15/5S (2|25|36): objs=164 size=248B /15/6N (2|25|36): objs=1314 size=5.65KiB /15/7N (2|25|36): objs=1516 size=6.23KiB /15/8S (2|25|36): objs=161 size=144B /15/9N (2|25|36): objs=1386 size=5.59KiB /15/10S (2|25|36): objs=145 size=101B /15/11N (2|25|36): objs=1044 size=4.24KiB /15/12S (2|25|36): objs=151 size=326B /15/13N (2|25|36): objs=1846 size=7.63KiB /15/14S (2|25|36): objs=130 size=266B /15/15N (2|25|36): objs=601 size=2.18KiB /15/16S (2|25|36): objs=147 size=119B /15/17N (2|25|36): objs=2436 size=10.25KiB /15/18S (2|25|36): objs=151 size=183B /15/19N (2|25|36): objs=3816 size=16.16KiB /15/20S (2|25|36): objs=166 size=284B /15/21N (2|25|36): objs=2430 size=9.92KiB /15/22S (2|25|36): objs=182 size=191B /15/23N (2|25|36): objs=5198 size=22.26KiB /15/24S (2|25|36): objs=145 size=288B /15/25N (2|25|36): objs=4836 size=20.8KiB /15/26S (2|25|36): objs=130 size=277B /15/27N (2|25|36): objs=3181 size=13.73KiB /15/28S (2|25|36): objs=140 size=316B /15/29N (2|25|36): objs=633 size=2.19KiB /15/30S (2|25|36): objs=140 size=240B /15/31N (2|25|36): objs=6893 size=36.29KiB /15/32S (2|25|36): objs=137 size=221B /15/33N (2|25|36): objs=1449 size=5.84KiB /15/34S (2|25|36): objs=175 size=106B /15/35N (2|25|36): objs=1970 size=8.16KiB /16/0N (2|25|36): objs=38985 size=742.19KiB /16/1N (2|25|36): objs=40964 size=915.69KiB /16/2N (2|25|36): objs=39253 size=722.41KiB /16/3N (2|25|36): objs=4860 size=21.96KiB /16/4S (2|25|36): objs=167 size=207B /16/5N (2|25|36): objs=2776 size=11.7KiB /16/6S (2|25|36): objs=135 size=312B /16/7N (2|25|36): objs=448 size=1.58KiB /16/8S (2|25|36): objs=140 size=312B /16/9N (2|25|36): objs=2220 size=9.78KiB /16/10S (2|25|36): objs=131 size=268B /16/11N (2|25|36): objs=1758 size=7.23KiB /16/12S (2|25|36): objs=144 size=155B /16/13N (2|25|36): objs=321 size=1003B /16/14S (2|25|36): objs=156 size=245B /16/15N (2|25|36): objs=341 size=957B /16/16S (2|25|36): objs=147 size=106B /16/17N (2|25|36): objs=1771 size=7.39KiB /16/18S (2|25|36): objs=166 size=97B /16/19N (2|25|36): objs=5863 size=29.01KiB /16/20S (2|25|36): objs=163 size=161B /16/21N (2|25|36): objs=741 size=2.9KiB /16/22S (2|25|36): objs=142 size=193B /16/23N (2|25|36): objs=818 size=3.03KiB /16/24S (2|25|36): objs=148 size=318B /16/25N (2|25|36): objs=1706 size=6.93KiB /16/26S (2|25|36): objs=157 size=308B /16/27N (2|25|36): objs=8549 size=40.48KiB /16/28S (2|25|36): objs=149 size=95B /16/29N (2|25|36): objs=1548 size=6.27KiB /16/30S (2|25|36): objs=131 size=296B /16/31N (2|25|36): objs=1832 size=7.53KiB /16/32S (2|25|36): objs=147 size=332B /16/33N (2|25|36): objs=1886 size=7.83KiB /16/34S (2|25|36): objs=146 size=301B /16/35S (2|25|36): objs=169 size=197B /17/0N (2|25|36): objs=36212 size=616.19KiB /17/1N (2|25|36): objs=36515 size=758.61KiB /17/2N (2|25|36): objs=36040 size=669.02KiB /17/3S (2|25|36): objs=137 size=112B /17/4N (2|25|36): objs=6469 size=32.65KiB /17/5N (2|25|36): objs=4870 size=25.32KiB /17/6S (2|25|36): objs=168 size=199B /17/7N (2|25|36): objs=309 size=955B /17/8S (2|25|36): objs=152 size=325B /17/10S (2|25|36): objs=140 size=233B /17/11N (2|25|36): objs=5423 size=25.13KiB /17/12S (2|25|36): objs=137 size=197B /17/13N (2|25|36): objs=8291 size=43.67KiB /17/14S (2|25|36): objs=180 size=130B /17/15N (2|25|36): objs=3328 size=14.66KiB /17/16S (2|25|36): objs=172 size=132B /17/18S (2|25|36): objs=162 size=201B /17/19N (2|25|36): objs=329 size=957B /17/20S (2|25|36): objs=145 size=180B /17/21N (2|25|36): objs=2936 size=12.23KiB /17/22S (2|25|36): objs=158 size=331B /17/23N (2|25|36): objs=739 size=2.84KiB /17/24S (2|25|36): objs=158 size=256B /17/25N (2|25|36): objs=769 size=2.99KiB /17/26S (2|25|36): objs=162 size=166B /17/27N (2|25|36): objs=1148 size=4.58KiB /17/28S (2|25|36): objs=144 size=121B /17/29N (2|25|36): objs=3586 size=15.96KiB /17/30S (2|25|36): objs=152 size=184B /17/31N (2|25|36): objs=3879 size=17.66KiB /17/32S (2|25|36): objs=169 size=296B /17/34S (2|25|36): objs=158 size=160B /17/35N (2|25|36): objs=594 size=2.3KiB /18/0N (2|25|36): objs=39686 size=817.97KiB /18/1N (2|25|36): objs=39480 size=814.5KiB /18/2N (2|25|36): objs=36573 size=683.37KiB /18/3N (2|25|36): objs=1364 size=5.41KiB /18/4S (2|25|36): objs=158 size=95B /18/5N (2|25|36): objs=1235 size=4.87KiB /18/6S (2|25|36): objs=153 size=87B /18/7N (2|25|36): objs=1221 size=4.91KiB /18/8S (2|25|36): objs=132 size=308B /18/9N (2|25|36): objs=2705 size=11.48KiB /18/10S (2|25|36): objs=149 size=129B /18/11N (2|25|36): objs=5297 size=24.24KiB /18/12S (2|25|36): objs=167 size=123B /18/13N (2|25|36): objs=1541 size=6.2KiB /18/14S (2|25|36): objs=158 size=209B /18/15N (2|25|36): objs=1256 size=5.16KiB /18/16S (2|25|36): objs=161 size=260B /18/17N (2|25|36): objs=1523 size=6.01KiB /18/18S (2|25|36): objs=146 size=116B /18/19N (2|25|36): objs=2340 size=9.98KiB /18/20S (2|25|36): objs=134 size=287B /18/21N (2|25|36): objs=5004 size=22.54KiB /18/22S (2|25|36): objs=125 size=175B /18/23N (2|25|36): objs=1926 size=8.1KiB /18/24S (2|25|36): objs=132 size=164B /18/25N (2|25|36): objs=1153 size=4.94KiB /18/26S (2|25|36): objs=152 size=188B /18/27N (2|25|36): objs=4612 size=20.3KiB /18/28S (2|25|36): objs=142 size=259B /18/29N (2|25|36): objs=1535 size=6.16KiB /18/30S (2|25|36): objs=161 size=292B /18/31N (2|25|36): objs=4257 size=17.92KiB /18/32S (2|25|36): objs=146 size=226B /18/33S (2|25|36): objs=160 size=194B /18/34S (2|25|36): objs=139 size=180B /18/35N (2|25|36): objs=464 size=1.73KiB /19/0N (2|25|36): objs=38899 size=843.08KiB /19/1N (2|25|36): objs=39055 size=763.04KiB /19/2N (2|25|36): objs=8577 size=38.25KiB /19/3S (2|25|36): objs=133 size=294B /19/4N (2|25|36): objs=27759 size=318.38KiB /19/5N (2|25|36): objs=11062 size=58.25KiB /19/6S (2|25|36): objs=164 size=299B /19/8S (2|25|36): objs=167 size=130B /19/9N (2|25|36): objs=773 size=3.25KiB /19/10S (2|25|36): objs=151 size=185B /19/11N (2|25|36): objs=2259 size=9.21KiB /19/12S (2|25|36): objs=158 size=207B /19/13N (2|25|36): objs=310 size=849B /19/14S (2|25|36): objs=153 size=264B /19/15N (2|25|36): objs=4364 size=18.58KiB /19/16S (2|25|36): objs=152 size=217B /19/17N (2|25|36): objs=3313 size=13.96KiB /19/18S (2|25|36): objs=162 size=323B /19/19N (2|25|36): objs=3165 size=14.71KiB /19/20S (2|25|36): objs=151 size=155B /19/22S (2|25|36): objs=160 size=108B /19/23N (2|25|36): objs=1512 size=6.05KiB /19/24S (2|25|36): objs=156 size=140B /19/25N (2|25|36): objs=804 size=3.07KiB /19/26S (2|25|36): objs=145 size=152B /19/28S (2|25|36): objs=141 size=140B /19/29N (2|25|36): objs=480 size=1.54KiB /19/30S (2|25|36): objs=149 size=110B /19/31N (2|25|36): objs=2916 size=12.23KiB /19/32S (2|25|36): objs=148 size=234B /19/33N (2|25|36): objs=1678 size=7.07KiB /19/34S (2|25|36): objs=141 size=265B /19/35N (2|25|36): objs=3963 size=18.41KiB /20/0N (2|25|36): objs=42171 size=1001.4KiB /20/1N (2|25|36): objs=41897 size=931.44KiB /20/2N (2|25|36): objs=39330 size=817.56KiB /20/3N (2|25|36): objs=8441 size=37.55KiB /20/4S (2|25|36): objs=152 size=183B /20/5N (2|25|36): objs=5150 size=23.69KiB /20/6S (2|25|36): objs=183 size=268B /20/7N (2|25|36): objs=898 size=3.57KiB /20/8S (2|25|36): objs=145 size=86B /20/9N (2|25|36): objs=2050 size=8.61KiB /20/10S (2|25|36): objs=170 size=194B /20/11N (2|25|36): objs=1922 size=8.03KiB /20/12S (2|25|36): objs=145 size=246B /20/13N (2|25|36): objs=936 size=3.48KiB /20/14S (2|25|36): objs=174 size=185B /20/15N (2|25|36): objs=1078 size=4.07KiB /20/16S (2|25|36): objs=179 size=201B /20/17N (2|25|36): objs=4057 size=17.88KiB /20/18S (2|25|36): objs=154 size=115B /20/19N (2|25|36): objs=297 size=954B /20/20S (2|25|36): objs=142 size=168B /20/21N (2|25|36): objs=1217 size=4.77KiB /20/22S (2|25|36): objs=159 size=122B /20/23N (2|25|36): objs=3546 size=19.06KiB /20/24S (2|25|36): objs=134 size=124B /20/25N (2|25|36): objs=2484 size=10.18KiB /20/26S (2|25|36): objs=155 size=191B /20/27N (2|25|36): objs=2578 size=11.32KiB /20/28S (2|25|36): objs=149 size=286B /20/29N (2|25|36): objs=297 size=1000B /20/30S (2|25|36): objs=163 size=90B /20/31N (2|25|36): objs=1099 size=4.22KiB /20/32S (2|25|36): objs=167 size=320B /20/33N (2|25|36): objs=320 size=1.05KiB /20/34S (2|25|36): objs=145 size=124B /20/35S (2|25|36): objs=148 size=151B /21/0N (2|25|36): objs=39323 size=702.95KiB /21/1N (2|25|36): objs=37586 size=614.6KiB /21/2N (2|25|36): objs=43429 size=945.18KiB /21/3N (2|25|36): objs=14389 size=98.6KiB /21/4S (2|25|36): objs=154 size=224B /21/5N (2|25|36): objs=2579 size=11.26KiB /21/6S (2|25|36): objs=157 size=100B /21/7N (2|25|36): objs=1554 size=6.41KiB /21/8S (2|25|36): objs=150 size=140B /21/9N (2|25|36): objs=3250 size=13.98KiB /21/10S (2|25|36): objs=138 size=271B /21/12S (2|25|36): objs=142 size=218B /21/13N (2|25|36): objs=439 size=1.57KiB /21/14S (2|25|36): objs=164 size=189B /21/15N (2|25|36): objs=1952 size=8.12KiB /21/16S (2|25|36): objs=148 size=287B /21/17N (2|25|36): objs=834 size=3.18KiB /21/18S (2|25|36): objs=189 size=260B /21/20S (2|25|36): objs=144 size=174B /21/21N (2|25|36): objs=951 size=3.61KiB /21/22S (2|25|36): objs=161 size=209B /21/23N (2|25|36): objs=1556 size=6.45KiB /21/24S (2|25|36): objs=162 size=89B /21/25N (2|25|36): objs=3253 size=13.98KiB /21/26S (2|25|36): objs=156 size=273B /21/27N (2|25|36): objs=1288 size=5.29KiB /21/28S (2|25|36): objs=147 size=120B /21/30S (2|25|36): objs=138 size=237B /21/32S (2|25|36): objs=157 size=233B /21/33N (2|25|36): objs=1858 size=7.72KiB /21/34S (2|25|36): objs=166 size=286B /21/35N (2|25|36): objs=1697 size=6.67KiB /22/0N (2|25|36): objs=36619 size=781.44KiB /22/1N (2|25|36): objs=42467 size=923.55KiB /22/2N (2|25|36): objs=37929 size=775.49KiB /22/3N (2|25|36): objs=16687 size=101.2KiB /22/4S (2|25|36): objs=137 size=173B /22/5N (2|25|36): objs=1828 size=7.36KiB /22/6S (2|25|36): objs=141 size=258B /22/7N (2|25|36): objs=650 size=2.35KiB /22/8S (2|25|36): objs=153 size=322B /22/9N (2|25|36): objs=611 size=2.44KiB /22/10S (2|25|36): objs=168 size=246B /22/11S (2|25|36): objs=168 size=272B /22/12S (2|25|36): objs=162 size=242B /22/13N (2|25|36): objs=810 size=3.02KiB /22/14S (2|25|36): objs=158 size=233B /22/15N (2|25|36): objs=5168 size=24.17KiB /22/16S (2|25|36): objs=160 size=127B /22/17N (2|25|36): objs=642 size=2.4KiB /22/18S (2|25|36): objs=174 size=324B /22/19N (2|25|36): objs=441 size=1.28KiB /22/20S (2|25|36): objs=136 size=282B /22/22S (2|25|36): objs=149 size=267B /22/23N (2|25|36): objs=636 size=2.44KiB /22/24S (2|25|36): objs=174 size=357B /22/25N (2|25|36): objs=2944 size=12.23KiB /22/26S (2|25|36): objs=150 size=244B /22/27N (2|25|36): objs=1244 size=5.04KiB /22/28S (2|25|36): objs=165 size=182B /22/29N (2|25|36): objs=640 size=2.28KiB /22/30S (2|25|36): objs=162 size=305B /22/32S (2|25|36): objs=140 size=311B /22/33N (2|25|36): objs=2501 size=10.42KiB /22/34S (2|25|36): objs=145 size=329B /22/35N (2|25|36): objs=1188 size=5.01KiB /23/0N (2|25|36): objs=40096 size=947.15KiB /23/1N (2|25|36): objs=40684 size=810.59KiB /23/2N (2|25|36): objs=3863 size=17.65KiB /23/3S (2|25|36): objs=155 size=101B /23/4N (2|25|36): objs=31697 size=493.45KiB /23/5S (2|25|36): objs=174 size=252B /23/6N (2|25|36): objs=3762 size=15.93KiB /23/7S (2|25|36): objs=195 size=132B /23/8S (2|25|36): objs=179 size=204B /23/9S (2|25|36): objs=166 size=273B /23/10N (2|25|36): objs=487 size=1.39KiB /23/11N (2|25|36): objs=596 size=2.25KiB /23/12S (2|25|36): objs=147 size=227B /23/13N (2|25|36): objs=1282 size=4.78KiB /23/14S (2|25|36): objs=144 size=273B /23/15N (2|25|36): objs=4985 size=22.11KiB /23/16S (2|25|36): objs=155 size=324B /23/17N (2|25|36): objs=1712 size=6.92KiB /23/18S (2|25|36): objs=142 size=160B /23/19N (2|25|36): objs=620 size=2.58KiB /23/20S (2|25|36): objs=144 size=151B /23/21N (2|25|36): objs=930 size=3.68KiB /23/22S (2|25|36): objs=156 size=284B /23/23N (2|25|36): objs=5072 size=25.55KiB /23/24S (2|25|36): objs=162 size=144B /23/25N (2|25|36): objs=3805 size=15.84KiB /23/26S (2|25|36): objs=190 size=212B /23/27N (2|25|36): objs=8924 size=54.18KiB /23/28S (2|25|36): objs=182 size=91B /23/29N (2|25|36): objs=4778 size=20.54KiB /23/30S (2|25|36): objs=131 size=131B /23/31N (2|25|36): objs=2165 size=9.03KiB /23/32S (2|25|36): objs=173 size=273B /23/33N (2|25|36): objs=352 size=1.12KiB /23/34S (2|25|36): objs=164 size=193B /23/35N (2|25|36): objs=753 size=2.79KiB /24/0N (2|25|36): objs=39098 size=765.66KiB /24/1N (2|25|36): objs=43246 size=998.75KiB /24/2N (2|25|36): objs=38291 size=730.39KiB /24/3N (2|25|36): objs=5834 size=26.96KiB /24/4S (2|25|36): objs=154 size=135B /24/5N (2|25|36): objs=2396 size=9.92KiB /24/6S (2|25|36): objs=164 size=299B /24/7N (2|25|36): objs=652 size=2.28KiB /24/8S (2|25|36): objs=153 size=105B /24/9N (2|25|36): objs=3380 size=15.08KiB /24/10S (2|25|36): objs=151 size=95B /24/11N (2|25|36): objs=3488 size=14.71KiB /24/12S (2|25|36): objs=155 size=310B /24/13N (2|25|36): objs=3346 size=14.96KiB /24/14S (2|25|36): objs=138 size=129B /24/15N (2|25|36): objs=935 size=3.8KiB /24/16S (2|25|36): objs=139 size=131B /24/17N (2|25|36): objs=3496 size=14.86KiB /24/18S (2|25|36): objs=148 size=281B /24/19S (2|25|36): objs=135 size=89B /24/20S (2|25|36): objs=150 size=303B /24/22S (2|25|36): objs=168 size=322B /24/23N (2|25|36): objs=354 size=1.04KiB /24/24S (2|25|36): objs=148 size=276B /24/25N (2|25|36): objs=4128 size=17.61KiB /24/26S (2|25|36): objs=149 size=102B /24/27N (2|25|36): objs=3883 size=19.47KiB /24/28S (2|25|36): objs=146 size=171B /24/29S (2|25|36): objs=151 size=145B /24/30S (2|25|36): objs=166 size=195B /24/31N (2|25|36): objs=1170 size=4.62KiB /24/32S (2|25|36): objs=152 size=137B /24/33S (2|25|36): objs=160 size=216B /24/34S (2|25|36): objs=146 size=329B /24/35N (2|25|36): objs=1515 size=6.33KiB /25/0N (2|25|36): objs=37147 size=569.74KiB /25/1N (2|25|36): objs=43385 size=1.01MiB /25/2N (2|25|36): objs=40291 size=824.61KiB /25/3S (2|25|36): objs=151 size=111B /25/4N (2|25|36): objs=500 size=1.65KiB /25/5S (2|25|36): objs=142 size=318B /25/6N (2|25|36): objs=297 size=724B /25/7N (2|25|36): objs=1105 size=4.38KiB /25/8S (2|25|36): objs=151 size=177B /25/10S (2|25|36): objs=148 size=294B /25/11N (2|25|36): objs=7375 size=34.16KiB /25/12S (2|25|36): objs=149 size=92B /25/13N (2|25|36): objs=8011 size=39.03KiB /25/14S (2|25|36): objs=131 size=293B /25/15S (2|25|36): objs=157 size=286B /25/16S (2|25|36): objs=139 size=181B /25/17N (2|25|36): objs=4194 size=18.13KiB /25/18S (2|25|36): objs=161 size=282B /25/19N (2|25|36): objs=747 size=2.68KiB /25/20S (2|25|36): objs=172 size=259B /25/21N (2|25|36): objs=4462 size=20.17KiB /25/22S (2|25|36): objs=148 size=254B /25/23N (2|25|36): objs=1837 size=7.58KiB /25/24S (2|25|36): objs=155 size=326B /25/25N (2|25|36): objs=303 size=873B /25/26S (2|25|36): objs=163 size=106B /25/27N (2|25|36): objs=1890 size=7.87KiB /25/28S (2|25|36): objs=155 size=190B /25/29N (2|25|36): objs=2002 size=8.31KiB /25/30S (2|25|36): objs=158 size=255B /25/31N (2|25|36): objs=3485 size=14.62KiB /25/32S (2|25|36): objs=162 size=223B /25/33S (2|25|36): objs=172 size=110B /25/34S (2|25|36): objs=153 size=109B /26/0N (2|25|36): objs=36934 size=665.48KiB /26/1N (2|25|36): objs=41452 size=978.81KiB /26/2N (2|25|36): objs=39483 size=742.32KiB /26/3N (2|25|36): objs=12456 size=70.25KiB /26/4S (2|25|36): objs=148 size=123B /26/5N (2|25|36): objs=1526 size=6.15KiB /26/6S (2|25|36): objs=166 size=333B /26/7N (2|25|36): objs=2064 size=8.58KiB /26/8S (2|25|36): objs=163 size=146B /26/9N (2|25|36): objs=1419 size=5.88KiB /26/10S (2|25|36): objs=152 size=219B /26/11N (2|25|36): objs=1241 size=4.93KiB /26/12S (2|25|36): objs=156 size=174B /26/13N (2|25|36): objs=8150 size=39.4KiB /26/14S (2|25|36): objs=153 size=117B /26/16S (2|25|36): objs=154 size=237B /26/17N (2|25|36): objs=661 size=2.31KiB /26/18S (2|25|36): objs=155 size=189B /26/19N (2|25|36): objs=2889 size=12.33KiB /26/20S (2|25|36): objs=163 size=176B /26/21N (2|25|36): objs=2276 size=9.51KiB /26/22S (2|25|36): objs=146 size=189B /26/23N (2|25|36): objs=873 size=3.39KiB /26/24S (2|25|36): objs=151 size=118B /26/25N (2|25|36): objs=1681 size=6.94KiB /26/26S (2|25|36): objs=158 size=286B /26/27N (2|25|36): objs=787 size=3.12KiB /26/28S (2|25|36): objs=170 size=98B /26/29N (2|25|36): objs=785 size=3.14KiB /26/30S (2|25|36): objs=155 size=187B /26/31N (2|25|36): objs=285 size=1.02KiB /26/32S (2|25|36): objs=149 size=279B /26/33N (2|25|36): objs=912 size=3.59KiB /26/34S (2|25|36): objs=146 size=333B /27/0N (2|25|36): objs=37154 size=685.2KiB /27/1N (2|25|36): objs=38639 size=663.29KiB /27/2N (2|25|36): objs=39294 size=857.53KiB /27/3N (2|25|36): objs=24338 size=203.53KiB /27/4S (2|25|36): objs=153 size=115B /27/6S (2|25|36): objs=147 size=154B /27/7N (2|25|36): objs=1072 size=4.33KiB /27/8S (2|25|36): objs=149 size=111B /27/9N (2|25|36): objs=2089 size=8.49KiB /27/10S (2|25|36): objs=126 size=225B /27/11N (2|25|36): objs=429 size=1.47KiB /27/12S (2|25|36): objs=154 size=205B /27/13S (2|25|36): objs=161 size=213B /27/14S (2|25|36): objs=144 size=265B /27/15N (2|25|36): objs=2382 size=10.39KiB /27/16S (2|25|36): objs=135 size=102B /27/17N (2|25|36): objs=866 size=3.55KiB /27/18S (2|25|36): objs=140 size=229B /27/19N (2|25|36): objs=1251 size=4.7KiB /27/20S (2|25|36): objs=143 size=102B /27/22S (2|25|36): objs=157 size=276B /27/23N (2|25|36): objs=431 size=1.59KiB /27/24S (2|25|36): objs=143 size=156B /27/25N (2|25|36): objs=1072 size=4.31KiB /27/26S (2|25|36): objs=148 size=117B /27/28S (2|25|36): objs=170 size=188B /27/29N (2|25|36): objs=474 size=1.67KiB /27/30S (2|25|36): objs=165 size=153B /27/31N (2|25|36): objs=262 size=931B /27/32S (2|25|36): objs=156 size=162B /27/33N (2|25|36): objs=2085 size=8.71KiB /27/34S (2|25|36): objs=166 size=352B /27/35N (2|25|36): objs=1522 size=6.1KiB /28/0N (2|25|36): objs=40872 size=856.67KiB /28/1N (2|25|36): objs=41128 size=977.82KiB /28/2N (2|25|36): objs=33426 size=555.07KiB /28/3S (2|25|36): objs=183 size=148B /28/4N (2|25|36): objs=3728 size=15.72KiB /28/5N (2|25|36): objs=746 size=2.8KiB /28/6S (2|25|36): objs=170 size=192B /28/7N (2|25|36): objs=1620 size=6.73KiB /28/8S (2|25|36): objs=149 size=307B /28/9N (2|25|36): objs=1036 size=4.13KiB /28/10S (2|25|36): objs=121 size=294B /28/11N (2|25|36): objs=2026 size=8.04KiB /28/12S (2|25|36): objs=139 size=234B /28/13N (2|25|36): objs=5956 size=28.95KiB /28/14S (2|25|36): objs=157 size=153B /28/15N (2|25|36): objs=756 size=2.78KiB /28/16S (2|25|36): objs=165 size=280B /28/17N (2|25|36): objs=2483 size=10.81KiB /28/18S (2|25|36): objs=159 size=179B /28/19N (2|25|36): objs=5332 size=24.68KiB /28/20S (2|25|36): objs=157 size=201B /28/21N (2|25|36): objs=893 size=3.4KiB /28/22S (2|25|36): objs=150 size=170B /28/23N (2|25|36): objs=7370 size=37.02KiB /28/24S (2|25|36): objs=168 size=333B /28/25N (2|25|36): objs=1040 size=4.39KiB /28/26S (2|25|36): objs=138 size=274B /28/27N (2|25|36): objs=739 size=2.83KiB /28/28S (2|25|36): objs=153 size=101B /28/29N (2|25|36): objs=310 size=972B /28/30S (2|25|36): objs=164 size=240B /28/31N (2|25|36): objs=3799 size=17.49KiB /28/32S (2|25|36): objs=143 size=172B /28/33N (2|25|36): objs=798 size=2.93KiB /28/34S (2|25|36): objs=150 size=210B /28/35N (2|25|36): objs=809 size=3.17KiB /29/0N (2|25|36): objs=36426 size=635.41KiB /29/1N (2|25|36): objs=42761 size=911.51KiB /29/2N (2|25|36): objs=40474 size=993.35KiB /29/3N (2|25|36): objs=10040 size=51.81KiB /29/4S (2|25|36): objs=163 size=350B /29/5N (2|25|36): objs=1965 size=8.28KiB /29/6S (2|25|36): objs=167 size=278B /29/7N (2|25|36): objs=3219 size=13.72KiB /29/8S (2|25|36): objs=139 size=267B /29/9N (2|25|36): objs=606 size=2.11KiB /29/10S (2|25|36): objs=155 size=238B /29/11N (2|25|36): objs=1713 size=7.2KiB /29/12S (2|25|36): objs=147 size=186B /29/13N (2|25|36): objs=792 size=2.99KiB /29/14S (2|25|36): objs=158 size=199B /29/15N (2|25|36): objs=4973 size=21.4KiB /29/16S (2|25|36): objs=178 size=217B /29/17N (2|25|36): objs=2107 size=8.49KiB /29/18S (2|25|36): objs=146 size=271B /29/19N (2|25|36): objs=597 size=2.25KiB /29/20S (2|25|36): objs=146 size=158B /29/21N (2|25|36): objs=939 size=3.57KiB /29/22S (2|25|36): objs=135 size=134B /29/23N (2|25|36): objs=1078 size=4.42KiB /29/24S (2|25|36): objs=149 size=194B /29/25N (2|25|36): objs=1828 size=7.51KiB /29/26S (2|25|36): objs=166 size=326B /29/28S (2|25|36): objs=159 size=344B /29/29N (2|25|36): objs=614 size=2.13KiB /29/30S (2|25|36): objs=158 size=191B /29/31N (2|25|36): objs=4169 size=18.8KiB /29/32S (2|25|36): objs=170 size=211B /29/33N (2|25|36): objs=2302 size=9.57KiB /29/34S (2|25|36): objs=179 size=147B /29/35N (2|25|36): objs=577 size=2.07KiB /30/0N (2|25|36): objs=37046 size=707.34KiB /30/1N (2|25|36): objs=32428 size=528.09KiB /30/2N (2|25|36): objs=38736 size=749.9KiB /30/3N (2|25|36): objs=14546 size=102.5KiB /30/4S (2|25|36): objs=143 size=335B /30/5N (2|25|36): objs=311 size=900B /30/6S (2|25|36): objs=169 size=128B /30/7N (2|25|36): objs=863 size=3.52KiB /30/8S (2|25|36): objs=159 size=273B /30/9N (2|25|36): objs=305 size=1.01KiB /30/10S (2|25|36): objs=145 size=228B /30/12S (2|25|36): objs=144 size=261B /30/13N (2|25|36): objs=315 size=1015B /30/14S (2|25|36): objs=167 size=283B /30/15N (2|25|36): objs=1870 size=7.77KiB /30/16S (2|25|36): objs=162 size=249B /30/17N (2|25|36): objs=714 size=2.71KiB /30/18S (2|25|36): objs=175 size=323B /30/19N (2|25|36): objs=3062 size=12.9KiB /30/20S (2|25|36): objs=159 size=270B /30/21N (2|25|36): objs=4258 size=18.95KiB /30/22S (2|25|36): objs=146 size=102B /30/23N (2|25|36): objs=2281 size=9.61KiB /30/24S (2|25|36): objs=143 size=139B /30/25N (2|25|36): objs=599 size=2.17KiB /30/26S (2|25|36): objs=154 size=146B /30/27N (2|25|36): objs=2199 size=9.25KiB /30/28S (2|25|36): objs=163 size=95B /30/29N (2|25|36): objs=1512 size=6.02KiB /30/30S (2|25|36): objs=150 size=89B /30/31N (2|25|36): objs=883 size=3.79KiB /30/32S (2|25|36): objs=156 size=227B /30/33N (2|25|36): objs=1247 size=5.19KiB /30/34S (2|25|36): objs=137 size=114B /30/35N (2|25|36): objs=1528 size=6.2KiB /31/0N (2|25|36): objs=38785 size=920.86KiB /31/1N (2|25|36): objs=39749 size=803.93KiB /31/2N (2|25|36): objs=14472 size=102.34KiB /31/3S (2|25|36): objs=148 size=219B /31/4N (2|25|36): objs=21036 size=163.64KiB /31/5N (2|25|36): objs=10796 size=62.25KiB /31/6S (2|25|36): objs=152 size=281B /31/7S (2|25|36): objs=148 size=164B /31/8S (2|25|36): objs=178 size=296B /31/9N (2|25|36): objs=3579 size=15.82KiB /31/10S (2|25|36): objs=166 size=126B /31/12S (2|25|36): objs=166 size=317B /31/13N (2|25|36): objs=1179 size=4.8KiB /31/14S (2|25|36): objs=154 size=128B /31/15N (2|25|36): objs=2693 size=11.39KiB /31/16S (2|25|36): objs=141 size=109B /31/17N (2|25|36): objs=726 size=2.8KiB /31/18S (2|25|36): objs=156 size=278B /31/19N (2|25|36): objs=902 size=3.4KiB /31/20S (2|25|36): objs=132 size=194B /31/21N (2|25|36): objs=4198 size=20.78KiB /31/22S (2|25|36): objs=153 size=217B /31/23N (2|25|36): objs=1984 size=8.32KiB /31/24S (2|25|36): objs=151 size=316B /31/25N (2|25|36): objs=1823 size=7.67KiB /31/26S (2|25|36): objs=154 size=247B /31/27N (2|25|36): objs=3426 size=14.93KiB /31/28S (2|25|36): objs=155 size=148B /31/29S (2|25|36): objs=140 size=178B /31/30S (2|25|36): objs=169 size=245B /31/31S (2|25|36): objs=164 size=264B /31/32S (2|25|36): objs=130 size=194B /31/33N (2|25|36): objs=1747 size=7.25KiB /31/34S (2|25|36): objs=150 size=227B /31/35N (2|25|36): objs=2560 size=10.76KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 347.71ms Sorting: 213.32ms 1 217 41355 99508 99996 Gradle Test Executor 1 finished executing tests. com.milaboratory.util.VersionInfoTest > test3 SKIPPED Finished generating test XML results (0.076 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.13 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[#50,Task worker for ':',5,main]) completed. Took 4 mins 9.749 secs. BUILD SUCCESSFUL in 4m 40s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath Duplicate specification "version|V" for option "V" jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_arm64.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_arm64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/3669716 and its subdirectories I: Current time: Mon Jan 20 14:17:46 -12 2025 I: pbuilder-time-stamp: 1737425866