I: pbuilder: network access will be disabled during build
I: Current time: Tue Dec 17 03:25:24 -12 2024
I: pbuilder-time-stamp: 1734449124
I: Building the build Environment
I: extracting base tarball [/var/cache/pbuilder/unstable-reproducible-base.tgz]
I: copying local configuration
W: --override-config is not set; not updating apt.conf Read the manpage for details.
I: mounting /proc filesystem
I: mounting /sys filesystem
I: creating /{dev,run}/shm
I: mounting /dev/pts filesystem
I: redirecting /dev/ptmx to /dev/pts/ptmx
I: policy-rc.d already exists
I: Copying source file
I: copying [milib_2.2.0+dfsg-1.dsc]
I: copying [./milib_2.2.0+dfsg.orig.tar.xz]
I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz]
I: Extracting source
gpgv: Signature made Fri Dec 30 14:08:01 2022 
gpgv:                using RSA key 33CB284313E90BD27DCB4523600316A6DC277476
gpgv: Can't check signature: No public key
dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found
dpkg-source: info: extracting milib in milib-2.2.0+dfsg
dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz
dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying build_gradle.patch
dpkg-source: info: applying guava_interface.patch
dpkg-source: info: applying deactivate_test_reading_build_properties.patch
dpkg-source: info: applying flaky_test.patch
I: Not using root during the build.
I: Installing the build-deps
I: user script /srv/workspace/pbuilder/17152/tmp/hooks/D02_print_environment starting
I: set
  BUILDDIR='/build/reproducible-path'
  BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other'
  BUILDUSERNAME='pbuilder1'
  BUILD_ARCH='armhf'
  DEBIAN_FRONTEND='noninteractive'
  DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=3 '
  DISTRIBUTION='unstable'
  HOME='/root'
  HOST_ARCH='armhf'
  IFS=' 	
  '
  INVOCATION_ID='b5b5b7e2b8f44e0ab436dc602c2c7a6d'
  LANG='C'
  LANGUAGE='en_US:en'
  LC_ALL='C'
  MAIL='/var/mail/root'
  OPTIND='1'
  PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games'
  PBCURRENTCOMMANDLINEOPERATION='build'
  PBUILDER_OPERATION='build'
  PBUILDER_PKGDATADIR='/usr/share/pbuilder'
  PBUILDER_PKGLIBDIR='/usr/lib/pbuilder'
  PBUILDER_SYSCONFDIR='/etc'
  PPID='17152'
  PS1='# '
  PS2='> '
  PS4='+ '
  PWD='/'
  SHELL='/bin/bash'
  SHLVL='2'
  SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.mzXgQZPx/pbuilderrc_FJed --distribution unstable --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/unstable-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.mzXgQZPx/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc'
  SUDO_GID='110'
  SUDO_UID='103'
  SUDO_USER='jenkins'
  TERM='unknown'
  TZ='/usr/share/zoneinfo/Etc/GMT+12'
  USER='root'
  _='/usr/bin/systemd-run'
  http_proxy='http://10.0.0.15:3142/'
I: uname -a
  Linux virt64z 6.1.0-28-arm64 #1 SMP Debian 6.1.119-1 (2024-11-22) aarch64 GNU/Linux
I: ls -l /bin
  lrwxrwxrwx 1 root root 7 Nov 22 14:40 /bin -> usr/bin
I: user script /srv/workspace/pbuilder/17152/tmp/hooks/D02_print_environment finished
 -> Attempting to satisfy build-dependencies
 -> Creating pbuilder-satisfydepends-dummy package
Package: pbuilder-satisfydepends-dummy
Version: 0.invalid.0
Architecture: armhf
Maintainer: Debian Pbuilder Team <pbuilder-maint@lists.alioth.debian.org>
Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder
 This package was created automatically by pbuilder to satisfy the
 build-dependencies of the package being currently built.
Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java
dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'.
Selecting previously unselected package pbuilder-satisfydepends-dummy.
(Reading database ... 19680 files and directories currently installed.)
Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ...
Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ...
dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested:
 pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however:
  Package debhelper-compat is not installed.
 pbuilder-satisfydepends-dummy depends on default-jdk; however:
  Package default-jdk is not installed.
 pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however:
  Package gradle-debian-helper is not installed.
 pbuilder-satisfydepends-dummy depends on javahelper; however:
  Package javahelper is not installed.
 pbuilder-satisfydepends-dummy depends on maven-repo-helper; however:
  Package maven-repo-helper is not installed.
 pbuilder-satisfydepends-dummy depends on junit4; however:
  Package junit4 is not installed.
 pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however:
  Package libcommons-compress-java is not installed.
 pbuilder-satisfydepends-dummy depends on libcommons-io-java; however:
  Package libcommons-io-java is not installed.
 pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however:
  Package libcommons-math3-java is not installed.
 pbuilder-satisfydepends-dummy depends on libguava-java; however:
  Package libguava-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however:
  Package libjackson2-annotations-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however:
  Package libjackson2-core-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however:
  Package libjackson2-databind-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjcommander-java; however:
  Package libjcommander-java is not installed.
 pbuilder-satisfydepends-dummy depends on liblz4-java; however:
  Package liblz4-java is not installed.
 pbuilder-satisfydepends-dummy depends on libmockito-java; however:
  Package libmockito-java is not installed.
 pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however:
  Package libredberry-pipe-java is not installed.
 pbuilder-satisfydepends-dummy depends on libtrove3-java; however:
  Package libtrove3-java is not installed.

Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ...
Reading package lists...
Building dependency tree...
Reading state information...
Initializing package states...
Writing extended state information...
Building tag database...
pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0)
pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0)
The following NEW packages will be installed:
  adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dbus{a} dbus-bin{a} dbus-daemon{a} dbus-session-bus-common{a} dbus-system-bus-common{a} dbus-user-session{a} dconf-gsettings-backend{a} dconf-service{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gpg{a} gpg-agent{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libapparmor1{a} libarchive-zip-perl{a} libasm-java{a} libasound2-data{a} libasound2t64{a} libassuan9{a} libatinject-jsr330-api-java{a} libatk-bridge2.0-0t64{a} libatk1.0-0t64{a} libatspi2.0-0t64{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo-gobject2{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcloudproviders0{a} libcolord2{a} libcom-err2{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2t64{a} libdatrie1{a} libdbus-1-3{a} libdconf1{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1t64{a} libencode-locale-perl{a} libepoxy0{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgbm1{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0t64{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgssapi-krb5-2{a} libgtk-3-0t64{a} libgtk-3-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjunixsocket-java{a} libjunixsocket-jni{a} libjzlib-java{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} liblightcouch-java{a} libllvm19{a} liblog4j2-java{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1t64{a} libmaven-parent-java{a} libmaven-resolver-1.6-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmongodb-java{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0t64{a} libnsl2{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpam-systemd{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16t64{a} libpolyglot-maven-java{a} libproc2-0{a} libpython3-stdlib{a} libpython3.12-minimal{a} libpython3.12-stdlib{a} libqdox-java{a} libreadline8t64{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-quote-perl{a} libsystemd-shared{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtirpc-common{a} libtirpc3t64{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwayland-client0{a} libwayland-cursor0{a} libwayland-egl1{a} libwayland-server0{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxkbcommon0{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} mesa-libgallium{a} netbase{a} openjdk-21-jdk{a} openjdk-21-jdk-headless{a} openjdk-21-jre{a} openjdk-21-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} procps{a} python3{a} python3-minimal{a} python3.12{a} python3.12-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} systemd{a} systemd-sysv{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} xkb-data{a} 
The following packages are RECOMMENDED but will NOT be installed:
  alsa-topology-conf alsa-ucm-conf at-spi2-core chrony curl debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra gnupg-utils gpg-wks-client javascript-common krb5-locales libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgtk-3-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libkmod2 libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libnss-systemd libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian linux-sysctl-defaults lynx mesa-vulkan-drivers ntpsec openntpd pristine-tar psmisc python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace systemd-cryptsetup systemd-timesyncd wget xdg-user-dirs 
0 packages upgraded, 380 newly installed, 0 to remove and 0 not upgraded.
Need to get 317 MB of archives. After unpacking 802 MB will be used.
Writing extended state information...
Get: 1 http://deb.debian.org/debian unstable/main armhf libapparmor1 armhf 3.1.7-1+b3 [38.0 kB]
Get: 2 http://deb.debian.org/debian unstable/main armhf libsystemd-shared armhf 257-2 [1957 kB]
Get: 3 http://deb.debian.org/debian unstable/main armhf systemd armhf 257-2 [3498 kB]
Get: 4 http://deb.debian.org/debian unstable/main armhf systemd-sysv armhf 257-2 [59.5 kB]
Get: 5 http://deb.debian.org/debian unstable/main armhf libdbus-1-3 armhf 1.16.0-1 [154 kB]
Get: 6 http://deb.debian.org/debian unstable/main armhf dbus-bin armhf 1.16.0-1 [77.2 kB]
Get: 7 http://deb.debian.org/debian unstable/main armhf dbus-session-bus-common all 1.16.0-1 [51.1 kB]
Get: 8 http://deb.debian.org/debian unstable/main armhf libexpat1 armhf 2.6.4-1 [83.5 kB]
Get: 9 http://deb.debian.org/debian unstable/main armhf dbus-daemon armhf 1.16.0-1 [144 kB]
Get: 10 http://deb.debian.org/debian unstable/main armhf dbus-system-bus-common all 1.16.0-1 [52.2 kB]
Get: 11 http://deb.debian.org/debian unstable/main armhf dbus armhf 1.16.0-1 [67.9 kB]
Get: 12 http://deb.debian.org/debian unstable/main armhf libpipeline1 armhf 1.5.8-1 [35.0 kB]
Get: 13 http://deb.debian.org/debian unstable/main armhf binfmt-support armhf 2.2.2-7 [55.3 kB]
Get: 14 http://deb.debian.org/debian unstable/main armhf libpython3.12-minimal armhf 3.12.8-3 [802 kB]
Get: 15 http://deb.debian.org/debian unstable/main armhf python3.12-minimal armhf 3.12.8-3 [1794 kB]
Get: 16 http://deb.debian.org/debian unstable/main armhf python3-minimal armhf 3.12.7-1 [26.8 kB]
Get: 17 http://deb.debian.org/debian unstable/main armhf media-types all 10.1.0 [26.9 kB]
Get: 18 http://deb.debian.org/debian unstable/main armhf netbase all 6.4 [12.8 kB]
Get: 19 http://deb.debian.org/debian unstable/main armhf tzdata all 2024b-4 [256 kB]
Get: 20 http://deb.debian.org/debian unstable/main armhf libkrb5support0 armhf 1.21.3-3 [30.0 kB]
Get: 21 http://deb.debian.org/debian unstable/main armhf libcom-err2 armhf 1.47.2~rc1-2 [22.9 kB]
Get: 22 http://deb.debian.org/debian unstable/main armhf libk5crypto3 armhf 1.21.3-3 [75.8 kB]
Get: 23 http://deb.debian.org/debian unstable/main armhf libkeyutils1 armhf 1.6.3-4 [8096 B]
Get: 24 http://deb.debian.org/debian unstable/main armhf libkrb5-3 armhf 1.21.3-3 [283 kB]
Get: 25 http://deb.debian.org/debian unstable/main armhf libgssapi-krb5-2 armhf 1.21.3-3 [114 kB]
Get: 26 http://deb.debian.org/debian unstable/main armhf libtirpc-common all 1.3.4+ds-1.3 [10.9 kB]
Get: 27 http://deb.debian.org/debian unstable/main armhf libtirpc3t64 armhf 1.3.4+ds-1.3+b1 [71.3 kB]
Get: 28 http://deb.debian.org/debian unstable/main armhf libnsl2 armhf 1.3.0-3+b3 [35.0 kB]
Get: 29 http://deb.debian.org/debian unstable/main armhf readline-common all 8.2-6 [69.4 kB]
Get: 30 http://deb.debian.org/debian unstable/main armhf libreadline8t64 armhf 8.2-6 [146 kB]
Get: 31 http://deb.debian.org/debian unstable/main armhf libpython3.12-stdlib armhf 3.12.8-3 [1824 kB]
Get: 32 http://deb.debian.org/debian unstable/main armhf python3.12 armhf 3.12.8-3 [677 kB]
Get: 33 http://deb.debian.org/debian unstable/main armhf libpython3-stdlib armhf 3.12.7-1 [9712 B]
Get: 34 http://deb.debian.org/debian unstable/main armhf python3 armhf 3.12.7-1 [27.8 kB]
Get: 35 http://deb.debian.org/debian unstable/main armhf libproc2-0 armhf 2:4.0.4-6 [56.0 kB]
Get: 36 http://deb.debian.org/debian unstable/main armhf procps armhf 2:4.0.4-6 [864 kB]
Get: 37 http://deb.debian.org/debian unstable/main armhf sensible-utils all 0.0.24 [24.8 kB]
Get: 38 http://deb.debian.org/debian unstable/main armhf openssl armhf 3.3.2-2 [1348 kB]
Get: 39 http://deb.debian.org/debian unstable/main armhf ca-certificates all 20240203 [158 kB]
Get: 40 http://deb.debian.org/debian unstable/main armhf libmagic-mgc armhf 1:5.45-3+b1 [314 kB]
Get: 41 http://deb.debian.org/debian unstable/main armhf libmagic1t64 armhf 1:5.45-3+b1 [98.5 kB]
Get: 42 http://deb.debian.org/debian unstable/main armhf file armhf 1:5.45-3+b1 [42.3 kB]
Get: 43 http://deb.debian.org/debian unstable/main armhf gettext-base armhf 0.22.5-3 [195 kB]
Get: 44 http://deb.debian.org/debian unstable/main armhf libuchardet0 armhf 0.0.8-1+b2 [65.6 kB]
Get: 45 http://deb.debian.org/debian unstable/main armhf groff-base armhf 1.23.0-6 [1091 kB]
Get: 46 http://deb.debian.org/debian unstable/main armhf libpam-systemd armhf 257-2 [266 kB]
Get: 47 http://deb.debian.org/debian unstable/main armhf bsdextrautils armhf 2.40.2-12 [83.9 kB]
Get: 48 http://deb.debian.org/debian unstable/main armhf man-db armhf 2.13.0-1 [1382 kB]
Get: 49 http://deb.debian.org/debian unstable/main armhf libgdk-pixbuf2.0-common all 2.42.12+dfsg-1 [311 kB]
Get: 50 http://deb.debian.org/debian unstable/main armhf libglib2.0-0t64 armhf 2.82.4-1 [1327 kB]
Get: 51 http://deb.debian.org/debian unstable/main armhf libicu72 armhf 72.1-5+b1 [9088 kB]
Get: 52 http://deb.debian.org/debian unstable/main armhf libxml2 armhf 2.12.7+dfsg+really2.9.14-0.2+b1 [605 kB]
Get: 53 http://deb.debian.org/debian unstable/main armhf shared-mime-info armhf 2.4-5+b1 [753 kB]
Get: 54 http://deb.debian.org/debian unstable/main armhf libjpeg62-turbo armhf 1:2.1.5-3+b1 [145 kB]
Get: 55 http://deb.debian.org/debian unstable/main armhf libpng16-16t64 armhf 1.6.44-3 [263 kB]
Get: 56 http://deb.debian.org/debian unstable/main armhf libdeflate0 armhf 1.22-1 [36.3 kB]
Get: 57 http://deb.debian.org/debian unstable/main armhf libjbig0 armhf 2.1-6.1+b2 [27.3 kB]
Get: 58 http://deb.debian.org/debian unstable/main armhf liblerc4 armhf 4.0.0+ds-5 [146 kB]
Get: 59 http://deb.debian.org/debian unstable/main armhf libsharpyuv0 armhf 1.4.0-0.1+b1 [111 kB]
Get: 60 http://deb.debian.org/debian unstable/main armhf libwebp7 armhf 1.4.0-0.1+b1 [266 kB]
Get: 61 http://deb.debian.org/debian unstable/main armhf libtiff6 armhf 4.5.1+git230720-5 [302 kB]
Get: 62 http://deb.debian.org/debian unstable/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.12+dfsg-1+b1 [124 kB]
Get: 63 http://deb.debian.org/debian unstable/main armhf gtk-update-icon-cache armhf 4.16.7+ds-1 [49.1 kB]
Get: 64 http://deb.debian.org/debian unstable/main armhf hicolor-icon-theme all 0.18-1 [12.0 kB]
Get: 65 http://deb.debian.org/debian unstable/main armhf adwaita-icon-theme all 47.0-2 [463 kB]
Get: 66 http://deb.debian.org/debian unstable/main armhf ca-certificates-java all 20240118 [11.6 kB]
Get: 67 http://deb.debian.org/debian unstable/main armhf java-common all 0.76 [6776 B]
Get: 68 http://deb.debian.org/debian unstable/main armhf liblcms2-2 armhf 2.16-2 [131 kB]
Get: 69 http://deb.debian.org/debian unstable/main armhf libnspr4 armhf 2:4.36-1 [87.8 kB]
Get: 70 http://deb.debian.org/debian unstable/main armhf libnss3 armhf 2:3.106-1 [1204 kB]
Get: 71 http://deb.debian.org/debian unstable/main armhf libpcsclite1 armhf 2.3.0-3 [51.7 kB]
Get: 72 http://deb.debian.org/debian unstable/main armhf openjdk-21-jre-headless armhf 21.0.5+11-1 [35.6 MB]
Get: 73 http://deb.debian.org/debian unstable/main armhf default-jre-headless armhf 2:1.21-76 [3192 B]
Get: 74 http://deb.debian.org/debian unstable/main armhf ant all 1.10.15-1 [2163 kB]
Get: 75 http://deb.debian.org/debian unstable/main armhf ant-optional all 1.10.15-1 [456 kB]
Get: 76 http://deb.debian.org/debian unstable/main armhf libantlr-java all 2.7.7+dfsg-14 [458 kB]
Get: 77 http://deb.debian.org/debian unstable/main armhf antlr all 2.7.7+dfsg-14 [8376 B]
Get: 78 http://deb.debian.org/debian unstable/main armhf at-spi2-common all 2.54.0-1 [170 kB]
Get: 79 http://deb.debian.org/debian unstable/main armhf m4 armhf 1.4.19-4 [264 kB]
Get: 80 http://deb.debian.org/debian unstable/main armhf autoconf all 2.72-3 [493 kB]
Get: 81 http://deb.debian.org/debian unstable/main armhf autotools-dev all 20220109.1 [51.6 kB]
Get: 82 http://deb.debian.org/debian unstable/main armhf automake all 1:1.16.5-1.3 [823 kB]
Get: 83 http://deb.debian.org/debian unstable/main armhf autopoint all 0.22.5-3 [723 kB]
Get: 84 http://deb.debian.org/debian unstable/main armhf unzip armhf 6.0-28 [152 kB]
Get: 85 http://deb.debian.org/debian unstable/main armhf java-wrappers all 0.5 [8848 B]
Get: 86 http://deb.debian.org/debian unstable/main armhf libhamcrest-java all 2.2-2 [121 kB]
Get: 87 http://deb.debian.org/debian unstable/main armhf junit4 all 4.13.2-5 [350 kB]
Get: 88 http://deb.debian.org/debian unstable/main armhf libfelix-framework-java all 4.6.1-2.1 [569 kB]
Get: 89 http://deb.debian.org/debian unstable/main armhf libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB]
Get: 90 http://deb.debian.org/debian unstable/main armhf libosgi-annotation-java all 8.1.0-1 [9436 B]
Get: 91 http://deb.debian.org/debian unstable/main armhf libosgi-core-java all 8.0.0-2 [182 kB]
Get: 92 http://deb.debian.org/debian unstable/main armhf libfelix-resolver-java all 1.16.0-1 [180 kB]
Get: 93 http://deb.debian.org/debian unstable/main armhf libhawtjni-runtime-java all 1.18-1 [36.3 kB]
Get: 94 http://deb.debian.org/debian unstable/main armhf libjansi-native-java all 1.8-2 [26.0 kB]
Get: 95 http://deb.debian.org/debian unstable/main armhf libjansi1-java all 1.18-3 [66.5 kB]
Get: 96 http://deb.debian.org/debian unstable/main armhf libjline2-java all 2.14.6-5 [151 kB]
Get: 97 http://deb.debian.org/debian unstable/main armhf libosgi-compendium-java all 7.0.0-1 [477 kB]
Get: 98 http://deb.debian.org/debian unstable/main armhf libslf4j-java all 1.7.32-1 [144 kB]
Get: 99 http://deb.debian.org/debian unstable/main armhf libxz-java all 1.9-1 [143 kB]
Get: 100 http://deb.debian.org/debian unstable/main armhf libyaml-snake-java all 1.33-2 [321 kB]
Get: 101 http://deb.debian.org/debian unstable/main armhf bnd all 5.0.1-5 [10.1 MB]
Get: 102 http://deb.debian.org/debian unstable/main armhf dbus-user-session armhf 1.16.0-1 [51.0 kB]
Get: 103 http://deb.debian.org/debian unstable/main armhf libdconf1 armhf 0.40.0-4+b3 [37.0 kB]
Get: 104 http://deb.debian.org/debian unstable/main armhf dconf-service armhf 0.40.0-4+b3 [27.7 kB]
Get: 105 http://deb.debian.org/debian unstable/main armhf dconf-gsettings-backend armhf 0.40.0-4+b3 [24.1 kB]
Get: 106 http://deb.debian.org/debian unstable/main armhf dctrl-tools armhf 2.24-3 [96.0 kB]
Get: 107 http://deb.debian.org/debian unstable/main armhf libdebhelper-perl all 13.21 [88.9 kB]
Get: 108 http://deb.debian.org/debian unstable/main armhf libtool all 2.4.7-8 [517 kB]
Get: 109 http://deb.debian.org/debian unstable/main armhf dh-autoreconf all 20 [17.1 kB]
Get: 110 http://deb.debian.org/debian unstable/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get: 111 http://deb.debian.org/debian unstable/main armhf libfile-stripnondeterminism-perl all 1.14.0-1 [19.5 kB]
Get: 112 http://deb.debian.org/debian unstable/main armhf dh-strip-nondeterminism all 1.14.0-1 [8448 B]
Get: 113 http://deb.debian.org/debian unstable/main armhf libelf1t64 armhf 0.192-4 [184 kB]
Get: 114 http://deb.debian.org/debian unstable/main armhf dwz armhf 0.15-1+b2 [106 kB]
Get: 115 http://deb.debian.org/debian unstable/main armhf gettext armhf 0.22.5-3 [1488 kB]
Get: 116 http://deb.debian.org/debian unstable/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB]
Get: 117 http://deb.debian.org/debian unstable/main armhf po-debconf all 1.0.21+nmu1 [248 kB]
Get: 118 http://deb.debian.org/debian unstable/main armhf debhelper all 13.21 [919 kB]
Get: 119 http://deb.debian.org/debian unstable/main armhf libatk1.0-0t64 armhf 2.54.0-1 [44.4 kB]
Get: 120 http://deb.debian.org/debian unstable/main armhf libxau6 armhf 1:1.0.11-1 [19.7 kB]
Get: 121 http://deb.debian.org/debian unstable/main armhf libxdmcp6 armhf 1:1.1.5-1 [26.4 kB]
Get: 122 http://deb.debian.org/debian unstable/main armhf libxcb1 armhf 1.17.0-2+b1 [140 kB]
Get: 123 http://deb.debian.org/debian unstable/main armhf libx11-data all 2:1.8.10-2 [337 kB]
Get: 124 http://deb.debian.org/debian unstable/main armhf libx11-6 armhf 2:1.8.10-2 [750 kB]
Get: 125 http://deb.debian.org/debian unstable/main armhf libxext6 armhf 2:1.3.4-1+b2 [45.2 kB]
Get: 126 http://deb.debian.org/debian unstable/main armhf libxi6 armhf 2:1.8.2-1 [73.6 kB]
Get: 127 http://deb.debian.org/debian unstable/main armhf libatspi2.0-0t64 armhf 2.54.0-1 [66.0 kB]
Get: 128 http://deb.debian.org/debian unstable/main armhf libatk-bridge2.0-0t64 armhf 2.54.0-1 [59.9 kB]
Get: 129 http://deb.debian.org/debian unstable/main armhf libbrotli1 armhf 1.1.0-2+b6 [282 kB]
Get: 130 http://deb.debian.org/debian unstable/main armhf libfreetype6 armhf 2.13.3+dfsg-1 [385 kB]
Get: 131 http://deb.debian.org/debian unstable/main armhf fonts-dejavu-mono all 2.37-8 [489 kB]
Get: 132 http://deb.debian.org/debian unstable/main armhf fonts-dejavu-core all 2.37-8 [840 kB]
Get: 133 http://deb.debian.org/debian unstable/main armhf fontconfig-config armhf 2.15.0-1.1+b1 [318 kB]
Get: 134 http://deb.debian.org/debian unstable/main armhf libfontconfig1 armhf 2.15.0-1.1+b1 [371 kB]
Get: 135 http://deb.debian.org/debian unstable/main armhf libpixman-1-0 armhf 0.44.0-3 [164 kB]
Get: 136 http://deb.debian.org/debian unstable/main armhf libxcb-render0 armhf 1.17.0-2+b1 [114 kB]
Get: 137 http://deb.debian.org/debian unstable/main armhf libxcb-shm0 armhf 1.17.0-2+b1 [105 kB]
Get: 138 http://deb.debian.org/debian unstable/main armhf libxrender1 armhf 1:0.9.10-1.1+b3 [25.0 kB]
Get: 139 http://deb.debian.org/debian unstable/main armhf libcairo2 armhf 1.18.2-2 [443 kB]
Get: 140 http://deb.debian.org/debian unstable/main armhf libcairo-gobject2 armhf 1.18.2-2 [129 kB]
Get: 141 http://deb.debian.org/debian unstable/main armhf libcloudproviders0 armhf 0.3.6-1+b1 [24.7 kB]
Get: 142 http://deb.debian.org/debian unstable/main armhf libcolord2 armhf 1.4.7-1+b2 [121 kB]
Get: 143 http://deb.debian.org/debian unstable/main armhf libavahi-common-data armhf 0.8-15 [112 kB]
Get: 144 http://deb.debian.org/debian unstable/main armhf libavahi-common3 armhf 0.8-15 [41.0 kB]
Get: 145 http://deb.debian.org/debian unstable/main armhf libavahi-client3 armhf 0.8-15 [44.4 kB]
Get: 146 http://deb.debian.org/debian unstable/main armhf libcups2t64 armhf 2.4.10-2 [216 kB]
Get: 147 http://deb.debian.org/debian unstable/main armhf libepoxy0 armhf 1.5.10-2 [165 kB]
Get: 148 http://deb.debian.org/debian unstable/main armhf libfribidi0 armhf 1.0.16-1 [24.6 kB]
Get: 149 http://deb.debian.org/debian unstable/main armhf libgraphite2-3 armhf 1.3.14-2+b1 [63.1 kB]
Get: 150 http://deb.debian.org/debian unstable/main armhf libharfbuzz0b armhf 10.1.0-1 [418 kB]
Get: 151 http://deb.debian.org/debian unstable/main armhf fontconfig armhf 2.15.0-1.1+b1 [461 kB]
Get: 152 http://deb.debian.org/debian unstable/main armhf libthai-data all 0.1.29-2 [168 kB]
Get: 153 http://deb.debian.org/debian unstable/main armhf libdatrie1 armhf 0.2.13-3+b1 [34.7 kB]
Get: 154 http://deb.debian.org/debian unstable/main armhf libthai0 armhf 0.1.29-2+b1 [46.0 kB]
Get: 155 http://deb.debian.org/debian unstable/main armhf libpango-1.0-0 armhf 1.55.0+ds-3 [200 kB]
Get: 156 http://deb.debian.org/debian unstable/main armhf libpangoft2-1.0-0 armhf 1.55.0+ds-3 [47.7 kB]
Get: 157 http://deb.debian.org/debian unstable/main armhf libpangocairo-1.0-0 armhf 1.55.0+ds-3 [31.3 kB]
Get: 158 http://deb.debian.org/debian unstable/main armhf libwayland-client0 armhf 1.23.0-1+b1 [21.2 kB]
Get: 159 http://deb.debian.org/debian unstable/main armhf libwayland-cursor0 armhf 1.23.0-1+b1 [10.5 kB]
Get: 160 http://deb.debian.org/debian unstable/main armhf libwayland-egl1 armhf 1.23.0-1+b1 [5452 B]
Get: 161 http://deb.debian.org/debian unstable/main armhf libxcomposite1 armhf 1:0.4.6-1 [15.8 kB]
Get: 162 http://deb.debian.org/debian unstable/main armhf libxfixes3 armhf 1:6.0.0-2+b3 [18.6 kB]
Get: 163 http://deb.debian.org/debian unstable/main armhf libxcursor1 armhf 1:1.2.2-1+b1 [34.1 kB]
Get: 164 http://deb.debian.org/debian unstable/main armhf libxdamage1 armhf 1:1.1.6-1+b2 [14.8 kB]
Get: 165 http://deb.debian.org/debian unstable/main armhf libxinerama1 armhf 2:1.1.4-3+b3 [15.7 kB]
Get: 166 http://deb.debian.org/debian unstable/main armhf xkb-data all 2.42-1 [790 kB]
Get: 167 http://deb.debian.org/debian unstable/main armhf libxkbcommon0 armhf 1.7.0-2 [99.7 kB]
Get: 168 http://deb.debian.org/debian unstable/main armhf libxrandr2 armhf 2:1.5.4-1+b2 [33.2 kB]
Get: 169 http://deb.debian.org/debian unstable/main armhf libgtk-3-common all 3.24.43-4 [4657 kB]
Get: 170 http://deb.debian.org/debian unstable/main armhf libgtk-3-0t64 armhf 3.24.43-4 [2368 kB]
Get: 171 http://deb.debian.org/debian unstable/main armhf libglvnd0 armhf 1.7.0-1+b2 [51.8 kB]
Get: 172 http://deb.debian.org/debian unstable/main armhf libdrm-common all 2.4.123-1 [8084 B]
Get: 173 http://deb.debian.org/debian unstable/main armhf libdrm2 armhf 2.4.123-1 [34.1 kB]
Get: 174 http://deb.debian.org/debian unstable/main armhf libglapi-mesa armhf 24.2.8-1 [44.6 kB]
Get: 175 http://deb.debian.org/debian unstable/main armhf libx11-xcb1 armhf 2:1.8.10-2 [241 kB]
Get: 176 http://deb.debian.org/debian unstable/main armhf libxcb-dri2-0 armhf 1.17.0-2+b1 [106 kB]
Get: 177 http://deb.debian.org/debian unstable/main armhf libxcb-dri3-0 armhf 1.17.0-2+b1 [107 kB]
Get: 178 http://deb.debian.org/debian unstable/main armhf libxcb-glx0 armhf 1.17.0-2+b1 [120 kB]
Get: 179 http://deb.debian.org/debian unstable/main armhf libxcb-present0 armhf 1.17.0-2+b1 [105 kB]
Get: 180 http://deb.debian.org/debian unstable/main armhf libxcb-randr0 armhf 1.17.0-2+b1 [116 kB]
Get: 181 http://deb.debian.org/debian unstable/main armhf libxcb-sync1 armhf 1.17.0-2+b1 [108 kB]
Get: 182 http://deb.debian.org/debian unstable/main armhf libxcb-xfixes0 armhf 1.17.0-2+b1 [109 kB]
Get: 183 http://deb.debian.org/debian unstable/main armhf libxshmfence1 armhf 1.3-1+b2 [8628 B]
Get: 184 http://deb.debian.org/debian unstable/main armhf libxxf86vm1 armhf 1:1.1.4-1+b3 [18.1 kB]
Get: 185 http://deb.debian.org/debian unstable/main armhf libdrm-amdgpu1 armhf 2.4.123-1 [20.4 kB]
Get: 186 http://deb.debian.org/debian unstable/main armhf libdrm-radeon1 armhf 2.4.123-1 [19.6 kB]
Get: 187 http://deb.debian.org/debian unstable/main armhf libedit2 armhf 3.1-20240808-1 [77.9 kB]
Get: 188 http://deb.debian.org/debian unstable/main armhf libz3-4 armhf 4.13.3-1 [7252 kB]
Get: 189 http://deb.debian.org/debian unstable/main armhf libllvm19 armhf 1:19.1.5-1 [23.8 MB]
Get: 190 http://deb.debian.org/debian unstable/main armhf libsensors-config all 1:3.6.0-10 [14.6 kB]
Get: 191 http://deb.debian.org/debian unstable/main armhf libsensors5 armhf 1:3.6.0-10+b1 [32.3 kB]
Get: 192 http://deb.debian.org/debian unstable/main armhf mesa-libgallium armhf 24.2.8-1 [7097 kB]
Get: 193 http://deb.debian.org/debian unstable/main armhf libvulkan1 armhf 1.3.296.0-1 [103 kB]
Get: 194 http://deb.debian.org/debian unstable/main armhf libwayland-server0 armhf 1.23.0-1+b1 [27.9 kB]
Get: 195 http://deb.debian.org/debian unstable/main armhf libgbm1 armhf 24.2.8-1 [39.0 kB]
Get: 196 http://deb.debian.org/debian unstable/main armhf libgl1-mesa-dri armhf 24.2.8-1 [41.0 kB]
Get: 197 http://deb.debian.org/debian unstable/main armhf libglx-mesa0 armhf 24.2.8-1 [132 kB]
Get: 198 http://deb.debian.org/debian unstable/main armhf libglx0 armhf 1.7.0-1+b2 [32.6 kB]
Get: 199 http://deb.debian.org/debian unstable/main armhf libgl1 armhf 1.7.0-1+b2 [88.2 kB]
Get: 200 http://deb.debian.org/debian unstable/main armhf libasound2-data all 1.2.12-1 [21.0 kB]
Get: 201 http://deb.debian.org/debian unstable/main armhf libasound2t64 armhf 1.2.12-1+b1 [317 kB]
Get: 202 http://deb.debian.org/debian unstable/main armhf libgif7 armhf 5.2.2-1+b1 [41.4 kB]
Get: 203 http://deb.debian.org/debian unstable/main armhf x11-common all 1:7.7+23.1 [216 kB]
Get: 204 http://deb.debian.org/debian unstable/main armhf libxtst6 armhf 2:1.2.3-1.1+b3 [24.3 kB]
Get: 205 http://deb.debian.org/debian unstable/main armhf openjdk-21-jre armhf 21.0.5+11-1 [180 kB]
Get: 206 http://deb.debian.org/debian unstable/main armhf default-jre armhf 2:1.21-76 [1068 B]
Get: 207 http://deb.debian.org/debian unstable/main armhf openjdk-21-jdk-headless armhf 21.0.5+11-1 [78.3 MB]
Get: 208 http://deb.debian.org/debian unstable/main armhf default-jdk-headless armhf 2:1.21-76 [1124 B]
Get: 209 http://deb.debian.org/debian unstable/main armhf openjdk-21-jdk armhf 21.0.5+11-1 [3422 kB]
Get: 210 http://deb.debian.org/debian unstable/main armhf default-jdk armhf 2:1.21-76 [1076 B]
Get: 211 http://deb.debian.org/debian unstable/main armhf libassuan9 armhf 3.0.1-2 [53.7 kB]
Get: 212 http://deb.debian.org/debian unstable/main armhf gpgconf armhf 2.2.45-2 [104 kB]
Get: 213 http://deb.debian.org/debian unstable/main armhf libksba8 armhf 1.6.7-2+b1 [115 kB]
Get: 214 http://deb.debian.org/debian unstable/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-8 [18.2 kB]
Get: 215 http://deb.debian.org/debian unstable/main armhf libsasl2-2 armhf 2.1.28+dfsg1-8 [50.2 kB]
Get: 216 http://deb.debian.org/debian unstable/main armhf libldap-2.5-0 armhf 2.5.18+dfsg-3+b1 [163 kB]
Get: 217 http://deb.debian.org/debian unstable/main armhf libnpth0t64 armhf 1.8-2 [21.8 kB]
Get: 218 http://deb.debian.org/debian unstable/main armhf dirmngr armhf 2.2.45-2 [322 kB]
Get: 219 http://deb.debian.org/debian unstable/main armhf gnupg-l10n all 2.2.45-2 [705 kB]
Get: 220 http://deb.debian.org/debian unstable/main armhf gpg armhf 2.2.45-2 [463 kB]
Get: 221 http://deb.debian.org/debian unstable/main armhf pinentry-curses armhf 1.2.1-4+b1 [76.1 kB]
Get: 222 http://deb.debian.org/debian unstable/main armhf gpg-agent armhf 2.2.45-2 [210 kB]
Get: 223 http://deb.debian.org/debian unstable/main armhf gpgsm armhf 2.2.45-2 [218 kB]
Get: 224 http://deb.debian.org/debian unstable/main armhf gnupg all 2.2.45-2 [376 kB]
Get: 225 http://deb.debian.org/debian unstable/main armhf libfile-dirlist-perl all 0.05-3 [7600 B]
Get: 226 http://deb.debian.org/debian unstable/main armhf libfile-which-perl all 1.27-2 [15.1 kB]
Get: 227 http://deb.debian.org/debian unstable/main armhf libfile-homedir-perl all 1.006-2 [42.4 kB]
Get: 228 http://deb.debian.org/debian unstable/main armhf libfile-touch-perl all 0.12-2 [8816 B]
Get: 229 http://deb.debian.org/debian unstable/main armhf libio-pty-perl armhf 1:1.20-1+b2 [33.8 kB]
Get: 230 http://deb.debian.org/debian unstable/main armhf libipc-run-perl all 20231003.0-2 [101 kB]
Get: 231 http://deb.debian.org/debian unstable/main armhf libclass-method-modifiers-perl all 2.15-1 [18.0 kB]
Get: 232 http://deb.debian.org/debian unstable/main armhf libclass-xsaccessor-perl armhf 1.19-4+b4 [35.1 kB]
Get: 233 http://deb.debian.org/debian unstable/main armhf libb-hooks-op-check-perl armhf 0.22-3+b2 [10.3 kB]
Get: 234 http://deb.debian.org/debian unstable/main armhf libdynaloader-functions-perl all 0.004-1 [12.1 kB]
Get: 235 http://deb.debian.org/debian unstable/main armhf libdevel-callchecker-perl armhf 0.009-1+b1 [16.0 kB]
Get: 236 http://deb.debian.org/debian unstable/main armhf libparams-classify-perl armhf 0.015-2+b4 [21.2 kB]
Get: 237 http://deb.debian.org/debian unstable/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB]
Get: 238 http://deb.debian.org/debian unstable/main armhf libimport-into-perl all 1.002005-2 [11.3 kB]
Get: 239 http://deb.debian.org/debian unstable/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB]
Get: 240 http://deb.debian.org/debian unstable/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB]
Get: 241 http://deb.debian.org/debian unstable/main armhf libmoo-perl all 2.005005-1 [58.0 kB]
Get: 242 http://deb.debian.org/debian unstable/main armhf libencode-locale-perl all 1.05-3 [12.9 kB]
Get: 243 http://deb.debian.org/debian unstable/main armhf libtimedate-perl all 2.3300-2 [39.3 kB]
Get: 244 http://deb.debian.org/debian unstable/main armhf libhttp-date-perl all 6.06-1 [10.7 kB]
Get: 245 http://deb.debian.org/debian unstable/main armhf libfile-listing-perl all 6.16-1 [12.4 kB]
Get: 246 http://deb.debian.org/debian unstable/main armhf libhtml-tagset-perl all 3.24-1 [14.7 kB]
Get: 247 http://deb.debian.org/debian unstable/main armhf liburi-perl all 5.30-1 [105 kB]
Get: 248 http://deb.debian.org/debian unstable/main armhf libhtml-parser-perl armhf 3.83-1+b1 [96.4 kB]
Get: 249 http://deb.debian.org/debian unstable/main armhf libhtml-tree-perl all 5.07-3 [211 kB]
Get: 250 http://deb.debian.org/debian unstable/main armhf libclone-perl armhf 0.47-1+b1 [13.3 kB]
Get: 251 http://deb.debian.org/debian unstable/main armhf libio-html-perl all 1.004-3 [16.2 kB]
Get: 252 http://deb.debian.org/debian unstable/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB]
Get: 253 http://deb.debian.org/debian unstable/main armhf libhttp-message-perl all 7.00-2 [79.8 kB]
Get: 254 http://deb.debian.org/debian unstable/main armhf libhttp-cookies-perl all 6.11-1 [19.1 kB]
Get: 255 http://deb.debian.org/debian unstable/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB]
Get: 256 http://deb.debian.org/debian unstable/main armhf perl-openssl-defaults armhf 7+b2 [6708 B]
Get: 257 http://deb.debian.org/debian unstable/main armhf libnet-ssleay-perl armhf 1.94-2 [319 kB]
Get: 258 http://deb.debian.org/debian unstable/main armhf libio-socket-ssl-perl all 2.089-1 [223 kB]
Get: 259 http://deb.debian.org/debian unstable/main armhf libnet-http-perl all 6.23-1 [23.9 kB]
Get: 260 http://deb.debian.org/debian unstable/main armhf liblwp-protocol-https-perl all 6.14-1 [10.8 kB]
Get: 261 http://deb.debian.org/debian unstable/main armhf libtry-tiny-perl all 0.32-1 [22.9 kB]
Get: 262 http://deb.debian.org/debian unstable/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB]
Get: 263 http://deb.debian.org/debian unstable/main armhf libwww-perl all 6.77-1 [183 kB]
Get: 264 http://deb.debian.org/debian unstable/main armhf patchutils armhf 0.4.2-1 [72.5 kB]
Get: 265 http://deb.debian.org/debian unstable/main armhf wdiff armhf 1.2.2-6 [118 kB]
Get: 266 http://deb.debian.org/debian unstable/main armhf devscripts all 2.24.7 [1081 kB]
Get: 267 http://deb.debian.org/debian unstable/main armhf fastjar armhf 2:0.98-7 [43.9 kB]
Get: 268 http://deb.debian.org/debian unstable/main armhf ivy all 2.5.2-1 [1295 kB]
Get: 269 http://deb.debian.org/debian unstable/main armhf libasm-java all 9.7.1-1 [391 kB]
Get: 270 http://deb.debian.org/debian unstable/main armhf libbsf-java all 1:2.4.0-8 [76.3 kB]
Get: 271 http://deb.debian.org/debian unstable/main armhf libcommons-cli-java all 1.6.0-1 [60.4 kB]
Get: 272 http://deb.debian.org/debian unstable/main armhf libapache-pom-java all 33-2 [5852 B]
Get: 273 http://deb.debian.org/debian unstable/main armhf libcommons-parent-java all 56-1 [10.8 kB]
Get: 274 http://deb.debian.org/debian unstable/main armhf libcommons-logging-java all 1.3.0-1 [68.6 kB]
Get: 275 http://deb.debian.org/debian unstable/main armhf libjansi-java all 2.4.1-2 [100 kB]
Get: 276 http://deb.debian.org/debian unstable/main armhf libjsp-api-java all 2.3.4-3 [53.7 kB]
Get: 277 http://deb.debian.org/debian unstable/main armhf libqdox-java all 1.12.1-4 [173 kB]
Get: 278 http://deb.debian.org/debian unstable/main armhf libservlet-api-java all 4.0.1-2 [81.0 kB]
Get: 279 http://deb.debian.org/debian unstable/main armhf libxpp3-java all 1.1.4c-3 [292 kB]
Get: 280 http://deb.debian.org/debian unstable/main armhf libxstream-java all 1.4.21-1 [567 kB]
Get: 281 http://deb.debian.org/debian unstable/main armhf groovy all 2.4.21-10 [12.8 MB]
Get: 282 http://deb.debian.org/debian unstable/main armhf libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B]
Get: 283 http://deb.debian.org/debian unstable/main armhf libcommons-collections3-java all 3.2.2-3 [530 kB]
Get: 284 http://deb.debian.org/debian unstable/main armhf libcommons-codec-java all 1.17.1-1 [303 kB]
Get: 285 http://deb.debian.org/debian unstable/main armhf libcommons-io-java all 2.17.0-1 [488 kB]
Get: 286 http://deb.debian.org/debian unstable/main armhf libcommons-compress-java all 1.27.1-2 [641 kB]
Get: 287 http://deb.debian.org/debian unstable/main armhf libcommons-lang-java all 2.6-10 [273 kB]
Get: 288 http://deb.debian.org/debian unstable/main armhf liberror-prone-java all 2.18.0-1 [22.5 kB]
Get: 289 http://deb.debian.org/debian unstable/main armhf libjsr305-java all 0.1~+svn49-11 [26.9 kB]
Get: 290 http://deb.debian.org/debian unstable/main armhf libguava-java all 32.0.1-1 [2708 kB]
Get: 291 http://deb.debian.org/debian unstable/main armhf libhttpcore-java all 4.4.16-1 [636 kB]
Get: 292 http://deb.debian.org/debian unstable/main armhf libhttpclient-java all 4.5.14-1 [1247 kB]
Get: 293 http://deb.debian.org/debian unstable/main armhf libjarjar-java all 1.4+svn142-12 [205 kB]
Get: 294 http://deb.debian.org/debian unstable/main armhf libjcip-annotations-java all 20060626-6 [11.8 kB]
Get: 295 http://deb.debian.org/debian unstable/main armhf libjna-jni armhf 5.15.0-1 [60.7 kB]
Get: 296 http://deb.debian.org/debian unstable/main armhf libjna-java all 5.15.0-1 [238 kB]
Get: 297 http://deb.debian.org/debian unstable/main armhf libbcprov-java all 1.77-1 [5300 kB]
Get: 298 http://deb.debian.org/debian unstable/main armhf libjunixsocket-jni armhf 2.6.1-1 [16.1 kB]
Get: 299 http://deb.debian.org/debian unstable/main armhf libeclipse-jdt-annotation-java all 2.2.700+eclipse4.29-2 [25.5 kB]
Get: 300 http://deb.debian.org/debian unstable/main armhf libjunixsocket-java all 2.6.1-1 [264 kB]
Get: 301 http://deb.debian.org/debian unstable/main armhf libgoogle-gson-java all 2.10.1-1 [262 kB]
Get: 302 http://deb.debian.org/debian unstable/main armhf liblightcouch-java all 0.2.0-1 [75.0 kB]
Get: 303 http://deb.debian.org/debian unstable/main armhf libmongodb-java all 3.6.3-2 [1901 kB]
Get: 304 http://deb.debian.org/debian unstable/main armhf liblog4j2-java all 2.19.0-2 [2310 kB]
Get: 305 http://deb.debian.org/debian unstable/main armhf libjzlib-java all 1.1.3-3 [79.4 kB]
Get: 306 http://deb.debian.org/debian unstable/main armhf libjsch-java all 0.2.19-1 [513 kB]
Get: 307 http://deb.debian.org/debian unstable/main armhf libminlog-java all 1.3.1-1 [7808 B]
Get: 308 http://deb.debian.org/debian unstable/main armhf libobjenesis-java all 3.3-3 [41.3 kB]
Get: 309 http://deb.debian.org/debian unstable/main armhf libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB]
Get: 310 http://deb.debian.org/debian unstable/main armhf libkryo-java all 2.20-7 [158 kB]
Get: 311 http://deb.debian.org/debian unstable/main armhf liblogback-java all 1:1.2.11-6 [701 kB]
Get: 312 http://deb.debian.org/debian unstable/main armhf libnative-platform-jni armhf 0.14-6 [10.2 kB]
Get: 313 http://deb.debian.org/debian unstable/main armhf libnative-platform-java all 0.14-6 [69.8 kB]
Get: 314 http://deb.debian.org/debian unstable/main armhf libxml-commons-external-java all 1.4.01-6 [240 kB]
Get: 315 http://deb.debian.org/debian unstable/main armhf libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB]
Get: 316 http://deb.debian.org/debian unstable/main armhf libxerces2-java all 2.12.2-1 [1440 kB]
Get: 317 http://deb.debian.org/debian unstable/main armhf libnekohtml-java all 1.9.22.noko2-0.1 [125 kB]
Get: 318 http://deb.debian.org/debian unstable/main armhf libxbean-reflect-java all 4.5-9 [132 kB]
Get: 319 http://deb.debian.org/debian unstable/main armhf libgradle-core-java all 4.4.1-20 [4293 kB]
Get: 320 http://deb.debian.org/debian unstable/main armhf libbcpg-java all 1.77-1 [428 kB]
Get: 321 http://deb.debian.org/debian unstable/main armhf libbsh-java all 2.0b4-20 [291 kB]
Get: 322 http://deb.debian.org/debian unstable/main armhf libdd-plist-java all 1.20-1.1 [72.6 kB]
Get: 323 http://deb.debian.org/debian unstable/main armhf libjaxen-java all 1.1.6-5 [214 kB]
Get: 324 http://deb.debian.org/debian unstable/main armhf libdom4j-java all 2.1.4-1 [312 kB]
Get: 325 http://deb.debian.org/debian unstable/main armhf libcommons-lang3-java all 3.17.0-1 [641 kB]
Get: 326 http://deb.debian.org/debian unstable/main armhf libbcel-java all 6.10.0-1 [674 kB]
Get: 327 http://deb.debian.org/debian unstable/main armhf libjformatstring-java all 0.10~20131207-2.1 [34.5 kB]
Get: 328 http://deb.debian.org/debian unstable/main armhf libfindbugs-java all 3.1.0~preview2-4 [3535 kB]
Get: 329 http://deb.debian.org/debian unstable/main armhf libaopalliance-java all 20070526-7 [8572 B]
Get: 330 http://deb.debian.org/debian unstable/main armhf libguice-java all 4.2.3-2 [1435 kB]
Get: 331 http://deb.debian.org/debian unstable/main armhf libjatl-java all 0.2.3-1.1 [29.0 kB]
Get: 332 http://deb.debian.org/debian unstable/main armhf libjcifs-java all 1.3.19-2 [394 kB]
Get: 333 http://deb.debian.org/debian unstable/main armhf libjavaewah-java all 1.2.3-1 [159 kB]
Get: 334 http://deb.debian.org/debian unstable/main armhf libel-api-java all 3.0.0-3 [64.9 kB]
Get: 335 http://deb.debian.org/debian unstable/main armhf libwebsocket-api-java all 1.1-2 [40.1 kB]
Get: 336 http://deb.debian.org/debian unstable/main armhf libjetty9-java all 9.4.56-1 [2964 kB]
Get: 337 http://deb.debian.org/debian unstable/main armhf libjgit-java all 6.7.0-2 [3152 kB]
Get: 338 http://deb.debian.org/debian unstable/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB]
Get: 339 http://deb.debian.org/debian unstable/main armhf libplexus-utils2-java all 3.4.2-1 [258 kB]
Get: 340 http://deb.debian.org/debian unstable/main armhf libwagon-provider-api-java all 3.5.3-1 [48.2 kB]
Get: 341 http://deb.debian.org/debian unstable/main armhf libmaven-resolver-java all 1.6.3-1 [548 kB]
Get: 342 http://deb.debian.org/debian unstable/main armhf libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB]
Get: 343 http://deb.debian.org/debian unstable/main armhf libmaven-parent-java all 43-2 [6252 B]
Get: 344 http://deb.debian.org/debian unstable/main armhf libmaven-resolver-1.6-java all 1.6.3-3 [558 kB]
Get: 345 http://deb.debian.org/debian unstable/main armhf libmaven-shared-utils-java all 3.4.2-1 [137 kB]
Get: 346 http://deb.debian.org/debian unstable/main armhf libplexus-cipher-java all 2.0-1 [14.9 kB]
Get: 347 http://deb.debian.org/debian unstable/main armhf libplexus-classworlds-java all 2.7.0-1 [50.6 kB]
Get: 348 http://deb.debian.org/debian unstable/main armhf libplexus-component-annotations-java all 2.1.1-1 [7660 B]
Get: 349 http://deb.debian.org/debian unstable/main armhf libplexus-interpolation-java all 1.27-1 [76.8 kB]
Get: 350 http://deb.debian.org/debian unstable/main armhf libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB]
Get: 351 http://deb.debian.org/debian unstable/main armhf libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B]
Get: 352 http://deb.debian.org/debian unstable/main armhf libcdi-api-java all 1.2-4 [55.3 kB]
Get: 353 http://deb.debian.org/debian unstable/main armhf libsisu-inject-java all 0.3.4-2 [347 kB]
Get: 354 http://deb.debian.org/debian unstable/main armhf libsisu-plexus-java all 0.3.4-3 [181 kB]
Get: 355 http://deb.debian.org/debian unstable/main armhf libmaven3-core-java all 3.8.8-2 [1579 kB]
Get: 356 http://deb.debian.org/debian unstable/main armhf libplexus-container-default-java all 2.1.1-1 [193 kB]
Get: 357 http://deb.debian.org/debian unstable/main armhf libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB]
Get: 358 http://deb.debian.org/debian unstable/main armhf librhino-java all 1.7.15-1 [1382 kB]
Get: 359 http://deb.debian.org/debian unstable/main armhf libsimple-http-java all 4.1.21-1.1 [211 kB]
Get: 360 http://deb.debian.org/debian unstable/main armhf libwagon-file-java all 3.5.3-1 [8388 B]
Get: 361 http://deb.debian.org/debian unstable/main armhf libjsoup-java all 1.15.3-1 [431 kB]
Get: 362 http://deb.debian.org/debian unstable/main armhf libwagon-http-java all 3.5.3-1 [49.5 kB]
Get: 363 http://deb.debian.org/debian unstable/main armhf libjcommander-java all 1.71-4 [73.0 kB]
Get: 364 http://deb.debian.org/debian unstable/main armhf testng all 6.9.12-4 [795 kB]
Get: 365 http://deb.debian.org/debian unstable/main armhf libgradle-plugins-java all 4.4.1-20 [5206 kB]
Get: 366 http://deb.debian.org/debian unstable/main armhf gradle all 4.4.1-20 [398 kB]
Get: 367 http://deb.debian.org/debian unstable/main armhf maven-repo-helper all 1.11 [142 kB]
Get: 368 http://deb.debian.org/debian unstable/main armhf gradle-debian-helper all 2.4 [24.5 kB]
Get: 369 http://deb.debian.org/debian unstable/main armhf jarwrapper all 0.80 [9692 B]
Get: 370 http://deb.debian.org/debian unstable/main armhf javahelper all 0.80 [80.4 kB]
Get: 371 http://deb.debian.org/debian unstable/main armhf libbyte-buddy-java all 1.14.19-1 [4756 kB]
Get: 372 http://deb.debian.org/debian unstable/main armhf libcommons-math3-java all 3.6.1-3 [2018 kB]
Get: 373 http://deb.debian.org/debian unstable/main armhf libjackson2-annotations-java all 2.14.0-1 [68.8 kB]
Get: 374 http://deb.debian.org/debian unstable/main armhf libjackson2-core-java all 2.14.1-1 [447 kB]
Get: 375 http://deb.debian.org/debian unstable/main armhf libjackson2-databind-java all 2.14.0-1 [1584 kB]
Get: 376 http://deb.debian.org/debian unstable/main armhf liblz4-jni armhf 1.8.0-4 [9672 B]
Get: 377 http://deb.debian.org/debian unstable/main armhf liblz4-java all 1.8.0-4 [116 kB]
Get: 378 http://deb.debian.org/debian unstable/main armhf libmockito-java all 3.3.0-2 [510 kB]
Get: 379 http://deb.debian.org/debian unstable/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB]
Get: 380 http://deb.debian.org/debian unstable/main armhf libtrove3-java all 3.0.3-5 [2146 kB]
Fetched 317 MB in 9s (35.1 MB/s)
debconf: delaying package configuration, since apt-utils is not installed
Selecting previously unselected package libapparmor1:armhf.
(Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 19680 files and directories currently installed.)
Preparing to unpack .../libapparmor1_3.1.7-1+b3_armhf.deb ...
Unpacking libapparmor1:armhf (3.1.7-1+b3) ...
Selecting previously unselected package libsystemd-shared:armhf.
Preparing to unpack .../libsystemd-shared_257-2_armhf.deb ...
Unpacking libsystemd-shared:armhf (257-2) ...
Selecting previously unselected package systemd.
Preparing to unpack .../systemd_257-2_armhf.deb ...
Unpacking systemd (257-2) ...
Setting up libapparmor1:armhf (3.1.7-1+b3) ...
Setting up libsystemd-shared:armhf (257-2) ...
Setting up systemd (257-2) ...
Created symlink '/etc/systemd/system/getty.target.wants/getty@tty1.service' -> '/usr/lib/systemd/system/getty@.service'.

Created symlink '/etc/systemd/system/multi-user.target.wants/remote-fs.target' -> '/usr/lib/systemd/system/remote-fs.target'.

Created symlink '/etc/systemd/system/sysinit.target.wants/systemd-pstore.service' -> '/usr/lib/systemd/system/systemd-pstore.service'.

Initializing machine ID from random generator.

Creating group 'systemd-journal' with GID 999.

Creating group 'systemd-network' with GID 998.

Creating user 'systemd-network' (systemd Network Management) with UID 998 and GID 998.

/usr/lib/tmpfiles.d/legacy.conf:14: Duplicate line for path "/run/lock", ignoring.

Selecting previously unselected package systemd-sysv.
(Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 20635 files and directories currently installed.)
Preparing to unpack .../00-systemd-sysv_257-2_armhf.deb ...
Unpacking systemd-sysv (257-2) ...
Selecting previously unselected package libdbus-1-3:armhf.
Preparing to unpack .../01-libdbus-1-3_1.16.0-1_armhf.deb ...
Unpacking libdbus-1-3:armhf (1.16.0-1) ...
Selecting previously unselected package dbus-bin.
Preparing to unpack .../02-dbus-bin_1.16.0-1_armhf.deb ...
Unpacking dbus-bin (1.16.0-1) ...
Selecting previously unselected package dbus-session-bus-common.
Preparing to unpack .../03-dbus-session-bus-common_1.16.0-1_all.deb ...
Unpacking dbus-session-bus-common (1.16.0-1) ...
Selecting previously unselected package libexpat1:armhf.
Preparing to unpack .../04-libexpat1_2.6.4-1_armhf.deb ...
Unpacking libexpat1:armhf (2.6.4-1) ...
Selecting previously unselected package dbus-daemon.
Preparing to unpack .../05-dbus-daemon_1.16.0-1_armhf.deb ...
Unpacking dbus-daemon (1.16.0-1) ...
Selecting previously unselected package dbus-system-bus-common.
Preparing to unpack .../06-dbus-system-bus-common_1.16.0-1_all.deb ...
Unpacking dbus-system-bus-common (1.16.0-1) ...
Selecting previously unselected package dbus.
Preparing to unpack .../07-dbus_1.16.0-1_armhf.deb ...
Unpacking dbus (1.16.0-1) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../08-libpipeline1_1.5.8-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.8-1) ...
Selecting previously unselected package binfmt-support.
Preparing to unpack .../09-binfmt-support_2.2.2-7_armhf.deb ...
Unpacking binfmt-support (2.2.2-7) ...
Selecting previously unselected package libpython3.12-minimal:armhf.
Preparing to unpack .../10-libpython3.12-minimal_3.12.8-3_armhf.deb ...
Unpacking libpython3.12-minimal:armhf (3.12.8-3) ...
Selecting previously unselected package python3.12-minimal.
Preparing to unpack .../11-python3.12-minimal_3.12.8-3_armhf.deb ...
Unpacking python3.12-minimal (3.12.8-3) ...
Setting up libpython3.12-minimal:armhf (3.12.8-3) ...
Setting up libexpat1:armhf (2.6.4-1) ...
Setting up python3.12-minimal (3.12.8-3) ...
Selecting previously unselected package python3-minimal.
(Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 21069 files and directories currently installed.)
Preparing to unpack .../00-python3-minimal_3.12.7-1_armhf.deb ...
Unpacking python3-minimal (3.12.7-1) ...
Selecting previously unselected package media-types.
Preparing to unpack .../01-media-types_10.1.0_all.deb ...
Unpacking media-types (10.1.0) ...
Selecting previously unselected package netbase.
Preparing to unpack .../02-netbase_6.4_all.deb ...
Unpacking netbase (6.4) ...
Selecting previously unselected package tzdata.
Preparing to unpack .../03-tzdata_2024b-4_all.deb ...
Unpacking tzdata (2024b-4) ...
Selecting previously unselected package libkrb5support0:armhf.
Preparing to unpack .../04-libkrb5support0_1.21.3-3_armhf.deb ...
Unpacking libkrb5support0:armhf (1.21.3-3) ...
Selecting previously unselected package libcom-err2:armhf.
Preparing to unpack .../05-libcom-err2_1.47.2~rc1-2_armhf.deb ...
Unpacking libcom-err2:armhf (1.47.2~rc1-2) ...
Selecting previously unselected package libk5crypto3:armhf.
Preparing to unpack .../06-libk5crypto3_1.21.3-3_armhf.deb ...
Unpacking libk5crypto3:armhf (1.21.3-3) ...
Selecting previously unselected package libkeyutils1:armhf.
Preparing to unpack .../07-libkeyutils1_1.6.3-4_armhf.deb ...
Unpacking libkeyutils1:armhf (1.6.3-4) ...
Selecting previously unselected package libkrb5-3:armhf.
Preparing to unpack .../08-libkrb5-3_1.21.3-3_armhf.deb ...
Unpacking libkrb5-3:armhf (1.21.3-3) ...
Selecting previously unselected package libgssapi-krb5-2:armhf.
Preparing to unpack .../09-libgssapi-krb5-2_1.21.3-3_armhf.deb ...
Unpacking libgssapi-krb5-2:armhf (1.21.3-3) ...
Selecting previously unselected package libtirpc-common.
Preparing to unpack .../10-libtirpc-common_1.3.4+ds-1.3_all.deb ...
Unpacking libtirpc-common (1.3.4+ds-1.3) ...
Selecting previously unselected package libtirpc3t64:armhf.
Preparing to unpack .../11-libtirpc3t64_1.3.4+ds-1.3+b1_armhf.deb ...
Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3 to /lib/arm-linux-gnueabihf/libtirpc.so.3.usr-is-merged by libtirpc3t64'
Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0 to /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0.usr-is-merged by libtirpc3t64'
Unpacking libtirpc3t64:armhf (1.3.4+ds-1.3+b1) ...
Selecting previously unselected package libnsl2:armhf.
Preparing to unpack .../12-libnsl2_1.3.0-3+b3_armhf.deb ...
Unpacking libnsl2:armhf (1.3.0-3+b3) ...
Selecting previously unselected package readline-common.
Preparing to unpack .../13-readline-common_8.2-6_all.deb ...
Unpacking readline-common (8.2-6) ...
Selecting previously unselected package libreadline8t64:armhf.
Preparing to unpack .../14-libreadline8t64_8.2-6_armhf.deb ...
Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8 to /lib/arm-linux-gnueabihf/libhistory.so.8.usr-is-merged by libreadline8t64'
Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8.2 to /lib/arm-linux-gnueabihf/libhistory.so.8.2.usr-is-merged by libreadline8t64'
Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8 to /lib/arm-linux-gnueabihf/libreadline.so.8.usr-is-merged by libreadline8t64'
Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8.2 to /lib/arm-linux-gnueabihf/libreadline.so.8.2.usr-is-merged by libreadline8t64'
Unpacking libreadline8t64:armhf (8.2-6) ...
Selecting previously unselected package libpython3.12-stdlib:armhf.
Preparing to unpack .../15-libpython3.12-stdlib_3.12.8-3_armhf.deb ...
Unpacking libpython3.12-stdlib:armhf (3.12.8-3) ...
Selecting previously unselected package python3.12.
Preparing to unpack .../16-python3.12_3.12.8-3_armhf.deb ...
Unpacking python3.12 (3.12.8-3) ...
Selecting previously unselected package libpython3-stdlib:armhf.
Preparing to unpack .../17-libpython3-stdlib_3.12.7-1_armhf.deb ...
Unpacking libpython3-stdlib:armhf (3.12.7-1) ...
Setting up python3-minimal (3.12.7-1) ...
Selecting previously unselected package python3.
(Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 22132 files and directories currently installed.)
Preparing to unpack .../000-python3_3.12.7-1_armhf.deb ...
Unpacking python3 (3.12.7-1) ...
Selecting previously unselected package libproc2-0:armhf.
Preparing to unpack .../001-libproc2-0_2%3a4.0.4-6_armhf.deb ...
Unpacking libproc2-0:armhf (2:4.0.4-6) ...
Selecting previously unselected package procps.
Preparing to unpack .../002-procps_2%3a4.0.4-6_armhf.deb ...
Unpacking procps (2:4.0.4-6) ...
Selecting previously unselected package sensible-utils.
Preparing to unpack .../003-sensible-utils_0.0.24_all.deb ...
Unpacking sensible-utils (0.0.24) ...
Selecting previously unselected package openssl.
Preparing to unpack .../004-openssl_3.3.2-2_armhf.deb ...
Unpacking openssl (3.3.2-2) ...
Selecting previously unselected package ca-certificates.
Preparing to unpack .../005-ca-certificates_20240203_all.deb ...
Unpacking ca-certificates (20240203) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../006-libmagic-mgc_1%3a5.45-3+b1_armhf.deb ...
Unpacking libmagic-mgc (1:5.45-3+b1) ...
Selecting previously unselected package libmagic1t64:armhf.
Preparing to unpack .../007-libmagic1t64_1%3a5.45-3+b1_armhf.deb ...
Unpacking libmagic1t64:armhf (1:5.45-3+b1) ...
Selecting previously unselected package file.
Preparing to unpack .../008-file_1%3a5.45-3+b1_armhf.deb ...
Unpacking file (1:5.45-3+b1) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../009-gettext-base_0.22.5-3_armhf.deb ...
Unpacking gettext-base (0.22.5-3) ...
Selecting previously unselected package libuchardet0:armhf.
Preparing to unpack .../010-libuchardet0_0.0.8-1+b2_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.8-1+b2) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../011-groff-base_1.23.0-6_armhf.deb ...
Unpacking groff-base (1.23.0-6) ...
Selecting previously unselected package libpam-systemd:armhf.
Preparing to unpack .../012-libpam-systemd_257-2_armhf.deb ...
Unpacking libpam-systemd:armhf (257-2) ...
Selecting previously unselected package bsdextrautils.
Preparing to unpack .../013-bsdextrautils_2.40.2-12_armhf.deb ...
Unpacking bsdextrautils (2.40.2-12) ...
Selecting previously unselected package man-db.
Preparing to unpack .../014-man-db_2.13.0-1_armhf.deb ...
Unpacking man-db (2.13.0-1) ...
Selecting previously unselected package libgdk-pixbuf2.0-common.
Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.12+dfsg-1_all.deb ...
Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ...
Selecting previously unselected package libglib2.0-0t64:armhf.
Preparing to unpack .../016-libglib2.0-0t64_2.82.4-1_armhf.deb ...
Unpacking libglib2.0-0t64:armhf (2.82.4-1) ...
Selecting previously unselected package libicu72:armhf.
Preparing to unpack .../017-libicu72_72.1-5+b1_armhf.deb ...
Unpacking libicu72:armhf (72.1-5+b1) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../018-libxml2_2.12.7+dfsg+really2.9.14-0.2+b1_armhf.deb ...
Unpacking libxml2:armhf (2.12.7+dfsg+really2.9.14-0.2+b1) ...
Selecting previously unselected package shared-mime-info.
Preparing to unpack .../019-shared-mime-info_2.4-5+b1_armhf.deb ...
Unpacking shared-mime-info (2.4-5+b1) ...
Selecting previously unselected package libjpeg62-turbo:armhf.
Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-3+b1_armhf.deb ...
Unpacking libjpeg62-turbo:armhf (1:2.1.5-3+b1) ...
Selecting previously unselected package libpng16-16t64:armhf.
Preparing to unpack .../021-libpng16-16t64_1.6.44-3_armhf.deb ...
Unpacking libpng16-16t64:armhf (1.6.44-3) ...
Selecting previously unselected package libdeflate0:armhf.
Preparing to unpack .../022-libdeflate0_1.22-1_armhf.deb ...
Unpacking libdeflate0:armhf (1.22-1) ...
Selecting previously unselected package libjbig0:armhf.
Preparing to unpack .../023-libjbig0_2.1-6.1+b2_armhf.deb ...
Unpacking libjbig0:armhf (2.1-6.1+b2) ...
Selecting previously unselected package liblerc4:armhf.
Preparing to unpack .../024-liblerc4_4.0.0+ds-5_armhf.deb ...
Unpacking liblerc4:armhf (4.0.0+ds-5) ...
Selecting previously unselected package libsharpyuv0:armhf.
Preparing to unpack .../025-libsharpyuv0_1.4.0-0.1+b1_armhf.deb ...
Unpacking libsharpyuv0:armhf (1.4.0-0.1+b1) ...
Selecting previously unselected package libwebp7:armhf.
Preparing to unpack .../026-libwebp7_1.4.0-0.1+b1_armhf.deb ...
Unpacking libwebp7:armhf (1.4.0-0.1+b1) ...
Selecting previously unselected package libtiff6:armhf.
Preparing to unpack .../027-libtiff6_4.5.1+git230720-5_armhf.deb ...
Unpacking libtiff6:armhf (4.5.1+git230720-5) ...
Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf.
Preparing to unpack .../028-libgdk-pixbuf-2.0-0_2.42.12+dfsg-1+b1_armhf.deb ...
Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1+b1) ...
Selecting previously unselected package gtk-update-icon-cache.
Preparing to unpack .../029-gtk-update-icon-cache_4.16.7+ds-1_armhf.deb ...
No diversion 'diversion of /usr/sbin/update-icon-caches to /usr/sbin/update-icon-caches.gtk2 by libgtk-3-bin', none removed.
No diversion 'diversion of /usr/share/man/man8/update-icon-caches.8.gz to /usr/share/man/man8/update-icon-caches.gtk2.8.gz by libgtk-3-bin', none removed.
Unpacking gtk-update-icon-cache (4.16.7+ds-1) ...
Selecting previously unselected package hicolor-icon-theme.
Preparing to unpack .../030-hicolor-icon-theme_0.18-1_all.deb ...
Unpacking hicolor-icon-theme (0.18-1) ...
Selecting previously unselected package adwaita-icon-theme.
Preparing to unpack .../031-adwaita-icon-theme_47.0-2_all.deb ...
Unpacking adwaita-icon-theme (47.0-2) ...
Selecting previously unselected package ca-certificates-java.
Preparing to unpack .../032-ca-certificates-java_20240118_all.deb ...
Unpacking ca-certificates-java (20240118) ...
Selecting previously unselected package java-common.
Preparing to unpack .../033-java-common_0.76_all.deb ...
Unpacking java-common (0.76) ...
Selecting previously unselected package liblcms2-2:armhf.
Preparing to unpack .../034-liblcms2-2_2.16-2_armhf.deb ...
Unpacking liblcms2-2:armhf (2.16-2) ...
Selecting previously unselected package libnspr4:armhf.
Preparing to unpack .../035-libnspr4_2%3a4.36-1_armhf.deb ...
Unpacking libnspr4:armhf (2:4.36-1) ...
Selecting previously unselected package libnss3:armhf.
Preparing to unpack .../036-libnss3_2%3a3.106-1_armhf.deb ...
Unpacking libnss3:armhf (2:3.106-1) ...
Selecting previously unselected package libpcsclite1:armhf.
Preparing to unpack .../037-libpcsclite1_2.3.0-3_armhf.deb ...
Unpacking libpcsclite1:armhf (2.3.0-3) ...
Selecting previously unselected package openjdk-21-jre-headless:armhf.
Preparing to unpack .../038-openjdk-21-jre-headless_21.0.5+11-1_armhf.deb ...
Unpacking openjdk-21-jre-headless:armhf (21.0.5+11-1) ...
Selecting previously unselected package default-jre-headless.
Preparing to unpack .../039-default-jre-headless_2%3a1.21-76_armhf.deb ...
Unpacking default-jre-headless (2:1.21-76) ...
Selecting previously unselected package ant.
Preparing to unpack .../040-ant_1.10.15-1_all.deb ...
Unpacking ant (1.10.15-1) ...
Selecting previously unselected package ant-optional.
Preparing to unpack .../041-ant-optional_1.10.15-1_all.deb ...
Unpacking ant-optional (1.10.15-1) ...
Selecting previously unselected package libantlr-java.
Preparing to unpack .../042-libantlr-java_2.7.7+dfsg-14_all.deb ...
Unpacking libantlr-java (2.7.7+dfsg-14) ...
Selecting previously unselected package antlr.
Preparing to unpack .../043-antlr_2.7.7+dfsg-14_all.deb ...
Unpacking antlr (2.7.7+dfsg-14) ...
Selecting previously unselected package at-spi2-common.
Preparing to unpack .../044-at-spi2-common_2.54.0-1_all.deb ...
Unpacking at-spi2-common (2.54.0-1) ...
Selecting previously unselected package m4.
Preparing to unpack .../045-m4_1.4.19-4_armhf.deb ...
Unpacking m4 (1.4.19-4) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../046-autoconf_2.72-3_all.deb ...
Unpacking autoconf (2.72-3) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../047-autotools-dev_20220109.1_all.deb ...
Unpacking autotools-dev (20220109.1) ...
Selecting previously unselected package automake.
Preparing to unpack .../048-automake_1%3a1.16.5-1.3_all.deb ...
Unpacking automake (1:1.16.5-1.3) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../049-autopoint_0.22.5-3_all.deb ...
Unpacking autopoint (0.22.5-3) ...
Selecting previously unselected package unzip.
Preparing to unpack .../050-unzip_6.0-28_armhf.deb ...
Unpacking unzip (6.0-28) ...
Selecting previously unselected package java-wrappers.
Preparing to unpack .../051-java-wrappers_0.5_all.deb ...
Unpacking java-wrappers (0.5) ...
Selecting previously unselected package libhamcrest-java.
Preparing to unpack .../052-libhamcrest-java_2.2-2_all.deb ...
Unpacking libhamcrest-java (2.2-2) ...
Selecting previously unselected package junit4.
Preparing to unpack .../053-junit4_4.13.2-5_all.deb ...
Unpacking junit4 (4.13.2-5) ...
Selecting previously unselected package libfelix-framework-java.
Preparing to unpack .../054-libfelix-framework-java_4.6.1-2.1_all.deb ...
Unpacking libfelix-framework-java (4.6.1-2.1) ...
Selecting previously unselected package libfelix-gogo-runtime-java.
Preparing to unpack .../055-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ...
Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ...
Selecting previously unselected package libosgi-annotation-java.
Preparing to unpack .../056-libosgi-annotation-java_8.1.0-1_all.deb ...
Unpacking libosgi-annotation-java (8.1.0-1) ...
Selecting previously unselected package libosgi-core-java.
Preparing to unpack .../057-libosgi-core-java_8.0.0-2_all.deb ...
Unpacking libosgi-core-java (8.0.0-2) ...
Selecting previously unselected package libfelix-resolver-java.
Preparing to unpack .../058-libfelix-resolver-java_1.16.0-1_all.deb ...
Unpacking libfelix-resolver-java (1.16.0-1) ...
Selecting previously unselected package libhawtjni-runtime-java.
Preparing to unpack .../059-libhawtjni-runtime-java_1.18-1_all.deb ...
Unpacking libhawtjni-runtime-java (1.18-1) ...
Selecting previously unselected package libjansi-native-java.
Preparing to unpack .../060-libjansi-native-java_1.8-2_all.deb ...
Unpacking libjansi-native-java (1.8-2) ...
Selecting previously unselected package libjansi1-java.
Preparing to unpack .../061-libjansi1-java_1.18-3_all.deb ...
Unpacking libjansi1-java (1.18-3) ...
Selecting previously unselected package libjline2-java.
Preparing to unpack .../062-libjline2-java_2.14.6-5_all.deb ...
Unpacking libjline2-java (2.14.6-5) ...
Selecting previously unselected package libosgi-compendium-java.
Preparing to unpack .../063-libosgi-compendium-java_7.0.0-1_all.deb ...
Unpacking libosgi-compendium-java (7.0.0-1) ...
Selecting previously unselected package libslf4j-java.
Preparing to unpack .../064-libslf4j-java_1.7.32-1_all.deb ...
Unpacking libslf4j-java (1.7.32-1) ...
Selecting previously unselected package libxz-java.
Preparing to unpack .../065-libxz-java_1.9-1_all.deb ...
Unpacking libxz-java (1.9-1) ...
Selecting previously unselected package libyaml-snake-java.
Preparing to unpack .../066-libyaml-snake-java_1.33-2_all.deb ...
Unpacking libyaml-snake-java (1.33-2) ...
Selecting previously unselected package bnd.
Preparing to unpack .../067-bnd_5.0.1-5_all.deb ...
Unpacking bnd (5.0.1-5) ...
Selecting previously unselected package dbus-user-session.
Preparing to unpack .../068-dbus-user-session_1.16.0-1_armhf.deb ...
Unpacking dbus-user-session (1.16.0-1) ...
Selecting previously unselected package libdconf1:armhf.
Preparing to unpack .../069-libdconf1_0.40.0-4+b3_armhf.deb ...
Unpacking libdconf1:armhf (0.40.0-4+b3) ...
Selecting previously unselected package dconf-service.
Preparing to unpack .../070-dconf-service_0.40.0-4+b3_armhf.deb ...
Unpacking dconf-service (0.40.0-4+b3) ...
Selecting previously unselected package dconf-gsettings-backend:armhf.
Preparing to unpack .../071-dconf-gsettings-backend_0.40.0-4+b3_armhf.deb ...
Unpacking dconf-gsettings-backend:armhf (0.40.0-4+b3) ...
Selecting previously unselected package dctrl-tools.
Preparing to unpack .../072-dctrl-tools_2.24-3_armhf.deb ...
Unpacking dctrl-tools (2.24-3) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../073-libdebhelper-perl_13.21_all.deb ...
Unpacking libdebhelper-perl (13.21) ...
Selecting previously unselected package libtool.
Preparing to unpack .../074-libtool_2.4.7-8_all.deb ...
Unpacking libtool (2.4.7-8) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../075-dh-autoreconf_20_all.deb ...
Unpacking dh-autoreconf (20) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../076-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../077-libfile-stripnondeterminism-perl_1.14.0-1_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.14.0-1) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../078-dh-strip-nondeterminism_1.14.0-1_all.deb ...
Unpacking dh-strip-nondeterminism (1.14.0-1) ...
Selecting previously unselected package libelf1t64:armhf.
Preparing to unpack .../079-libelf1t64_0.192-4_armhf.deb ...
Unpacking libelf1t64:armhf (0.192-4) ...
Selecting previously unselected package dwz.
Preparing to unpack .../080-dwz_0.15-1+b2_armhf.deb ...
Unpacking dwz (0.15-1+b2) ...
Selecting previously unselected package gettext.
Preparing to unpack .../081-gettext_0.22.5-3_armhf.deb ...
Unpacking gettext (0.22.5-3) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../082-intltool-debian_0.35.0+20060710.6_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.6) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../083-po-debconf_1.0.21+nmu1_all.deb ...
Unpacking po-debconf (1.0.21+nmu1) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../084-debhelper_13.21_all.deb ...
Unpacking debhelper (13.21) ...
Selecting previously unselected package libatk1.0-0t64:armhf.
Preparing to unpack .../085-libatk1.0-0t64_2.54.0-1_armhf.deb ...
Unpacking libatk1.0-0t64:armhf (2.54.0-1) ...
Selecting previously unselected package libxau6:armhf.
Preparing to unpack .../086-libxau6_1%3a1.0.11-1_armhf.deb ...
Unpacking libxau6:armhf (1:1.0.11-1) ...
Selecting previously unselected package libxdmcp6:armhf.
Preparing to unpack .../087-libxdmcp6_1%3a1.1.5-1_armhf.deb ...
Unpacking libxdmcp6:armhf (1:1.1.5-1) ...
Selecting previously unselected package libxcb1:armhf.
Preparing to unpack .../088-libxcb1_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb1:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libx11-data.
Preparing to unpack .../089-libx11-data_2%3a1.8.10-2_all.deb ...
Unpacking libx11-data (2:1.8.10-2) ...
Selecting previously unselected package libx11-6:armhf.
Preparing to unpack .../090-libx11-6_2%3a1.8.10-2_armhf.deb ...
Unpacking libx11-6:armhf (2:1.8.10-2) ...
Selecting previously unselected package libxext6:armhf.
Preparing to unpack .../091-libxext6_2%3a1.3.4-1+b2_armhf.deb ...
Unpacking libxext6:armhf (2:1.3.4-1+b2) ...
Selecting previously unselected package libxi6:armhf.
Preparing to unpack .../092-libxi6_2%3a1.8.2-1_armhf.deb ...
Unpacking libxi6:armhf (2:1.8.2-1) ...
Selecting previously unselected package libatspi2.0-0t64:armhf.
Preparing to unpack .../093-libatspi2.0-0t64_2.54.0-1_armhf.deb ...
Unpacking libatspi2.0-0t64:armhf (2.54.0-1) ...
Selecting previously unselected package libatk-bridge2.0-0t64:armhf.
Preparing to unpack .../094-libatk-bridge2.0-0t64_2.54.0-1_armhf.deb ...
Unpacking libatk-bridge2.0-0t64:armhf (2.54.0-1) ...
Selecting previously unselected package libbrotli1:armhf.
Preparing to unpack .../095-libbrotli1_1.1.0-2+b6_armhf.deb ...
Unpacking libbrotli1:armhf (1.1.0-2+b6) ...
Selecting previously unselected package libfreetype6:armhf.
Preparing to unpack .../096-libfreetype6_2.13.3+dfsg-1_armhf.deb ...
Unpacking libfreetype6:armhf (2.13.3+dfsg-1) ...
Selecting previously unselected package fonts-dejavu-mono.
Preparing to unpack .../097-fonts-dejavu-mono_2.37-8_all.deb ...
Unpacking fonts-dejavu-mono (2.37-8) ...
Selecting previously unselected package fonts-dejavu-core.
Preparing to unpack .../098-fonts-dejavu-core_2.37-8_all.deb ...
Unpacking fonts-dejavu-core (2.37-8) ...
Selecting previously unselected package fontconfig-config.
Preparing to unpack .../099-fontconfig-config_2.15.0-1.1+b1_armhf.deb ...
Unpacking fontconfig-config (2.15.0-1.1+b1) ...
Selecting previously unselected package libfontconfig1:armhf.
Preparing to unpack .../100-libfontconfig1_2.15.0-1.1+b1_armhf.deb ...
Unpacking libfontconfig1:armhf (2.15.0-1.1+b1) ...
Selecting previously unselected package libpixman-1-0:armhf.
Preparing to unpack .../101-libpixman-1-0_0.44.0-3_armhf.deb ...
Unpacking libpixman-1-0:armhf (0.44.0-3) ...
Selecting previously unselected package libxcb-render0:armhf.
Preparing to unpack .../102-libxcb-render0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-render0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxcb-shm0:armhf.
Preparing to unpack .../103-libxcb-shm0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-shm0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxrender1:armhf.
Preparing to unpack .../104-libxrender1_1%3a0.9.10-1.1+b3_armhf.deb ...
Unpacking libxrender1:armhf (1:0.9.10-1.1+b3) ...
Selecting previously unselected package libcairo2:armhf.
Preparing to unpack .../105-libcairo2_1.18.2-2_armhf.deb ...
Unpacking libcairo2:armhf (1.18.2-2) ...
Selecting previously unselected package libcairo-gobject2:armhf.
Preparing to unpack .../106-libcairo-gobject2_1.18.2-2_armhf.deb ...
Unpacking libcairo-gobject2:armhf (1.18.2-2) ...
Selecting previously unselected package libcloudproviders0:armhf.
Preparing to unpack .../107-libcloudproviders0_0.3.6-1+b1_armhf.deb ...
Unpacking libcloudproviders0:armhf (0.3.6-1+b1) ...
Selecting previously unselected package libcolord2:armhf.
Preparing to unpack .../108-libcolord2_1.4.7-1+b2_armhf.deb ...
Unpacking libcolord2:armhf (1.4.7-1+b2) ...
Selecting previously unselected package libavahi-common-data:armhf.
Preparing to unpack .../109-libavahi-common-data_0.8-15_armhf.deb ...
Unpacking libavahi-common-data:armhf (0.8-15) ...
Selecting previously unselected package libavahi-common3:armhf.
Preparing to unpack .../110-libavahi-common3_0.8-15_armhf.deb ...
Unpacking libavahi-common3:armhf (0.8-15) ...
Selecting previously unselected package libavahi-client3:armhf.
Preparing to unpack .../111-libavahi-client3_0.8-15_armhf.deb ...
Unpacking libavahi-client3:armhf (0.8-15) ...
Selecting previously unselected package libcups2t64:armhf.
Preparing to unpack .../112-libcups2t64_2.4.10-2_armhf.deb ...
Unpacking libcups2t64:armhf (2.4.10-2) ...
Selecting previously unselected package libepoxy0:armhf.
Preparing to unpack .../113-libepoxy0_1.5.10-2_armhf.deb ...
Unpacking libepoxy0:armhf (1.5.10-2) ...
Selecting previously unselected package libfribidi0:armhf.
Preparing to unpack .../114-libfribidi0_1.0.16-1_armhf.deb ...
Unpacking libfribidi0:armhf (1.0.16-1) ...
Selecting previously unselected package libgraphite2-3:armhf.
Preparing to unpack .../115-libgraphite2-3_1.3.14-2+b1_armhf.deb ...
Unpacking libgraphite2-3:armhf (1.3.14-2+b1) ...
Selecting previously unselected package libharfbuzz0b:armhf.
Preparing to unpack .../116-libharfbuzz0b_10.1.0-1_armhf.deb ...
Unpacking libharfbuzz0b:armhf (10.1.0-1) ...
Selecting previously unselected package fontconfig.
Preparing to unpack .../117-fontconfig_2.15.0-1.1+b1_armhf.deb ...
Unpacking fontconfig (2.15.0-1.1+b1) ...
Selecting previously unselected package libthai-data.
Preparing to unpack .../118-libthai-data_0.1.29-2_all.deb ...
Unpacking libthai-data (0.1.29-2) ...
Selecting previously unselected package libdatrie1:armhf.
Preparing to unpack .../119-libdatrie1_0.2.13-3+b1_armhf.deb ...
Unpacking libdatrie1:armhf (0.2.13-3+b1) ...
Selecting previously unselected package libthai0:armhf.
Preparing to unpack .../120-libthai0_0.1.29-2+b1_armhf.deb ...
Unpacking libthai0:armhf (0.1.29-2+b1) ...
Selecting previously unselected package libpango-1.0-0:armhf.
Preparing to unpack .../121-libpango-1.0-0_1.55.0+ds-3_armhf.deb ...
Unpacking libpango-1.0-0:armhf (1.55.0+ds-3) ...
Selecting previously unselected package libpangoft2-1.0-0:armhf.
Preparing to unpack .../122-libpangoft2-1.0-0_1.55.0+ds-3_armhf.deb ...
Unpacking libpangoft2-1.0-0:armhf (1.55.0+ds-3) ...
Selecting previously unselected package libpangocairo-1.0-0:armhf.
Preparing to unpack .../123-libpangocairo-1.0-0_1.55.0+ds-3_armhf.deb ...
Unpacking libpangocairo-1.0-0:armhf (1.55.0+ds-3) ...
Selecting previously unselected package libwayland-client0:armhf.
Preparing to unpack .../124-libwayland-client0_1.23.0-1+b1_armhf.deb ...
Unpacking libwayland-client0:armhf (1.23.0-1+b1) ...
Selecting previously unselected package libwayland-cursor0:armhf.
Preparing to unpack .../125-libwayland-cursor0_1.23.0-1+b1_armhf.deb ...
Unpacking libwayland-cursor0:armhf (1.23.0-1+b1) ...
Selecting previously unselected package libwayland-egl1:armhf.
Preparing to unpack .../126-libwayland-egl1_1.23.0-1+b1_armhf.deb ...
Unpacking libwayland-egl1:armhf (1.23.0-1+b1) ...
Selecting previously unselected package libxcomposite1:armhf.
Preparing to unpack .../127-libxcomposite1_1%3a0.4.6-1_armhf.deb ...
Unpacking libxcomposite1:armhf (1:0.4.6-1) ...
Selecting previously unselected package libxfixes3:armhf.
Preparing to unpack .../128-libxfixes3_1%3a6.0.0-2+b3_armhf.deb ...
Unpacking libxfixes3:armhf (1:6.0.0-2+b3) ...
Selecting previously unselected package libxcursor1:armhf.
Preparing to unpack .../129-libxcursor1_1%3a1.2.2-1+b1_armhf.deb ...
Unpacking libxcursor1:armhf (1:1.2.2-1+b1) ...
Selecting previously unselected package libxdamage1:armhf.
Preparing to unpack .../130-libxdamage1_1%3a1.1.6-1+b2_armhf.deb ...
Unpacking libxdamage1:armhf (1:1.1.6-1+b2) ...
Selecting previously unselected package libxinerama1:armhf.
Preparing to unpack .../131-libxinerama1_2%3a1.1.4-3+b3_armhf.deb ...
Unpacking libxinerama1:armhf (2:1.1.4-3+b3) ...
Selecting previously unselected package xkb-data.
Preparing to unpack .../132-xkb-data_2.42-1_all.deb ...
Unpacking xkb-data (2.42-1) ...
Selecting previously unselected package libxkbcommon0:armhf.
Preparing to unpack .../133-libxkbcommon0_1.7.0-2_armhf.deb ...
Unpacking libxkbcommon0:armhf (1.7.0-2) ...
Selecting previously unselected package libxrandr2:armhf.
Preparing to unpack .../134-libxrandr2_2%3a1.5.4-1+b2_armhf.deb ...
Unpacking libxrandr2:armhf (2:1.5.4-1+b2) ...
Selecting previously unselected package libgtk-3-common.
Preparing to unpack .../135-libgtk-3-common_3.24.43-4_all.deb ...
Unpacking libgtk-3-common (3.24.43-4) ...
Selecting previously unselected package libgtk-3-0t64:armhf.
Preparing to unpack .../136-libgtk-3-0t64_3.24.43-4_armhf.deb ...
Unpacking libgtk-3-0t64:armhf (3.24.43-4) ...
Selecting previously unselected package libglvnd0:armhf.
Preparing to unpack .../137-libglvnd0_1.7.0-1+b2_armhf.deb ...
Unpacking libglvnd0:armhf (1.7.0-1+b2) ...
Selecting previously unselected package libdrm-common.
Preparing to unpack .../138-libdrm-common_2.4.123-1_all.deb ...
Unpacking libdrm-common (2.4.123-1) ...
Selecting previously unselected package libdrm2:armhf.
Preparing to unpack .../139-libdrm2_2.4.123-1_armhf.deb ...
Unpacking libdrm2:armhf (2.4.123-1) ...
Selecting previously unselected package libglapi-mesa:armhf.
Preparing to unpack .../140-libglapi-mesa_24.2.8-1_armhf.deb ...
Unpacking libglapi-mesa:armhf (24.2.8-1) ...
Selecting previously unselected package libx11-xcb1:armhf.
Preparing to unpack .../141-libx11-xcb1_2%3a1.8.10-2_armhf.deb ...
Unpacking libx11-xcb1:armhf (2:1.8.10-2) ...
Selecting previously unselected package libxcb-dri2-0:armhf.
Preparing to unpack .../142-libxcb-dri2-0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-dri2-0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxcb-dri3-0:armhf.
Preparing to unpack .../143-libxcb-dri3-0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-dri3-0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxcb-glx0:armhf.
Preparing to unpack .../144-libxcb-glx0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-glx0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxcb-present0:armhf.
Preparing to unpack .../145-libxcb-present0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-present0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxcb-randr0:armhf.
Preparing to unpack .../146-libxcb-randr0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-randr0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxcb-sync1:armhf.
Preparing to unpack .../147-libxcb-sync1_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-sync1:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxcb-xfixes0:armhf.
Preparing to unpack .../148-libxcb-xfixes0_1.17.0-2+b1_armhf.deb ...
Unpacking libxcb-xfixes0:armhf (1.17.0-2+b1) ...
Selecting previously unselected package libxshmfence1:armhf.
Preparing to unpack .../149-libxshmfence1_1.3-1+b2_armhf.deb ...
Unpacking libxshmfence1:armhf (1.3-1+b2) ...
Selecting previously unselected package libxxf86vm1:armhf.
Preparing to unpack .../150-libxxf86vm1_1%3a1.1.4-1+b3_armhf.deb ...
Unpacking libxxf86vm1:armhf (1:1.1.4-1+b3) ...
Selecting previously unselected package libdrm-amdgpu1:armhf.
Preparing to unpack .../151-libdrm-amdgpu1_2.4.123-1_armhf.deb ...
Unpacking libdrm-amdgpu1:armhf (2.4.123-1) ...
Selecting previously unselected package libdrm-radeon1:armhf.
Preparing to unpack .../152-libdrm-radeon1_2.4.123-1_armhf.deb ...
Unpacking libdrm-radeon1:armhf (2.4.123-1) ...
Selecting previously unselected package libedit2:armhf.
Preparing to unpack .../153-libedit2_3.1-20240808-1_armhf.deb ...
Unpacking libedit2:armhf (3.1-20240808-1) ...
Selecting previously unselected package libz3-4:armhf.
Preparing to unpack .../154-libz3-4_4.13.3-1_armhf.deb ...
Unpacking libz3-4:armhf (4.13.3-1) ...
Selecting previously unselected package libllvm19:armhf.
Preparing to unpack .../155-libllvm19_1%3a19.1.5-1_armhf.deb ...
Unpacking libllvm19:armhf (1:19.1.5-1) ...
Selecting previously unselected package libsensors-config.
Preparing to unpack .../156-libsensors-config_1%3a3.6.0-10_all.deb ...
Unpacking libsensors-config (1:3.6.0-10) ...
Selecting previously unselected package libsensors5:armhf.
Preparing to unpack .../157-libsensors5_1%3a3.6.0-10+b1_armhf.deb ...
Unpacking libsensors5:armhf (1:3.6.0-10+b1) ...
Selecting previously unselected package mesa-libgallium:armhf.
Preparing to unpack .../158-mesa-libgallium_24.2.8-1_armhf.deb ...
Unpacking mesa-libgallium:armhf (24.2.8-1) ...
Selecting previously unselected package libvulkan1:armhf.
Preparing to unpack .../159-libvulkan1_1.3.296.0-1_armhf.deb ...
Unpacking libvulkan1:armhf (1.3.296.0-1) ...
Selecting previously unselected package libwayland-server0:armhf.
Preparing to unpack .../160-libwayland-server0_1.23.0-1+b1_armhf.deb ...
Unpacking libwayland-server0:armhf (1.23.0-1+b1) ...
Selecting previously unselected package libgbm1:armhf.
Preparing to unpack .../161-libgbm1_24.2.8-1_armhf.deb ...
Unpacking libgbm1:armhf (24.2.8-1) ...
Selecting previously unselected package libgl1-mesa-dri:armhf.
Preparing to unpack .../162-libgl1-mesa-dri_24.2.8-1_armhf.deb ...
Unpacking libgl1-mesa-dri:armhf (24.2.8-1) ...
Selecting previously unselected package libglx-mesa0:armhf.
Preparing to unpack .../163-libglx-mesa0_24.2.8-1_armhf.deb ...
Unpacking libglx-mesa0:armhf (24.2.8-1) ...
Selecting previously unselected package libglx0:armhf.
Preparing to unpack .../164-libglx0_1.7.0-1+b2_armhf.deb ...
Unpacking libglx0:armhf (1.7.0-1+b2) ...
Selecting previously unselected package libgl1:armhf.
Preparing to unpack .../165-libgl1_1.7.0-1+b2_armhf.deb ...
Unpacking libgl1:armhf (1.7.0-1+b2) ...
Selecting previously unselected package libasound2-data.
Preparing to unpack .../166-libasound2-data_1.2.12-1_all.deb ...
Unpacking libasound2-data (1.2.12-1) ...
Selecting previously unselected package libasound2t64:armhf.
Preparing to unpack .../167-libasound2t64_1.2.12-1+b1_armhf.deb ...
Unpacking libasound2t64:armhf (1.2.12-1+b1) ...
Selecting previously unselected package libgif7:armhf.
Preparing to unpack .../168-libgif7_5.2.2-1+b1_armhf.deb ...
Unpacking libgif7:armhf (5.2.2-1+b1) ...
Selecting previously unselected package x11-common.
Preparing to unpack .../169-x11-common_1%3a7.7+23.1_all.deb ...
Unpacking x11-common (1:7.7+23.1) ...
Selecting previously unselected package libxtst6:armhf.
Preparing to unpack .../170-libxtst6_2%3a1.2.3-1.1+b3_armhf.deb ...
Unpacking libxtst6:armhf (2:1.2.3-1.1+b3) ...
Selecting previously unselected package openjdk-21-jre:armhf.
Preparing to unpack .../171-openjdk-21-jre_21.0.5+11-1_armhf.deb ...
Unpacking openjdk-21-jre:armhf (21.0.5+11-1) ...
Selecting previously unselected package default-jre.
Preparing to unpack .../172-default-jre_2%3a1.21-76_armhf.deb ...
Unpacking default-jre (2:1.21-76) ...
Selecting previously unselected package openjdk-21-jdk-headless:armhf.
Preparing to unpack .../173-openjdk-21-jdk-headless_21.0.5+11-1_armhf.deb ...
Unpacking openjdk-21-jdk-headless:armhf (21.0.5+11-1) ...
Selecting previously unselected package default-jdk-headless.
Preparing to unpack .../174-default-jdk-headless_2%3a1.21-76_armhf.deb ...
Unpacking default-jdk-headless (2:1.21-76) ...
Selecting previously unselected package openjdk-21-jdk:armhf.
Preparing to unpack .../175-openjdk-21-jdk_21.0.5+11-1_armhf.deb ...
Unpacking openjdk-21-jdk:armhf (21.0.5+11-1) ...
Selecting previously unselected package default-jdk.
Preparing to unpack .../176-default-jdk_2%3a1.21-76_armhf.deb ...
Unpacking default-jdk (2:1.21-76) ...
Selecting previously unselected package libassuan9:armhf.
Preparing to unpack .../177-libassuan9_3.0.1-2_armhf.deb ...
Unpacking libassuan9:armhf (3.0.1-2) ...
Selecting previously unselected package gpgconf.
Preparing to unpack .../178-gpgconf_2.2.45-2_armhf.deb ...
Unpacking gpgconf (2.2.45-2) ...
Selecting previously unselected package libksba8:armhf.
Preparing to unpack .../179-libksba8_1.6.7-2+b1_armhf.deb ...
Unpacking libksba8:armhf (1.6.7-2+b1) ...
Selecting previously unselected package libsasl2-modules-db:armhf.
Preparing to unpack .../180-libsasl2-modules-db_2.1.28+dfsg1-8_armhf.deb ...
Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-8) ...
Selecting previously unselected package libsasl2-2:armhf.
Preparing to unpack .../181-libsasl2-2_2.1.28+dfsg1-8_armhf.deb ...
Unpacking libsasl2-2:armhf (2.1.28+dfsg1-8) ...
Selecting previously unselected package libldap-2.5-0:armhf.
Preparing to unpack .../182-libldap-2.5-0_2.5.18+dfsg-3+b1_armhf.deb ...
Unpacking libldap-2.5-0:armhf (2.5.18+dfsg-3+b1) ...
Selecting previously unselected package libnpth0t64:armhf.
Preparing to unpack .../183-libnpth0t64_1.8-2_armhf.deb ...
Unpacking libnpth0t64:armhf (1.8-2) ...
Selecting previously unselected package dirmngr.
Preparing to unpack .../184-dirmngr_2.2.45-2_armhf.deb ...
Unpacking dirmngr (2.2.45-2) ...
Selecting previously unselected package gnupg-l10n.
Preparing to unpack .../185-gnupg-l10n_2.2.45-2_all.deb ...
Unpacking gnupg-l10n (2.2.45-2) ...
Selecting previously unselected package gpg.
Preparing to unpack .../186-gpg_2.2.45-2_armhf.deb ...
Unpacking gpg (2.2.45-2) ...
Selecting previously unselected package pinentry-curses.
Preparing to unpack .../187-pinentry-curses_1.2.1-4+b1_armhf.deb ...
Unpacking pinentry-curses (1.2.1-4+b1) ...
Selecting previously unselected package gpg-agent.
Preparing to unpack .../188-gpg-agent_2.2.45-2_armhf.deb ...
Unpacking gpg-agent (2.2.45-2) ...
Selecting previously unselected package gpgsm.
Preparing to unpack .../189-gpgsm_2.2.45-2_armhf.deb ...
Unpacking gpgsm (2.2.45-2) ...
Selecting previously unselected package gnupg.
Preparing to unpack .../190-gnupg_2.2.45-2_all.deb ...
Unpacking gnupg (2.2.45-2) ...
Selecting previously unselected package libfile-dirlist-perl.
Preparing to unpack .../191-libfile-dirlist-perl_0.05-3_all.deb ...
Unpacking libfile-dirlist-perl (0.05-3) ...
Selecting previously unselected package libfile-which-perl.
Preparing to unpack .../192-libfile-which-perl_1.27-2_all.deb ...
Unpacking libfile-which-perl (1.27-2) ...
Selecting previously unselected package libfile-homedir-perl.
Preparing to unpack .../193-libfile-homedir-perl_1.006-2_all.deb ...
Unpacking libfile-homedir-perl (1.006-2) ...
Selecting previously unselected package libfile-touch-perl.
Preparing to unpack .../194-libfile-touch-perl_0.12-2_all.deb ...
Unpacking libfile-touch-perl (0.12-2) ...
Selecting previously unselected package libio-pty-perl.
Preparing to unpack .../195-libio-pty-perl_1%3a1.20-1+b2_armhf.deb ...
Unpacking libio-pty-perl (1:1.20-1+b2) ...
Selecting previously unselected package libipc-run-perl.
Preparing to unpack .../196-libipc-run-perl_20231003.0-2_all.deb ...
Unpacking libipc-run-perl (20231003.0-2) ...
Selecting previously unselected package libclass-method-modifiers-perl.
Preparing to unpack .../197-libclass-method-modifiers-perl_2.15-1_all.deb ...
Unpacking libclass-method-modifiers-perl (2.15-1) ...
Selecting previously unselected package libclass-xsaccessor-perl.
Preparing to unpack .../198-libclass-xsaccessor-perl_1.19-4+b4_armhf.deb ...
Unpacking libclass-xsaccessor-perl (1.19-4+b4) ...
Selecting previously unselected package libb-hooks-op-check-perl:armhf.
Preparing to unpack .../199-libb-hooks-op-check-perl_0.22-3+b2_armhf.deb ...
Unpacking libb-hooks-op-check-perl:armhf (0.22-3+b2) ...
Selecting previously unselected package libdynaloader-functions-perl.
Preparing to unpack .../200-libdynaloader-functions-perl_0.004-1_all.deb ...
Unpacking libdynaloader-functions-perl (0.004-1) ...
Selecting previously unselected package libdevel-callchecker-perl:armhf.
Preparing to unpack .../201-libdevel-callchecker-perl_0.009-1+b1_armhf.deb ...
Unpacking libdevel-callchecker-perl:armhf (0.009-1+b1) ...
Selecting previously unselected package libparams-classify-perl:armhf.
Preparing to unpack .../202-libparams-classify-perl_0.015-2+b4_armhf.deb ...
Unpacking libparams-classify-perl:armhf (0.015-2+b4) ...
Selecting previously unselected package libmodule-runtime-perl.
Preparing to unpack .../203-libmodule-runtime-perl_0.016-2_all.deb ...
Unpacking libmodule-runtime-perl (0.016-2) ...
Selecting previously unselected package libimport-into-perl.
Preparing to unpack .../204-libimport-into-perl_1.002005-2_all.deb ...
Unpacking libimport-into-perl (1.002005-2) ...
Selecting previously unselected package librole-tiny-perl.
Preparing to unpack .../205-librole-tiny-perl_2.002004-1_all.deb ...
Unpacking librole-tiny-perl (2.002004-1) ...
Selecting previously unselected package libsub-quote-perl.
Preparing to unpack .../206-libsub-quote-perl_2.006008-1_all.deb ...
Unpacking libsub-quote-perl (2.006008-1) ...
Selecting previously unselected package libmoo-perl.
Preparing to unpack .../207-libmoo-perl_2.005005-1_all.deb ...
Unpacking libmoo-perl (2.005005-1) ...
Selecting previously unselected package libencode-locale-perl.
Preparing to unpack .../208-libencode-locale-perl_1.05-3_all.deb ...
Unpacking libencode-locale-perl (1.05-3) ...
Selecting previously unselected package libtimedate-perl.
Preparing to unpack .../209-libtimedate-perl_2.3300-2_all.deb ...
Unpacking libtimedate-perl (2.3300-2) ...
Selecting previously unselected package libhttp-date-perl.
Preparing to unpack .../210-libhttp-date-perl_6.06-1_all.deb ...
Unpacking libhttp-date-perl (6.06-1) ...
Selecting previously unselected package libfile-listing-perl.
Preparing to unpack .../211-libfile-listing-perl_6.16-1_all.deb ...
Unpacking libfile-listing-perl (6.16-1) ...
Selecting previously unselected package libhtml-tagset-perl.
Preparing to unpack .../212-libhtml-tagset-perl_3.24-1_all.deb ...
Unpacking libhtml-tagset-perl (3.24-1) ...
Selecting previously unselected package liburi-perl.
Preparing to unpack .../213-liburi-perl_5.30-1_all.deb ...
Unpacking liburi-perl (5.30-1) ...
Selecting previously unselected package libhtml-parser-perl:armhf.
Preparing to unpack .../214-libhtml-parser-perl_3.83-1+b1_armhf.deb ...
Unpacking libhtml-parser-perl:armhf (3.83-1+b1) ...
Selecting previously unselected package libhtml-tree-perl.
Preparing to unpack .../215-libhtml-tree-perl_5.07-3_all.deb ...
Unpacking libhtml-tree-perl (5.07-3) ...
Selecting previously unselected package libclone-perl:armhf.
Preparing to unpack .../216-libclone-perl_0.47-1+b1_armhf.deb ...
Unpacking libclone-perl:armhf (0.47-1+b1) ...
Selecting previously unselected package libio-html-perl.
Preparing to unpack .../217-libio-html-perl_1.004-3_all.deb ...
Unpacking libio-html-perl (1.004-3) ...
Selecting previously unselected package liblwp-mediatypes-perl.
Preparing to unpack .../218-liblwp-mediatypes-perl_6.04-2_all.deb ...
Unpacking liblwp-mediatypes-perl (6.04-2) ...
Selecting previously unselected package libhttp-message-perl.
Preparing to unpack .../219-libhttp-message-perl_7.00-2_all.deb ...
Unpacking libhttp-message-perl (7.00-2) ...
Selecting previously unselected package libhttp-cookies-perl.
Preparing to unpack .../220-libhttp-cookies-perl_6.11-1_all.deb ...
Unpacking libhttp-cookies-perl (6.11-1) ...
Selecting previously unselected package libhttp-negotiate-perl.
Preparing to unpack .../221-libhttp-negotiate-perl_6.01-2_all.deb ...
Unpacking libhttp-negotiate-perl (6.01-2) ...
Selecting previously unselected package perl-openssl-defaults:armhf.
Preparing to unpack .../222-perl-openssl-defaults_7+b2_armhf.deb ...
Unpacking perl-openssl-defaults:armhf (7+b2) ...
Selecting previously unselected package libnet-ssleay-perl:armhf.
Preparing to unpack .../223-libnet-ssleay-perl_1.94-2_armhf.deb ...
Unpacking libnet-ssleay-perl:armhf (1.94-2) ...
Selecting previously unselected package libio-socket-ssl-perl.
Preparing to unpack .../224-libio-socket-ssl-perl_2.089-1_all.deb ...
Unpacking libio-socket-ssl-perl (2.089-1) ...
Selecting previously unselected package libnet-http-perl.
Preparing to unpack .../225-libnet-http-perl_6.23-1_all.deb ...
Unpacking libnet-http-perl (6.23-1) ...
Selecting previously unselected package liblwp-protocol-https-perl.
Preparing to unpack .../226-liblwp-protocol-https-perl_6.14-1_all.deb ...
Unpacking liblwp-protocol-https-perl (6.14-1) ...
Selecting previously unselected package libtry-tiny-perl.
Preparing to unpack .../227-libtry-tiny-perl_0.32-1_all.deb ...
Unpacking libtry-tiny-perl (0.32-1) ...
Selecting previously unselected package libwww-robotrules-perl.
Preparing to unpack .../228-libwww-robotrules-perl_6.02-1_all.deb ...
Unpacking libwww-robotrules-perl (6.02-1) ...
Selecting previously unselected package libwww-perl.
Preparing to unpack .../229-libwww-perl_6.77-1_all.deb ...
Unpacking libwww-perl (6.77-1) ...
Selecting previously unselected package patchutils.
Preparing to unpack .../230-patchutils_0.4.2-1_armhf.deb ...
Unpacking patchutils (0.4.2-1) ...
Selecting previously unselected package wdiff.
Preparing to unpack .../231-wdiff_1.2.2-6_armhf.deb ...
Unpacking wdiff (1.2.2-6) ...
Selecting previously unselected package devscripts.
Preparing to unpack .../232-devscripts_2.24.7_all.deb ...
Unpacking devscripts (2.24.7) ...
Selecting previously unselected package fastjar.
Preparing to unpack .../233-fastjar_2%3a0.98-7_armhf.deb ...
Unpacking fastjar (2:0.98-7) ...
Selecting previously unselected package ivy.
Preparing to unpack .../234-ivy_2.5.2-1_all.deb ...
Unpacking ivy (2.5.2-1) ...
Selecting previously unselected package libasm-java.
Preparing to unpack .../235-libasm-java_9.7.1-1_all.deb ...
Unpacking libasm-java (9.7.1-1) ...
Selecting previously unselected package libbsf-java.
Preparing to unpack .../236-libbsf-java_1%3a2.4.0-8_all.deb ...
Unpacking libbsf-java (1:2.4.0-8) ...
Selecting previously unselected package libcommons-cli-java.
Preparing to unpack .../237-libcommons-cli-java_1.6.0-1_all.deb ...
Unpacking libcommons-cli-java (1.6.0-1) ...
Selecting previously unselected package libapache-pom-java.
Preparing to unpack .../238-libapache-pom-java_33-2_all.deb ...
Unpacking libapache-pom-java (33-2) ...
Selecting previously unselected package libcommons-parent-java.
Preparing to unpack .../239-libcommons-parent-java_56-1_all.deb ...
Unpacking libcommons-parent-java (56-1) ...
Selecting previously unselected package libcommons-logging-java.
Preparing to unpack .../240-libcommons-logging-java_1.3.0-1_all.deb ...
Unpacking libcommons-logging-java (1.3.0-1) ...
Selecting previously unselected package libjansi-java.
Preparing to unpack .../241-libjansi-java_2.4.1-2_all.deb ...
Unpacking libjansi-java (2.4.1-2) ...
Selecting previously unselected package libjsp-api-java.
Preparing to unpack .../242-libjsp-api-java_2.3.4-3_all.deb ...
Unpacking libjsp-api-java (2.3.4-3) ...
Selecting previously unselected package libqdox-java.
Preparing to unpack .../243-libqdox-java_1.12.1-4_all.deb ...
Unpacking libqdox-java (1.12.1-4) ...
Selecting previously unselected package libservlet-api-java.
Preparing to unpack .../244-libservlet-api-java_4.0.1-2_all.deb ...
Unpacking libservlet-api-java (4.0.1-2) ...
Selecting previously unselected package libxpp3-java.
Preparing to unpack .../245-libxpp3-java_1.1.4c-3_all.deb ...
Unpacking libxpp3-java (1.1.4c-3) ...
Selecting previously unselected package libxstream-java.
Preparing to unpack .../246-libxstream-java_1.4.21-1_all.deb ...
Unpacking libxstream-java (1.4.21-1) ...
Selecting previously unselected package groovy.
Preparing to unpack .../247-groovy_2.4.21-10_all.deb ...
Unpacking groovy (2.4.21-10) ...
Selecting previously unselected package libatinject-jsr330-api-java.
Preparing to unpack .../248-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ...
Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ...
Selecting previously unselected package libcommons-collections3-java.
Preparing to unpack .../249-libcommons-collections3-java_3.2.2-3_all.deb ...
Unpacking libcommons-collections3-java (3.2.2-3) ...
Selecting previously unselected package libcommons-codec-java.
Preparing to unpack .../250-libcommons-codec-java_1.17.1-1_all.deb ...
Unpacking libcommons-codec-java (1.17.1-1) ...
Selecting previously unselected package libcommons-io-java.
Preparing to unpack .../251-libcommons-io-java_2.17.0-1_all.deb ...
Unpacking libcommons-io-java (2.17.0-1) ...
Selecting previously unselected package libcommons-compress-java.
Preparing to unpack .../252-libcommons-compress-java_1.27.1-2_all.deb ...
Unpacking libcommons-compress-java (1.27.1-2) ...
Selecting previously unselected package libcommons-lang-java.
Preparing to unpack .../253-libcommons-lang-java_2.6-10_all.deb ...
Unpacking libcommons-lang-java (2.6-10) ...
Selecting previously unselected package liberror-prone-java.
Preparing to unpack .../254-liberror-prone-java_2.18.0-1_all.deb ...
Unpacking liberror-prone-java (2.18.0-1) ...
Selecting previously unselected package libjsr305-java.
Preparing to unpack .../255-libjsr305-java_0.1~+svn49-11_all.deb ...
Unpacking libjsr305-java (0.1~+svn49-11) ...
Selecting previously unselected package libguava-java.
Preparing to unpack .../256-libguava-java_32.0.1-1_all.deb ...
Unpacking libguava-java (32.0.1-1) ...
Selecting previously unselected package libhttpcore-java.
Preparing to unpack .../257-libhttpcore-java_4.4.16-1_all.deb ...
Unpacking libhttpcore-java (4.4.16-1) ...
Selecting previously unselected package libhttpclient-java.
Preparing to unpack .../258-libhttpclient-java_4.5.14-1_all.deb ...
Unpacking libhttpclient-java (4.5.14-1) ...
Selecting previously unselected package libjarjar-java.
Preparing to unpack .../259-libjarjar-java_1.4+svn142-12_all.deb ...
Unpacking libjarjar-java (1.4+svn142-12) ...
Selecting previously unselected package libjcip-annotations-java.
Preparing to unpack .../260-libjcip-annotations-java_20060626-6_all.deb ...
Unpacking libjcip-annotations-java (20060626-6) ...
Selecting previously unselected package libjna-jni.
Preparing to unpack .../261-libjna-jni_5.15.0-1_armhf.deb ...
Unpacking libjna-jni (5.15.0-1) ...
Selecting previously unselected package libjna-java.
Preparing to unpack .../262-libjna-java_5.15.0-1_all.deb ...
Unpacking libjna-java (5.15.0-1) ...
Selecting previously unselected package libbcprov-java.
Preparing to unpack .../263-libbcprov-java_1.77-1_all.deb ...
Unpacking libbcprov-java (1.77-1) ...
Selecting previously unselected package libjunixsocket-jni.
Preparing to unpack .../264-libjunixsocket-jni_2.6.1-1_armhf.deb ...
Unpacking libjunixsocket-jni (2.6.1-1) ...
Selecting previously unselected package libeclipse-jdt-annotation-java.
Preparing to unpack .../265-libeclipse-jdt-annotation-java_2.2.700+eclipse4.29-2_all.deb ...
Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ...
Selecting previously unselected package libjunixsocket-java.
Preparing to unpack .../266-libjunixsocket-java_2.6.1-1_all.deb ...
Unpacking libjunixsocket-java (2.6.1-1) ...
Selecting previously unselected package libgoogle-gson-java.
Preparing to unpack .../267-libgoogle-gson-java_2.10.1-1_all.deb ...
Unpacking libgoogle-gson-java (2.10.1-1) ...
Selecting previously unselected package liblightcouch-java.
Preparing to unpack .../268-liblightcouch-java_0.2.0-1_all.deb ...
Unpacking liblightcouch-java (0.2.0-1) ...
Selecting previously unselected package libmongodb-java.
Preparing to unpack .../269-libmongodb-java_3.6.3-2_all.deb ...
Unpacking libmongodb-java (3.6.3-2) ...
Selecting previously unselected package liblog4j2-java.
Preparing to unpack .../270-liblog4j2-java_2.19.0-2_all.deb ...
Unpacking liblog4j2-java (2.19.0-2) ...
Selecting previously unselected package libjzlib-java.
Preparing to unpack .../271-libjzlib-java_1.1.3-3_all.deb ...
Unpacking libjzlib-java (1.1.3-3) ...
Selecting previously unselected package libjsch-java.
Preparing to unpack .../272-libjsch-java_0.2.19-1_all.deb ...
Unpacking libjsch-java (0.2.19-1) ...
Selecting previously unselected package libminlog-java.
Preparing to unpack .../273-libminlog-java_1.3.1-1_all.deb ...
Unpacking libminlog-java (1.3.1-1) ...
Selecting previously unselected package libobjenesis-java.
Preparing to unpack .../274-libobjenesis-java_3.3-3_all.deb ...
Unpacking libobjenesis-java (3.3-3) ...
Selecting previously unselected package libreflectasm-java.
Preparing to unpack .../275-libreflectasm-java_1.11.9+dfsg-4_all.deb ...
Unpacking libreflectasm-java (1.11.9+dfsg-4) ...
Selecting previously unselected package libkryo-java.
Preparing to unpack .../276-libkryo-java_2.20-7_all.deb ...
Unpacking libkryo-java (2.20-7) ...
Selecting previously unselected package liblogback-java.
Preparing to unpack .../277-liblogback-java_1%3a1.2.11-6_all.deb ...
Unpacking liblogback-java (1:1.2.11-6) ...
Selecting previously unselected package libnative-platform-jni.
Preparing to unpack .../278-libnative-platform-jni_0.14-6_armhf.deb ...
Unpacking libnative-platform-jni (0.14-6) ...
Selecting previously unselected package libnative-platform-java.
Preparing to unpack .../279-libnative-platform-java_0.14-6_all.deb ...
Unpacking libnative-platform-java (0.14-6) ...
Selecting previously unselected package libxml-commons-external-java.
Preparing to unpack .../280-libxml-commons-external-java_1.4.01-6_all.deb ...
Unpacking libxml-commons-external-java (1.4.01-6) ...
Selecting previously unselected package libxml-commons-resolver1.1-java.
Preparing to unpack .../281-libxml-commons-resolver1.1-java_1.2-11_all.deb ...
Unpacking libxml-commons-resolver1.1-java (1.2-11) ...
Selecting previously unselected package libxerces2-java.
Preparing to unpack .../282-libxerces2-java_2.12.2-1_all.deb ...
Unpacking libxerces2-java (2.12.2-1) ...
Selecting previously unselected package libnekohtml-java.
Preparing to unpack .../283-libnekohtml-java_1.9.22.noko2-0.1_all.deb ...
Unpacking libnekohtml-java (1.9.22.noko2-0.1) ...
Selecting previously unselected package libxbean-reflect-java.
Preparing to unpack .../284-libxbean-reflect-java_4.5-9_all.deb ...
Unpacking libxbean-reflect-java (4.5-9) ...
Selecting previously unselected package libgradle-core-java.
Preparing to unpack .../285-libgradle-core-java_4.4.1-20_all.deb ...
Unpacking libgradle-core-java (4.4.1-20) ...
Selecting previously unselected package libbcpg-java.
Preparing to unpack .../286-libbcpg-java_1.77-1_all.deb ...
Unpacking libbcpg-java (1.77-1) ...
Selecting previously unselected package libbsh-java.
Preparing to unpack .../287-libbsh-java_2.0b4-20_all.deb ...
Unpacking libbsh-java (2.0b4-20) ...
Selecting previously unselected package libdd-plist-java.
Preparing to unpack .../288-libdd-plist-java_1.20-1.1_all.deb ...
Unpacking libdd-plist-java (1.20-1.1) ...
Selecting previously unselected package libjaxen-java.
Preparing to unpack .../289-libjaxen-java_1.1.6-5_all.deb ...
Unpacking libjaxen-java (1.1.6-5) ...
Selecting previously unselected package libdom4j-java.
Preparing to unpack .../290-libdom4j-java_2.1.4-1_all.deb ...
Unpacking libdom4j-java (2.1.4-1) ...
Selecting previously unselected package libcommons-lang3-java.
Preparing to unpack .../291-libcommons-lang3-java_3.17.0-1_all.deb ...
Unpacking libcommons-lang3-java (3.17.0-1) ...
Selecting previously unselected package libbcel-java.
Preparing to unpack .../292-libbcel-java_6.10.0-1_all.deb ...
Unpacking libbcel-java (6.10.0-1) ...
Selecting previously unselected package libjformatstring-java.
Preparing to unpack .../293-libjformatstring-java_0.10~20131207-2.1_all.deb ...
Unpacking libjformatstring-java (0.10~20131207-2.1) ...
Selecting previously unselected package libfindbugs-java.
Preparing to unpack .../294-libfindbugs-java_3.1.0~preview2-4_all.deb ...
Unpacking libfindbugs-java (3.1.0~preview2-4) ...
Selecting previously unselected package libaopalliance-java.
Preparing to unpack .../295-libaopalliance-java_20070526-7_all.deb ...
Unpacking libaopalliance-java (20070526-7) ...
Selecting previously unselected package libguice-java.
Preparing to unpack .../296-libguice-java_4.2.3-2_all.deb ...
Unpacking libguice-java (4.2.3-2) ...
Selecting previously unselected package libjatl-java.
Preparing to unpack .../297-libjatl-java_0.2.3-1.1_all.deb ...
Unpacking libjatl-java (0.2.3-1.1) ...
Selecting previously unselected package libjcifs-java.
Preparing to unpack .../298-libjcifs-java_1.3.19-2_all.deb ...
Unpacking libjcifs-java (1.3.19-2) ...
Selecting previously unselected package libjavaewah-java.
Preparing to unpack .../299-libjavaewah-java_1.2.3-1_all.deb ...
Unpacking libjavaewah-java (1.2.3-1) ...
Selecting previously unselected package libel-api-java.
Preparing to unpack .../300-libel-api-java_3.0.0-3_all.deb ...
Unpacking libel-api-java (3.0.0-3) ...
Selecting previously unselected package libwebsocket-api-java.
Preparing to unpack .../301-libwebsocket-api-java_1.1-2_all.deb ...
Unpacking libwebsocket-api-java (1.1-2) ...
Selecting previously unselected package libjetty9-java.
Preparing to unpack .../302-libjetty9-java_9.4.56-1_all.deb ...
Unpacking libjetty9-java (9.4.56-1) ...
Selecting previously unselected package libjgit-java.
Preparing to unpack .../303-libjgit-java_6.7.0-2_all.deb ...
Unpacking libjgit-java (6.7.0-2) ...
Selecting previously unselected package libjs-jquery.
Preparing to unpack .../304-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ...
Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
Selecting previously unselected package libplexus-utils2-java.
Preparing to unpack .../305-libplexus-utils2-java_3.4.2-1_all.deb ...
Unpacking libplexus-utils2-java (3.4.2-1) ...
Selecting previously unselected package libwagon-provider-api-java.
Preparing to unpack .../306-libwagon-provider-api-java_3.5.3-1_all.deb ...
Unpacking libwagon-provider-api-java (3.5.3-1) ...
Selecting previously unselected package libmaven-resolver-java.
Preparing to unpack .../307-libmaven-resolver-java_1.6.3-1_all.deb ...
Unpacking libmaven-resolver-java (1.6.3-1) ...
Selecting previously unselected package libgeronimo-annotation-1.3-spec-java.
Preparing to unpack .../308-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ...
Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ...
Selecting previously unselected package libmaven-parent-java.
Preparing to unpack .../309-libmaven-parent-java_43-2_all.deb ...
Unpacking libmaven-parent-java (43-2) ...
Selecting previously unselected package libmaven-resolver-1.6-java.
Preparing to unpack .../310-libmaven-resolver-1.6-java_1.6.3-3_all.deb ...
Unpacking libmaven-resolver-1.6-java (1.6.3-3) ...
Selecting previously unselected package libmaven-shared-utils-java.
Preparing to unpack .../311-libmaven-shared-utils-java_3.4.2-1_all.deb ...
Unpacking libmaven-shared-utils-java (3.4.2-1) ...
Selecting previously unselected package libplexus-cipher-java.
Preparing to unpack .../312-libplexus-cipher-java_2.0-1_all.deb ...
Unpacking libplexus-cipher-java (2.0-1) ...
Selecting previously unselected package libplexus-classworlds-java.
Preparing to unpack .../313-libplexus-classworlds-java_2.7.0-1_all.deb ...
Unpacking libplexus-classworlds-java (2.7.0-1) ...
Selecting previously unselected package libplexus-component-annotations-java.
Preparing to unpack .../314-libplexus-component-annotations-java_2.1.1-1_all.deb ...
Unpacking libplexus-component-annotations-java (2.1.1-1) ...
Selecting previously unselected package libplexus-interpolation-java.
Preparing to unpack .../315-libplexus-interpolation-java_1.27-1_all.deb ...
Unpacking libplexus-interpolation-java (1.27-1) ...
Selecting previously unselected package libplexus-sec-dispatcher-java.
Preparing to unpack .../316-libplexus-sec-dispatcher-java_2.0-3_all.deb ...
Unpacking libplexus-sec-dispatcher-java (2.0-3) ...
Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java.
Preparing to unpack .../317-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ...
Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ...
Selecting previously unselected package libcdi-api-java.
Preparing to unpack .../318-libcdi-api-java_1.2-4_all.deb ...
Unpacking libcdi-api-java (1.2-4) ...
Selecting previously unselected package libsisu-inject-java.
Preparing to unpack .../319-libsisu-inject-java_0.3.4-2_all.deb ...
Unpacking libsisu-inject-java (0.3.4-2) ...
Selecting previously unselected package libsisu-plexus-java.
Preparing to unpack .../320-libsisu-plexus-java_0.3.4-3_all.deb ...
Unpacking libsisu-plexus-java (0.3.4-3) ...
Selecting previously unselected package libmaven3-core-java.
Preparing to unpack .../321-libmaven3-core-java_3.8.8-2_all.deb ...
Unpacking libmaven3-core-java (3.8.8-2) ...
Selecting previously unselected package libplexus-container-default-java.
Preparing to unpack .../322-libplexus-container-default-java_2.1.1-1_all.deb ...
Unpacking libplexus-container-default-java (2.1.1-1) ...
Selecting previously unselected package libpolyglot-maven-java.
Preparing to unpack .../323-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ...
Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ...
Selecting previously unselected package librhino-java.
Preparing to unpack .../324-librhino-java_1.7.15-1_all.deb ...
Unpacking librhino-java (1.7.15-1) ...
Selecting previously unselected package libsimple-http-java.
Preparing to unpack .../325-libsimple-http-java_4.1.21-1.1_all.deb ...
Unpacking libsimple-http-java (4.1.21-1.1) ...
Selecting previously unselected package libwagon-file-java.
Preparing to unpack .../326-libwagon-file-java_3.5.3-1_all.deb ...
Unpacking libwagon-file-java (3.5.3-1) ...
Selecting previously unselected package libjsoup-java.
Preparing to unpack .../327-libjsoup-java_1.15.3-1_all.deb ...
Unpacking libjsoup-java (1.15.3-1) ...
Selecting previously unselected package libwagon-http-java.
Preparing to unpack .../328-libwagon-http-java_3.5.3-1_all.deb ...
Unpacking libwagon-http-java (3.5.3-1) ...
Selecting previously unselected package libjcommander-java.
Preparing to unpack .../329-libjcommander-java_1.71-4_all.deb ...
Unpacking libjcommander-java (1.71-4) ...
Selecting previously unselected package testng.
Preparing to unpack .../330-testng_6.9.12-4_all.deb ...
Unpacking testng (6.9.12-4) ...
Selecting previously unselected package libgradle-plugins-java.
Preparing to unpack .../331-libgradle-plugins-java_4.4.1-20_all.deb ...
Unpacking libgradle-plugins-java (4.4.1-20) ...
Selecting previously unselected package gradle.
Preparing to unpack .../332-gradle_4.4.1-20_all.deb ...
Unpacking gradle (4.4.1-20) ...
Selecting previously unselected package maven-repo-helper.
Preparing to unpack .../333-maven-repo-helper_1.11_all.deb ...
Unpacking maven-repo-helper (1.11) ...
Selecting previously unselected package gradle-debian-helper.
Preparing to unpack .../334-gradle-debian-helper_2.4_all.deb ...
Unpacking gradle-debian-helper (2.4) ...
Selecting previously unselected package jarwrapper.
Preparing to unpack .../335-jarwrapper_0.80_all.deb ...
Unpacking jarwrapper (0.80) ...
Selecting previously unselected package javahelper.
Preparing to unpack .../336-javahelper_0.80_all.deb ...
Unpacking javahelper (0.80) ...
Selecting previously unselected package libbyte-buddy-java.
Preparing to unpack .../337-libbyte-buddy-java_1.14.19-1_all.deb ...
Unpacking libbyte-buddy-java (1.14.19-1) ...
Selecting previously unselected package libcommons-math3-java.
Preparing to unpack .../338-libcommons-math3-java_3.6.1-3_all.deb ...
Unpacking libcommons-math3-java (3.6.1-3) ...
Selecting previously unselected package libjackson2-annotations-java.
Preparing to unpack .../339-libjackson2-annotations-java_2.14.0-1_all.deb ...
Unpacking libjackson2-annotations-java (2.14.0-1) ...
Selecting previously unselected package libjackson2-core-java.
Preparing to unpack .../340-libjackson2-core-java_2.14.1-1_all.deb ...
Unpacking libjackson2-core-java (2.14.1-1) ...
Selecting previously unselected package libjackson2-databind-java.
Preparing to unpack .../341-libjackson2-databind-java_2.14.0-1_all.deb ...
Unpacking libjackson2-databind-java (2.14.0-1) ...
Selecting previously unselected package liblz4-jni.
Preparing to unpack .../342-liblz4-jni_1.8.0-4_armhf.deb ...
Unpacking liblz4-jni (1.8.0-4) ...
Selecting previously unselected package liblz4-java.
Preparing to unpack .../343-liblz4-java_1.8.0-4_all.deb ...
Unpacking liblz4-java (1.8.0-4) ...
Selecting previously unselected package libmockito-java.
Preparing to unpack .../344-libmockito-java_3.3.0-2_all.deb ...
Unpacking libmockito-java (3.3.0-2) ...
Selecting previously unselected package libredberry-pipe-java.
Preparing to unpack .../345-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ...
Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ...
Selecting previously unselected package libtrove3-java.
Preparing to unpack .../346-libtrove3-java_3.0.3-5_all.deb ...
Unpacking libtrove3-java (3.0.3-5) ...
Setting up libjcifs-java (1.3.19-2) ...
Setting up libbcprov-java (1.77-1) ...
Setting up libksba8:armhf (1.6.7-2+b1) ...
Setting up media-types (10.1.0) ...
Setting up libpipeline1:armhf (1.5.8-1) ...
Setting up fastjar (2:0.98-7) ...
Setting up libgraphite2-3:armhf (1.3.14-2+b1) ...
Setting up liblcms2-2:armhf (2.16-2) ...
Setting up libpixman-1-0:armhf (0.44.0-3) ...
Setting up libjcommander-java (1.71-4) ...
Setting up libjackson2-annotations-java (2.14.0-1) ...
Setting up wdiff (1.2.2-6) ...
Setting up libsharpyuv0:armhf (1.4.0-0.1+b1) ...
Setting up libwayland-server0:armhf (1.23.0-1+b1) ...
Setting up libslf4j-java (1.7.32-1) ...
Setting up libfile-which-perl (1.27-2) ...
Setting up systemd-sysv (257-2) ...
Setting up libxau6:armhf (1:1.0.11-1) ...
Setting up libxdmcp6:armhf (1:1.1.5-1) ...
Setting up libplexus-utils2-java (3.4.2-1) ...
Setting up libnpth0t64:armhf (1.8-2) ...
Setting up libredberry-pipe-java (1.0.0~alpha0-3) ...
Setting up libkeyutils1:armhf (1.6.3-4) ...
Setting up libplexus-classworlds-java (2.7.0-1) ...
Setting up libxcb1:armhf (1.17.0-2+b1) ...
Setting up libqdox-java (1.12.1-4) ...
Setting up libicu72:armhf (72.1-5+b1) ...
Setting up libxcb-xfixes0:armhf (1.17.0-2+b1) ...
Setting up liblerc4:armhf (4.0.0+ds-5) ...
Setting up libjsr305-java (0.1~+svn49-11) ...
Setting up libsimple-http-java (4.1.21-1.1) ...
Setting up bsdextrautils (2.40.2-12) ...
Setting up hicolor-icon-theme (0.18-1) ...
Setting up java-common (0.76) ...
Setting up libdynaloader-functions-perl (0.004-1) ...
Setting up libdatrie1:armhf (0.2.13-3+b1) ...
Setting up libjcip-annotations-java (20060626-6) ...
Setting up libobjenesis-java (3.3-3) ...
Setting up libclass-method-modifiers-perl (2.15-1) ...
Setting up libaopalliance-java (20070526-7) ...
Setting up libcommons-cli-java (1.6.0-1) ...
Setting up libio-pty-perl (1:1.20-1+b2) ...
Setting up libmagic-mgc (1:5.45-3+b1) ...
Setting up libxcb-render0:armhf (1.17.0-2+b1) ...
Setting up liblogback-java (1:1.2.11-6) ...
Setting up libclone-perl:armhf (0.47-1+b1) ...
Setting up libminlog-java (1.3.1-1) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libglvnd0:armhf (1.7.0-1+b2) ...
Setting up libgoogle-gson-java (2.10.1-1) ...
Setting up libtirpc-common (1.3.4+ds-1.3) ...
Setting up libhtml-tagset-perl (3.24-1) ...
Setting up libxcb-glx0:armhf (1.17.0-2+b1) ...
Setting up unzip (6.0-28) ...
Setting up libdebhelper-perl (13.21) ...
Setting up libbrotli1:armhf (1.1.0-2+b6) ...
Setting up libedit2:armhf (3.1-20240808-1) ...
Setting up liblwp-mediatypes-perl (6.04-2) ...
Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ...
Setting up libmagic1t64:armhf (1:5.45-3+b1) ...
Setting up libasm-java (9.7.1-1) ...
Setting up x11-common (1:7.7+23.1) ...
Running in chroot, ignoring request.

Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix.
Setting up libtry-tiny-perl (0.32-1) ...
Setting up libsensors-config (1:3.6.0-10) ...
Setting up libdeflate0:armhf (1.22-1) ...
Setting up perl-openssl-defaults:armhf (7+b2) ...
Setting up libdd-plist-java (1.20-1.1) ...
Setting up gettext-base (0.22.5-3) ...
Setting up m4 (1.4.19-4) ...
Setting up libel-api-java (3.0.0-3) ...
Setting up xkb-data (2.42-1) ...
Setting up libencode-locale-perl (1.05-3) ...
Setting up libplexus-component-annotations-java (2.1.1-1) ...
Setting up libxcb-shm0:armhf (1.17.0-2+b1) ...
Setting up libcom-err2:armhf (1.47.2~rc1-2) ...
Setting up file (1:5.45-3+b1) ...
Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ...
Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ...
Setting up libjzlib-java (1.1.3-3) ...
Setting up libjbig0:armhf (2.1-6.1+b2) ...
Setting up libelf1t64:armhf (0.192-4) ...
Setting up libkrb5support0:armhf (1.21.3-3) ...
Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-8) ...
Setting up tzdata (2024b-4) ...

Current default time zone: 'Etc/UTC'
Local time is now:      Tue Dec 17 15:27:06 UTC 2024.
Universal Time is now:  Tue Dec 17 15:27:06 UTC 2024.
Run 'dpkg-reconfigure tzdata' if you wish to change it.

Setting up libxcb-present0:armhf (1.17.0-2+b1) ...
Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ...
Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ...
Setting up libcommons-collections3-java (3.2.2-3) ...
Setting up libasound2-data (1.2.12-1) ...
Setting up libreflectasm-java (1.11.9+dfsg-4) ...
Setting up librhino-java (1.7.15-1) ...
Setting up autotools-dev (20220109.1) ...
Setting up libz3-4:armhf (4.13.3-1) ...
Setting up libglib2.0-0t64:armhf (2.82.4-1) ...
Setting up libbsf-java (1:2.4.0-8) ...
Setting up libosgi-annotation-java (8.1.0-1) ...
Setting up libjformatstring-java (0.10~20131207-2.1) ...
Setting up libasound2t64:armhf (1.2.12-1+b1) ...
Setting up libjavaewah-java (1.2.3-1) ...
Setting up libjpeg62-turbo:armhf (1:2.1.5-3+b1) ...
Setting up libjaxen-java (1.1.6-5) ...
Setting up libx11-data (2:1.8.10-2) ...
Setting up libepoxy0:armhf (1.5.10-2) ...
Setting up libnspr4:armhf (2:4.36-1) ...
Setting up gnupg-l10n (2.2.45-2) ...
Setting up libxcb-sync1:armhf (1.17.0-2+b1) ...
Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ...
Setting up libjansi-java (2.4.1-2) ...
Setting up libapache-pom-java (33-2) ...
Setting up libavahi-common-data:armhf (0.8-15) ...
Setting up libxpp3-java (1.1.4c-3) ...
Setting up libatinject-jsr330-api-java (1.0+ds1-5) ...
Setting up libdbus-1-3:armhf (1.16.0-1) ...
Setting up libwebsocket-api-java (1.1-2) ...
Setting up libfribidi0:armhf (1.0.16-1) ...
Setting up libproc2-0:armhf (2:4.0.4-6) ...
Setting up libplexus-interpolation-java (1.27-1) ...
Setting up fonts-dejavu-mono (2.37-8) ...
Setting up libpng16-16t64:armhf (1.6.44-3) ...
Setting up libxml-commons-resolver1.1-java (1.2-11) ...
Setting up libkryo-java (2.20-7) ...
Setting up libxz-java (1.9-1) ...
Setting up libio-html-perl (1.004-3) ...
Setting up libjna-jni (5.15.0-1) ...
Setting up autopoint (0.22.5-3) ...
Setting up binfmt-support (2.2.2-7) ...
Running in chroot, ignoring request.

invoke-rc.d: policy-rc.d denied execution of start.
Created symlink '/etc/systemd/system/multi-user.target.wants/binfmt-support.service' -> '/usr/lib/systemd/system/binfmt-support.service'.

Setting up libb-hooks-op-check-perl:armhf (0.22-3+b2) ...
Setting up libjunixsocket-jni (2.6.1-1) ...
Setting up fonts-dejavu-core (2.37-8) ...
Setting up libfelix-framework-java (4.6.1-2.1) ...
Setting up libipc-run-perl (20231003.0-2) ...
Setting up libpcsclite1:armhf (2.3.0-3) ...
Setting up libsensors5:armhf (1:3.6.0-10+b1) ...
Setting up libmongodb-java (3.6.3-2) ...
Setting up libk5crypto3:armhf (1.21.3-3) ...
Setting up libhamcrest-java (2.2-2) ...
Setting up libglapi-mesa:armhf (24.2.8-1) ...
Setting up libbsh-java (2.0b4-20) ...
Setting up libjsp-api-java (2.3.4-3) ...
Setting up libsasl2-2:armhf (2.1.28+dfsg1-8) ...
Setting up libvulkan1:armhf (1.3.296.0-1) ...
Setting up autoconf (2.72-3) ...
Setting up libwebp7:armhf (1.4.0-0.1+b1) ...
Setting up libtimedate-perl (2.3300-2) ...
Setting up libxcb-dri2-0:armhf (1.17.0-2+b1) ...
Setting up libgif7:armhf (5.2.2-1+b1) ...
Setting up libjarjar-java (1.4+svn142-12) ...
Setting up libtrove3-java (3.0.3-5) ...
Setting up dwz (0.15-1+b2) ...
Setting up sensible-utils (0.0.24) ...
Setting up libxshmfence1:armhf (1.3-1+b2) ...
Setting up libjsoup-java (1.15.3-1) ...
Setting up at-spi2-common (2.54.0-1) ...
Setting up libtiff6:armhf (4.5.1+git230720-5) ...
Setting up libxcb-randr0:armhf (1.17.0-2+b1) ...
Setting up dbus-session-bus-common (1.16.0-1) ...
Setting up libuchardet0:armhf (0.0.8-1+b2) ...
Setting up libassuan9:armhf (3.0.1-2) ...
Setting up libxml-commons-external-java (1.4.01-6) ...
Setting up procps (2:4.0.4-6) ...
Setting up libjna-java (5.15.0-1) ...
Setting up libxbean-reflect-java (4.5-9) ...
Setting up libservlet-api-java (4.0.1-2) ...
Setting up librole-tiny-perl (2.002004-1) ...
Setting up libjackson2-core-java (2.14.1-1) ...
Setting up libx11-6:armhf (2:1.8.10-2) ...
Setting up libthai-data (0.1.29-2) ...
Setting up netbase (6.4) ...
Setting up libcommons-math3-java (3.6.1-3) ...
Setting up libsub-quote-perl (2.006008-1) ...
Setting up libnative-platform-jni (0.14-6) ...
Setting up libclass-xsaccessor-perl (1.19-4+b4) ...
Setting up libkrb5-3:armhf (1.21.3-3) ...
Setting up liblz4-jni (1.8.0-4) ...
Setting up libwayland-egl1:armhf (1.23.0-1+b1) ...
Setting up libhttpcore-java (4.4.16-1) ...
Setting up libbcpg-java (1.77-1) ...
Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
Setting up libxerces2-java (2.12.2-1) ...
Setting up libfile-dirlist-perl (0.05-3) ...
Setting up dbus-system-bus-common (1.16.0-1) ...
useradd: Warning: missing or non-executable shell '/usr/sbin/nologin'
Setting up libfile-homedir-perl (1.006-2) ...
Setting up libantlr-java (2.7.7+dfsg-14) ...
Setting up libyaml-snake-java (1.33-2) ...
Setting up openssl (3.3.2-2) ...
Setting up libdrm-common (2.4.123-1) ...
Setting up libcdi-api-java (1.2-4) ...
Setting up libxcomposite1:armhf (1:0.4.6-1) ...
Setting up readline-common (8.2-6) ...
Setting up libhawtjni-runtime-java (1.18-1) ...
Setting up libxml2:armhf (2.12.7+dfsg+really2.9.14-0.2+b1) ...
Setting up liburi-perl (5.30-1) ...
Setting up dbus-bin (1.16.0-1) ...
Setting up libfile-touch-perl (0.12-2) ...
Setting up dctrl-tools (2.24-3) ...
Setting up libjatl-java (0.2.3-1.1) ...
Setting up libxkbcommon0:armhf (1.7.0-2) ...
Setting up libwayland-client0:armhf (1.23.0-1+b1) ...
Setting up libnet-ssleay-perl:armhf (1.94-2) ...
Setting up automake (1:1.16.5-1.3) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up pinentry-curses (1.2.1-4+b1) ...
Setting up libdom4j-java (2.1.4-1) ...
Setting up libfile-stripnondeterminism-perl (1.14.0-1) ...
Setting up libxcb-dri3-0:armhf (1.17.0-2+b1) ...
Setting up libwagon-provider-api-java (3.5.3-1) ...
Setting up libnative-platform-java (0.14-6) ...
Setting up libllvm19:armhf (1:19.1.5-1) ...
Setting up libosgi-core-java (8.0.0-2) ...
Setting up libx11-xcb1:armhf (2:1.8.10-2) ...
Setting up libhttp-date-perl (6.06-1) ...
Setting up libxstream-java (1.4.21-1) ...
Setting up libnekohtml-java (1.9.22.noko2-0.1) ...
Setting up liblz4-java (1.8.0-4) ...
Setting up gettext (0.22.5-3) ...
Setting up libjetty9-java (9.4.56-1) ...
Setting up libxdamage1:armhf (1:1.1.6-1+b2) ...
Setting up java-wrappers (0.5) ...
Setting up libatk1.0-0t64:armhf (2.54.0-1) ...
Setting up libfile-listing-perl (6.16-1) ...
Setting up libosgi-compendium-java (7.0.0-1) ...
Setting up libxrender1:armhf (1:0.9.10-1.1+b3) ...
Setting up jarwrapper (0.80) ...
Setting up libtool (2.4.7-8) ...
Setting up fontconfig-config (2.15.0-1.1+b1) ...
Setting up libmaven-parent-java (43-2) ...
Setting up libcommons-parent-java (56-1) ...
Setting up libavahi-common3:armhf (0.8-15) ...
Setting up libcloudproviders0:armhf (0.3.6-1+b1) ...
Setting up libcommons-logging-java (1.3.0-1) ...
Setting up libxext6:armhf (2:1.3.4-1+b2) ...
Setting up libnet-http-perl (6.23-1) ...
Setting up libsisu-inject-java (0.3.4-2) ...
Setting up libnss3:armhf (2:3.106-1) ...
Setting up dbus-daemon (1.16.0-1) ...
Setting up libdevel-callchecker-perl:armhf (0.009-1+b1) ...
Setting up libcommons-lang-java (2.6-10) ...
Setting up libjunixsocket-java (2.6.1-1) ...
Setting up libldap-2.5-0:armhf (2.5.18+dfsg-3+b1) ...
Setting up libcolord2:armhf (1.4.7-1+b2) ...
Setting up libjackson2-databind-java (2.14.0-1) ...
Setting up libplexus-cipher-java (2.0-1) ...
Setting up libxxf86vm1:armhf (1:1.1.4-1+b3) ...
Setting up intltool-debian (0.35.0+20060710.6) ...
Setting up libdconf1:armhf (0.40.0-4+b3) ...
Setting up dh-autoreconf (20) ...
Setting up patchutils (0.4.2-1) ...
Setting up libthai0:armhf (0.1.29-2+b1) ...
Setting up ca-certificates (20240203) ...
Updating certificates in /etc/ssl/certs...
146 added, 0 removed; done.
Setting up libsisu-plexus-java (0.3.4-3) ...
Setting up libfreetype6:armhf (2.13.3+dfsg-1) ...
Setting up libxfixes3:armhf (1:6.0.0-2+b3) ...
Setting up testng (6.9.12-4) ...
Setting up dbus (1.16.0-1) ...
Running in chroot, ignoring request.

invoke-rc.d: policy-rc.d denied execution of start.
Setting up shared-mime-info (2.4-5+b1) ...
Setting up libxinerama1:armhf (2:1.1.4-3+b3) ...
Setting up libgssapi-krb5-2:armhf (1.21.3-3) ...
Setting up libxrandr2:armhf (2:1.5.4-1+b2) ...
Setting up libcommons-lang3-java (3.17.0-1) ...
Setting up libreadline8t64:armhf (8.2-6) ...
Setting up dh-strip-nondeterminism (1.14.0-1) ...
Setting up libwww-robotrules-perl (6.02-1) ...
Setting up libfelix-resolver-java (1.16.0-1) ...
Setting up libdrm2:armhf (2.4.123-1) ...
Setting up libjansi-native-java (1.8-2) ...
Setting up groff-base (1.23.0-6) ...
Setting up libwayland-cursor0:armhf (1.23.0-1+b1) ...
Setting up libhtml-parser-perl:armhf (3.83-1+b1) ...
Setting up gpgconf (2.2.45-2) ...
Setting up libpam-systemd:armhf (257-2) ...
Setting up libjansi1-java (1.18-3) ...
Setting up libplexus-sec-dispatcher-java (2.0-3) ...
Setting up libharfbuzz0b:armhf (10.1.0-1) ...
Setting up libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1+b1) ...
Setting up libfontconfig1:armhf (2.15.0-1.1+b1) ...
Setting up ca-certificates-java (20240118) ...
No JRE found. Skipping Java certificates setup.
Setting up libwagon-file-java (3.5.3-1) ...
Setting up libcommons-codec-java (1.17.1-1) ...
Setting up libjline2-java (2.14.6-5) ...
Setting up libavahi-client3:armhf (0.8-15) ...
Setting up libio-socket-ssl-perl (2.089-1) ...
Setting up gpg (2.2.45-2) ...
Setting up libhttp-message-perl (7.00-2) ...
Setting up libdrm-amdgpu1:armhf (2.4.123-1) ...
Setting up gtk-update-icon-cache (4.16.7+ds-1) ...
Setting up libhttp-negotiate-perl (6.01-2) ...
Setting up fontconfig (2.15.0-1.1+b1) ...
Regenerating fonts cache... done.
Setting up gpg-agent (2.2.45-2) ...
Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-browser.socket' -> '/usr/lib/systemd/user/gpg-agent-browser.socket'.

Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-extra.socket' -> '/usr/lib/systemd/user/gpg-agent-extra.socket'.

Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-ssh.socket' -> '/usr/lib/systemd/user/gpg-agent-ssh.socket'.

Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent.socket' -> '/usr/lib/systemd/user/gpg-agent.socket'.

Setting up openjdk-21-jre-headless:armhf (21.0.5+11-1) ...
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode
Setting up libxi6:armhf (2:1.8.2-1) ...
Setting up libtirpc3t64:armhf (1.3.4+ds-1.3+b1) ...
Setting up libhttp-cookies-perl (6.11-1) ...
Setting up libcommons-io-java (2.17.0-1) ...
Setting up libdrm-radeon1:armhf (2.4.123-1) ...
Setting up libxtst6:armhf (2:1.2.3-1.1+b3) ...
Setting up po-debconf (1.0.21+nmu1) ...
Setting up libhtml-tree-perl (5.07-3) ...
Setting up libxcursor1:armhf (1:1.2.2-1+b1) ...
Setting up libparams-classify-perl:armhf (0.015-2+b4) ...
Setting up gpgsm (2.2.45-2) ...
Setting up libpango-1.0-0:armhf (1.55.0+ds-3) ...
Setting up man-db (2.13.0-1) ...
Not building database; man-db/auto-update is not 'true'.
Created symlink '/etc/systemd/system/timers.target.wants/man-db.timer' -> '/usr/lib/systemd/system/man-db.timer'.

Setting up libcairo2:armhf (1.18.2-2) ...
Setting up libmaven-resolver-1.6-java (1.6.3-3) ...
Setting up dirmngr (2.2.45-2) ...
Created symlink '/etc/systemd/user/sockets.target.wants/dirmngr.socket' -> '/usr/lib/systemd/user/dirmngr.socket'.

Setting up dbus-user-session (1.16.0-1) ...
Setting up libmaven-resolver-java (1.6.3-1) ...
Setting up libbcel-java (6.10.0-1) ...
Setting up adwaita-icon-theme (47.0-2) ...
update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode
Setting up libmodule-runtime-perl (0.016-2) ...
Setting up libatspi2.0-0t64:armhf (2.54.0-1) ...
Setting up libhttpclient-java (4.5.14-1) ...
Setting up libnsl2:armhf (1.3.0-3+b3) ...
Setting up gnupg (2.2.45-2) ...
Setting up liblightcouch-java (0.2.0-1) ...
Setting up libwagon-http-java (3.5.3-1) ...
Setting up libcairo-gobject2:armhf (1.18.2-2) ...
Setting up libmaven-shared-utils-java (3.4.2-1) ...
Setting up libpangoft2-1.0-0:armhf (1.55.0+ds-3) ...
Setting up libcups2t64:armhf (2.4.10-2) ...
Setting up libpangocairo-1.0-0:armhf (1.55.0+ds-3) ...
Setting up libatk-bridge2.0-0t64:armhf (2.54.0-1) ...
Setting up mesa-libgallium:armhf (24.2.8-1) ...
Setting up libfindbugs-java (3.1.0~preview2-4) ...
Setting up libpython3.12-stdlib:armhf (3.12.8-3) ...
Setting up libcommons-compress-java (1.27.1-2) ...
Setting up libgbm1:armhf (24.2.8-1) ...
Setting up libimport-into-perl (1.002005-2) ...
Setting up libmoo-perl (2.005005-1) ...
Setting up liblog4j2-java (2.19.0-2) ...
Setting up python3.12 (3.12.8-3) ...
Setting up libgl1-mesa-dri:armhf (24.2.8-1) ...
Setting up debhelper (13.21) ...
Setting up dconf-service (0.40.0-4+b3) ...
Setting up libjsch-java (0.2.19-1) ...
Setting up libpython3-stdlib:armhf (3.12.7-1) ...
Setting up libjgit-java (6.7.0-2) ...
Setting up libglx-mesa0:armhf (24.2.8-1) ...
Setting up libglx0:armhf (1.7.0-1+b2) ...
Setting up dconf-gsettings-backend:armhf (0.40.0-4+b3) ...
Setting up python3 (3.12.7-1) ...
Setting up libgl1:armhf (1.7.0-1+b2) ...
Setting up libgtk-3-common (3.24.43-4) ...
Setting up libgtk-3-0t64:armhf (3.24.43-4) ...
Setting up liberror-prone-java (2.18.0-1) ...
Setting up libwww-perl (6.77-1) ...
Setting up devscripts (2.24.7) ...
Setting up libguava-java (32.0.1-1) ...
Setting up javahelper (0.80) ...
Setting up libplexus-container-default-java (2.1.1-1) ...
Setting up liblwp-protocol-https-perl (6.14-1) ...
Setting up libguice-java (4.2.3-2) ...
Setting up libmaven3-core-java (3.8.8-2) ...
Setting up libbyte-buddy-java (1.14.19-1) ...
Setting up libmockito-java (3.3.0-2) ...
Processing triggers for libc-bin (2.40-4) ...
Processing triggers for systemd (257-2) ...
Processing triggers for ca-certificates-java (20240118) ...
Adding debian:ACCVRAIZ1.pem
Adding debian:AC_RAIZ_FNMT-RCM.pem
Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem
Adding debian:ANF_Secure_Server_Root_CA.pem
Adding debian:Actalis_Authentication_Root_CA.pem
Adding debian:AffirmTrust_Commercial.pem
Adding debian:AffirmTrust_Networking.pem
Adding debian:AffirmTrust_Premium.pem
Adding debian:AffirmTrust_Premium_ECC.pem
Adding debian:Amazon_Root_CA_1.pem
Adding debian:Amazon_Root_CA_2.pem
Adding debian:Amazon_Root_CA_3.pem
Adding debian:Amazon_Root_CA_4.pem
Adding debian:Atos_TrustedRoot_2011.pem
Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem
Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem
Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem
Adding debian:BJCA_Global_Root_CA1.pem
Adding debian:BJCA_Global_Root_CA2.pem
Adding debian:Baltimore_CyberTrust_Root.pem
Adding debian:Buypass_Class_2_Root_CA.pem
Adding debian:Buypass_Class_3_Root_CA.pem
Adding debian:CA_Disig_Root_R2.pem
Adding debian:CFCA_EV_ROOT.pem
Adding debian:COMODO_Certification_Authority.pem
Adding debian:COMODO_ECC_Certification_Authority.pem
Adding debian:COMODO_RSA_Certification_Authority.pem
Adding debian:Certainly_Root_E1.pem
Adding debian:Certainly_Root_R1.pem
Adding debian:Certigna.pem
Adding debian:Certigna_Root_CA.pem
Adding debian:Certum_EC-384_CA.pem
Adding debian:Certum_Trusted_Network_CA.pem
Adding debian:Certum_Trusted_Network_CA_2.pem
Adding debian:Certum_Trusted_Root_CA.pem
Adding debian:CommScope_Public_Trust_ECC_Root-01.pem
Adding debian:CommScope_Public_Trust_ECC_Root-02.pem
Adding debian:CommScope_Public_Trust_RSA_Root-01.pem
Adding debian:CommScope_Public_Trust_RSA_Root-02.pem
Adding debian:Comodo_AAA_Services_root.pem
Adding debian:D-TRUST_BR_Root_CA_1_2020.pem
Adding debian:D-TRUST_EV_Root_CA_1_2020.pem
Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem
Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem
Adding debian:DigiCert_Assured_ID_Root_CA.pem
Adding debian:DigiCert_Assured_ID_Root_G2.pem
Adding debian:DigiCert_Assured_ID_Root_G3.pem
Adding debian:DigiCert_Global_Root_CA.pem
Adding debian:DigiCert_Global_Root_G2.pem
Adding debian:DigiCert_Global_Root_G3.pem
Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem
Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem
Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem
Adding debian:DigiCert_Trusted_Root_G4.pem
Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem
Adding debian:Entrust_Root_Certification_Authority.pem
Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem
Adding debian:Entrust_Root_Certification_Authority_-_G2.pem
Adding debian:Entrust_Root_Certification_Authority_-_G4.pem
Adding debian:GDCA_TrustAUTH_R5_ROOT.pem
Adding debian:GLOBALTRUST_2020.pem
Adding debian:GTS_Root_R1.pem
Adding debian:GTS_Root_R2.pem
Adding debian:GTS_Root_R3.pem
Adding debian:GTS_Root_R4.pem
Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem
Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem
Adding debian:GlobalSign_Root_CA.pem
Adding debian:GlobalSign_Root_CA_-_R3.pem
Adding debian:GlobalSign_Root_CA_-_R6.pem
Adding debian:GlobalSign_Root_E46.pem
Adding debian:GlobalSign_Root_R46.pem
Adding debian:Go_Daddy_Class_2_CA.pem
Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem
Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem
Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem
Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem
Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem
Adding debian:HiPKI_Root_CA_-_G1.pem
Adding debian:Hongkong_Post_Root_CA_3.pem
Adding debian:ISRG_Root_X1.pem
Adding debian:ISRG_Root_X2.pem
Adding debian:IdenTrust_Commercial_Root_CA_1.pem
Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem
Adding debian:Izenpe.com.pem
Adding debian:Microsec_e-Szigno_Root_CA_2009.pem
Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem
Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem
Adding debian:NAVER_Global_Root_Certification_Authority.pem
Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem
Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem
Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem
Adding debian:QuoVadis_Root_CA_1_G3.pem
Adding debian:QuoVadis_Root_CA_2.pem
Adding debian:QuoVadis_Root_CA_2_G3.pem
Adding debian:QuoVadis_Root_CA_3.pem
Adding debian:QuoVadis_Root_CA_3_G3.pem
Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem
Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem
Adding debian:SSL.com_Root_Certification_Authority_ECC.pem
Adding debian:SSL.com_Root_Certification_Authority_RSA.pem
Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem
Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem
Adding debian:SZAFIR_ROOT_CA2.pem
Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem
Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem
Adding debian:SecureSign_RootCA11.pem
Adding debian:SecureTrust_CA.pem
Adding debian:Secure_Global_CA.pem
Adding debian:Security_Communication_ECC_RootCA1.pem
Adding debian:Security_Communication_RootCA2.pem
Adding debian:Security_Communication_RootCA3.pem
Adding debian:Security_Communication_Root_CA.pem
Adding debian:Starfield_Class_2_CA.pem
Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem
Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem
Adding debian:SwissSign_Gold_CA_-_G2.pem
Adding debian:SwissSign_Silver_CA_-_G2.pem
Adding debian:T-TeleSec_GlobalRoot_Class_2.pem
Adding debian:T-TeleSec_GlobalRoot_Class_3.pem
Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem
Adding debian:TWCA_Global_Root_CA.pem
Adding debian:TWCA_Root_Certification_Authority.pem
Adding debian:TeliaSonera_Root_CA_v1.pem
Adding debian:Telia_Root_CA_v2.pem
Adding debian:TrustAsia_Global_Root_CA_G3.pem
Adding debian:TrustAsia_Global_Root_CA_G4.pem
Adding debian:Trustwave_Global_Certification_Authority.pem
Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem
Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem
Adding debian:TunTrust_Root_CA.pem
Adding debian:UCA_Extended_Validation_Root.pem
Adding debian:UCA_Global_G2_Root.pem
Adding debian:USERTrust_ECC_Certification_Authority.pem
Adding debian:USERTrust_RSA_Certification_Authority.pem
Adding debian:XRamp_Global_CA_Root.pem
Adding debian:certSIGN_ROOT_CA.pem
Adding debian:certSIGN_Root_CA_G2.pem
Adding debian:e-Szigno_Root_CA_2017.pem
Adding debian:ePKI_Root_Certification_Authority.pem
Adding debian:emSign_ECC_Root_CA_-_C3.pem
Adding debian:emSign_ECC_Root_CA_-_G3.pem
Adding debian:emSign_Root_CA_-_C1.pem
Adding debian:emSign_Root_CA_-_G1.pem
Adding debian:vTrus_ECC_Root_CA.pem
Adding debian:vTrus_Root_CA.pem
done.
Setting up antlr (2.7.7+dfsg-14) ...
Setting up openjdk-21-jre:armhf (21.0.5+11-1) ...
Setting up ivy (2.5.2-1) ...
Setting up ant (1.10.15-1) ...
Setting up junit4 (4.13.2-5) ...
Setting up groovy (2.4.21-10) ...
update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode
update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode
update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode
update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode
Setting up openjdk-21-jdk-headless:armhf (21.0.5+11-1) ...
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode
Setting up default-jre-headless (2:1.21-76) ...
Setting up maven-repo-helper (1.11) ...
Setting up default-jre (2:1.21-76) ...
Setting up ant-optional (1.10.15-1) ...
Setting up openjdk-21-jdk:armhf (21.0.5+11-1) ...
update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode
Setting up bnd (5.0.1-5) ...
Setting up default-jdk-headless (2:1.21-76) ...
Setting up libgradle-core-java (4.4.1-20) ...
Setting up libgradle-plugins-java (4.4.1-20) ...
Setting up gradle (4.4.1-20) ...
Setting up default-jdk (2:1.21-76) ...
Setting up gradle-debian-helper (2.4) ...
Processing triggers for ca-certificates (20240203) ...
Updating certificates in /etc/ssl/certs...
0 added, 0 removed; done.
Running hooks in /etc/ca-certificates/update.d...
done.
Processing triggers for ca-certificates-java (20240118) ...
done.
Reading package lists...
Building dependency tree...
Reading state information...
Reading extended state information...
Initializing package states...
Writing extended state information...
Building tag database...
 -> Finished parsing the build-deps
I: Building the package
I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S  > ../milib_2.2.0+dfsg-1_source.changes
dpkg-buildpackage: info: source package milib
dpkg-buildpackage: info: source version 2.2.0+dfsg-1
dpkg-buildpackage: info: source distribution unstable
dpkg-buildpackage: info: source changed by Pierre Gruet <pgt@debian.org>
 dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
 debian/rules clean
dh clean --with javahelper --with maven_repo_helper
   debian/rules override_dh_auto_clean
make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg'
dh_auto_clean
# Clearing the build.gradle file we provide
rm build.gradle
rm: cannot remove 'build.gradle': No such file or directory
make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored)
make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg'
   jh_clean
Duplicate specification "u=s" for option "u"
   dh_clean
 debian/rules binary
dh binary --with javahelper --with maven_repo_helper
   dh_update_autotools_config
   dh_autoreconf
   debian/rules override_dh_auto_configure
make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg'
# Adding the upstream version number (without +dfsg) to the build.gradle file
# we got by patching build.gradle.kts
sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle
dh_auto_configure
make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg'
   jh_linkjars
   dh_auto_build
	mkdir -p .gradle/init.d
	cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/
	gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 jar
openjdk version "21.0.5" 2024-10-15
OpenJDK Runtime Environment (build 21.0.5+11-Debian-1)
OpenJDK Server VM (build 21.0.5+11-Debian-1, mixed mode, sharing)
Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native
To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html.
Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1
Successfully started process 'Gradle build daemon'
An attempt to start the daemon took 2.535 secs.
The client will now receive all logging from the daemon (pid: 26636). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-26636.out.log
Daemon will be stopped at the end of the build stopping after processing
Closing daemon's stdin at end of input.
The daemon will no longer process any standard input.
Using 3 worker leases.
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@429bbb
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@429bbb
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@17bc1e0
Starting Build
Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer.
Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@a070a7
Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer.
Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'.
	Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle)
	Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg'
Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
Included projects: [root project 'milib']
	Keep-alive timer started
	Adding Debian repository to project 'milib'
Parallel execution is an incubating feature.
Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer.
Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer.
	Adding Maven pom generation to project 'milib'
	Linking the generated javadoc to the system JDK API documentation
All projects evaluated.
Selected primary task 'jar' from project :
Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@36344e
Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar']
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@17bc1e0
Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@3aac4b
Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1d4996d
:compileJava (Thread[#41,Task worker for ':',5,main]) started.
:compileJava
Putting task artifact state for task ':compileJava' into context took 0.017 secs.
Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@578edc
	Loading the Maven rules...
	Replacing org.apache.commons:commons-math3:jar:3.6.1  ->  org.apache.commons:commons-math3:jar:debian
	Replacing cc.redberry:pipe:jar:1.3.0  ->  cc.redberry:pipe:jar:1.0.0-alpha0
	Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0  ->  com.fasterxml.jackson:jackson-bom:jar:debian
	Passing through com.fasterxml.jackson:jackson-parent:jar:debian
	Passing through com.fasterxml:oss-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x
	Passing through com.fasterxml.jackson:jackson-base:jar:debian
	Passing through com.fasterxml.jackson:jackson-bom:jar:debian
	Replacing org.apache.commons:commons-compress:jar:1.21  ->  org.apache.commons:commons-compress:jar:debian
	Passing through org.apache.commons:commons-parent:jar:debian
	Passing through org.apache:apache:jar:debian
	Replacing commons-io:commons-io:jar:2.11.0  ->  commons-io:commons-io:jar:debian
	Replacing org.lz4:lz4-java:jar:1.8.0  ->  org.lz4:lz4-java:jar:debian
	Replacing com.beust:jcommander:jar:1.72  ->  com.beust:jcommander:jar:debian
	Replacing net.sf.trove4j:trove4j:jar:3.0.3  ->  net.sf.trove4j:trove4j:jar:debian
	Replacing com.google.guava:guava:jar:31.1-jre  ->  com.google.guava:guava:jar:debian
	Passing through com.google.guava:guava-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x
	Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x
	Passing through commons-codec:commons-codec:jar:debian
	Passing through org.jsr-305:jsr305:jar:0.x
	Passing through com.google.errorprone:error_prone_annotations:jar:debian
	Passing through com.google.errorprone:error_prone_parent:jar:debian
Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath.
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93)
	at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76)
	at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77)
	at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234)
	at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185)
	at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53)
	at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114)
	at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201)
	at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86)
	at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53)
	at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54)
	at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60)
	at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97)
	at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87)
	at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52)
	at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52)
	at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54)
	at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43)
	at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34)
	at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110)
	at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241)
	at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98)
	at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626)
	at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98)
	at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63)
	at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46)
	at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1144)
	at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:642)
	at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55)
	at java.base/java.lang.Thread.run(Thread.java:1583)
Up-to-date check for task ':compileJava' took 7.08 secs. It is not up-to-date because:
  No history is available.
All input files are considered out-of-date for incremental task ':compileJava'.
Compiling with JDK Java compiler API.
warning: [options] source value 8 is obsolete and will be removed in a future release
warning: [options] target value 8 is obsolete and will be removed in a future release
warning: [options] To suppress warnings about obsolete options, use -Xlint:-options.
/build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:108: warning: [removal] finalize() in Object has been deprecated and marked for removal
    protected void finalize() throws Throwable {
                   ^
/build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:116: warning: [removal] finalize() in Object has been deprecated and marked for removal
        super.finalize();
             ^
/build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1279: warning: [removal] finalize() in Object has been deprecated and marked for removal
    protected void finalize() throws Throwable {
                   ^
/build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1280: warning: [removal] finalize() in Object has been deprecated and marked for removal
        super.finalize();
             ^
Note: Some input files use or override a deprecated API.
Note: Recompile with -Xlint:deprecation for details.
Note: Some input files use unchecked or unsafe operations.
Note: Recompile with -Xlint:unchecked for details.
7 warnings
:compileJava (Thread[#41,Task worker for ':',5,main]) completed. Took 24.305 secs.
:processResources (Thread[#41,Task worker for ':',5,main]) started.
:processResources
Putting task artifact state for task ':processResources' into context took 0.0 secs.
Up-to-date check for task ':processResources' took 0.018 secs. It is not up-to-date because:
  No history is available.
:processResources (Thread[#41,Task worker for ':',5,main]) completed. Took 0.09 secs.
:classes (Thread[#41,Task worker for ':',5,main]) started.
:classes
Skipping task ':classes' as it has no actions.
:classes (Thread[#41,Task worker for ':',5,main]) completed. Took 0.002 secs.
:debianMavenPom (Thread[#41,Task worker for ':',5,main]) started.
:debianMavenPom
Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs.
Up-to-date check for task ':debianMavenPom' took 0.005 secs. It is not up-to-date because:
  No history is available.
	Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom
:debianMavenPom (Thread[#41,Task worker for ':',5,main]) completed. Took 0.225 secs.
:jar (Thread[#41,Task worker for ':',5,main]) started.
:jar
Putting task artifact state for task ':jar' into context took 0.0 secs.
Up-to-date check for task ':jar' took 0.091 secs. It is not up-to-date because:
  No history is available.
:jar (Thread[#41,Task worker for ':',5,main]) completed. Took 0.821 secs.

BUILD SUCCESSFUL in 39s
4 actionable tasks: 4 executed
   dh_auto_test
	mkdir -p .gradle/init.d
	cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/
	gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 test
openjdk version "21.0.5" 2024-10-15
OpenJDK Runtime Environment (build 21.0.5+11-Debian-1)
OpenJDK Server VM (build 21.0.5+11-Debian-1, mixed mode, sharing)
Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native
To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html.
Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1
Successfully started process 'Gradle build daemon'
An attempt to start the daemon took 2.997 secs.
The client will now receive all logging from the daemon (pid: 26817). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-26817.out.log
Daemon will be stopped at the end of the build stopping after processing
Closing daemon's stdin at end of input.
The daemon will no longer process any standard input.
Using 3 worker leases.
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@5aab5a
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@5aab5a
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@8c01d5
Starting Build
Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@10dd7d6
Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'.
	Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle)
	Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg'
Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
Included projects: [root project 'milib']
	Keep-alive timer started
	Adding Debian repository to project 'milib'
Parallel execution is an incubating feature.
Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
	Adding Maven pom generation to project 'milib'
	Linking the generated javadoc to the system JDK API documentation
All projects evaluated.
Selected primary task 'test' from project :
Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@18c80e9
Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test']
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@8c01d5
Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@19f4f55
Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1780e24
:compileJava (Thread[#41,Task worker for ':',5,main]) started.
:compileJava
Putting task artifact state for task ':compileJava' into context took 0.012 secs.
Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@7a6a0f
	Loading the Maven rules...
	Replacing org.apache.commons:commons-math3:jar:3.6.1  ->  org.apache.commons:commons-math3:jar:debian
	Replacing cc.redberry:pipe:jar:1.3.0  ->  cc.redberry:pipe:jar:1.0.0-alpha0
	Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0  ->  com.fasterxml.jackson:jackson-bom:jar:debian
	Passing through com.fasterxml.jackson:jackson-parent:jar:debian
	Passing through com.fasterxml:oss-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x
	Passing through com.fasterxml.jackson:jackson-base:jar:debian
	Passing through com.fasterxml.jackson:jackson-bom:jar:debian
	Replacing org.apache.commons:commons-compress:jar:1.21  ->  org.apache.commons:commons-compress:jar:debian
	Passing through org.apache.commons:commons-parent:jar:debian
	Passing through org.apache:apache:jar:debian
	Replacing commons-io:commons-io:jar:2.11.0  ->  commons-io:commons-io:jar:debian
	Replacing org.lz4:lz4-java:jar:1.8.0  ->  org.lz4:lz4-java:jar:debian
	Replacing com.beust:jcommander:jar:1.72  ->  com.beust:jcommander:jar:debian
	Replacing net.sf.trove4j:trove4j:jar:3.0.3  ->  net.sf.trove4j:trove4j:jar:debian
	Replacing com.google.guava:guava:jar:31.1-jre  ->  com.google.guava:guava:jar:debian
	Passing through com.google.guava:guava-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x
	Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x
	Passing through commons-codec:commons-codec:jar:debian
	Passing through org.jsr-305:jsr305:jar:0.x
	Passing through com.google.errorprone:error_prone_annotations:jar:debian
	Passing through com.google.errorprone:error_prone_parent:jar:debian
Skipping task ':compileJava' as it is up-to-date (took 2.414 secs).
:compileJava UP-TO-DATE
:compileJava (Thread[#41,Task worker for ':',5,main]) completed. Took 2.506 secs.
:processResources (Thread[#41,Task worker for ':',5,main]) started.
:processResources
Putting task artifact state for task ':processResources' into context took 0.0 secs.
Skipping task ':processResources' as it is up-to-date (took 0.031 secs).
:processResources UP-TO-DATE
:processResources (Thread[#41,Task worker for ':',5,main]) completed. Took 0.041 secs.
:classes (Thread[#41,Task worker for ':',5,main]) started.
:classes
Skipping task ':classes' as it has no actions.
:classes UP-TO-DATE
:classes (Thread[#41,Task worker for ':',5,main]) completed. Took 0.002 secs.
:compileTestJava (Thread[#41,Task worker for ':',5,main]) started.
:compileTestJava
Putting task artifact state for task ':compileTestJava' into context took 0.0 secs.
	Replacing junit:junit:jar:4.13.2  ->  junit:junit:jar:4.x
	Replacing org.mockito:mockito-all:jar:1.10.19  ->  org.mockito:mockito-all:jar:debian
org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies.
	Passing through org.hamcrest:hamcrest:jar:debian
	Passing through org.mockito:mockito-core:jar:debian
	Passing through net.bytebuddy:byte-buddy:jar:debian
	Passing through net.bytebuddy:byte-buddy-parent:jar:debian
	Passing through net.bytebuddy:byte-buddy-agent:jar:debian
	Passing through org.objenesis:objenesis:jar:debian
	Passing through org.objenesis:objenesis-parent:jar:debian
	Passing through net.bytebuddy:byte-buddy-dep:jar:debian
	Passing through org.ow2.asm:asm:jar:debian
	Passing through org.ow2.asm:asm-commons:jar:debian
Up-to-date check for task ':compileTestJava' took 5.893 secs. It is not up-to-date because:
  No history is available.
All input files are considered out-of-date for incremental task ':compileTestJava'.
Compiling with JDK Java compiler API.
warning: [options] source value 8 is obsolete and will be removed in a future release
warning: [options] target value 8 is obsolete and will be removed in a future release
warning: [options] To suppress warnings about obsolete options, use -Xlint:-options.
Note: Some input files use or override a deprecated API.
Note: Recompile with -Xlint:deprecation for details.
Note: Some input files use unchecked or unsafe operations.
Note: Recompile with -Xlint:unchecked for details.
3 warnings
:compileTestJava (Thread[#41,Task worker for ':',5,main]) completed. Took 19.667 secs.
:processTestResources (Thread[#41,Task worker for ':',5,main]) started.
:processTestResources
Putting task artifact state for task ':processTestResources' into context took 0.0 secs.
Up-to-date check for task ':processTestResources' took 0.055 secs. It is not up-to-date because:
  No history is available.
:processTestResources (Thread[#41,Task worker for ':',5,main]) completed. Took 0.127 secs.
:testClasses (Thread[#41,Task worker for ':',5,main]) started.
:testClasses
Skipping task ':testClasses' as it has no actions.
:testClasses (Thread[#41,Task worker for ':',5,main]) completed. Took 0.001 secs.
:test (Thread[#41,Task worker for ':',5,main]) started.
:test
Putting task artifact state for task ':test' into context took 0.0 secs.
Up-to-date check for task ':test' took 1.913 secs. It is not up-to-date because:
  No history is available.
Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-21-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath12924679249714941596txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1'
Successfully started process 'Gradle Test Executor 1'
Gradle Test Executor 1 started executing tests.

com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED

com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT

    ==================
    High compression: false
    Concurrency: 4
    File size: 6799510
    Write time: 537.48ms

    O. Stats:
    Wall clock time: 549.66ms
    Total CPU time: 946.35ms
    User wait time: 414.92ms
    Serialization time: 581.94ms (61.49%)
    Checksum calculation time: 252.49ms (26.68%)
    Compression time: 82.92ms (8.76%)
    Total IO delay: 138.97ms
    Concurrency overhead: 93.2ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.17%)
    IO speed: 46.99MiB/s
    Concurrency adjusted uncompressed speed: 50.65MiB/s
    Actual uncompressed speed: 33.58MiB/s
    Actual speed: 11.81MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 364.05ms
    Total CPU time: 494.78ms
    Serialization time: 383.52ms (77.51%)
    Checksum calculation time: 33.94ms (6.86%)
    Compression time: 69.02ms (13.95%)
    Total IO delay: 125.75ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.17%)
    IO speed: 51.88MiB/s
    Concurrency adjusted uncompressed speed: 118.95MiB/s
    Actual uncompressed speed: 50.65MiB/s
    Actual speed: 17.81MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 662.54ms
    Total CPU time: 720.76ms
    Serialization time: 495.94ms (68.81%)
    Checksum calculation time: 65.92ms (9.15%)
    Compression time: 142.66ms (19.79%)
    Total IO delay: 252.66ms
    Input size: 12.97MiB
    Decompressed size: 36.87MiB (compression = 35.17%)
    IO speed: 51.46MiB/s
    Concurrency adjusted uncompressed speed: 151.74MiB/s
    Actual uncompressed speed: 55.7MiB/s
    Actual speed: 19.59MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 124 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    ==================
    High compression: false
    Concurrency: 4
    File size: 6791878
    Write time: 200.31ms

    O. Stats:
    Wall clock time: 201.97ms
    Total CPU time: 218.2ms
    User wait time: 152.24ms
    Serialization time: 101.1ms (46.33%)
    Checksum calculation time: 39.75ms (18.22%)
    Compression time: 67.75ms (31.05%)
    Total IO delay: 53.26ms
    Concurrency overhead: 7.1ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.13%)
    IO speed: 122.21MiB/s
    Concurrency adjusted uncompressed speed: 249.15MiB/s
    Actual uncompressed speed: 91.73MiB/s
    Actual speed: 32.23MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 185.13ms
    Total CPU time: 196.54ms
    Serialization time: 74.02ms (37.66%)
    Checksum calculation time: 36.39ms (18.52%)
    Compression time: 83.36ms (42.41%)
    Total IO delay: 57.51ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.13%)
    IO speed: 113.64MiB/s
    Concurrency adjusted uncompressed speed: 292.65MiB/s
    Actual uncompressed speed: 99.66MiB/s
    Actual speed: 35.01MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 402.3ms
    Total CPU time: 382.66ms
    Serialization time: 142.48ms (37.24%)
    Checksum calculation time: 72.04ms (18.83%)
    Compression time: 163.8ms (42.8%)
    Total IO delay: 103.36ms
    Input size: 12.95MiB
    Decompressed size: 36.87MiB (compression = 35.13%)
    IO speed: 125.77MiB/s
    Concurrency adjusted uncompressed speed: 304.74MiB/s
    Actual uncompressed speed: 91.73MiB/s
    Actual speed: 32.23MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 40 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    ==================
    High compression: false
    Concurrency: 1
    File size: 6799510
    Write time: 316.1ms

    O. Stats:
    Wall clock time: 317.46ms
    Total CPU time: 194.62ms
    User wait time: 269.22ms
    Serialization time: 88.98ms (45.72%)
    Checksum calculation time: 32.31ms (16.6%)
    Compression time: 61.41ms (31.55%)
    Total IO delay: 59.54ms
    Concurrency overhead: 15.57ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.17%)
    IO speed: 109.91MiB/s
    Concurrency adjusted uncompressed speed: 68.54MiB/s
    Actual uncompressed speed: 58.16MiB/s
    Actual speed: 20.46MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!

    I. Stats 1:
    Wall clock time: 200.17ms
    Total CPU time: 202.81ms
    Serialization time: 85.59ms (42.2%)
    Checksum calculation time: 31.62ms (15.59%)
    Compression time: 77.47ms (38.2%)
    Total IO delay: 111.71ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.17%)
    IO speed: 58.42MiB/s
    Concurrency adjusted uncompressed speed: 58.72MiB/s
    Actual uncompressed speed: 92.18MiB/s
    Actual speed: 32.42MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 398.36ms
    Total CPU time: 394.28ms
    Serialization time: 162.22ms (41.14%)
    Checksum calculation time: 64.59ms (16.38%)
    Compression time: 152.66ms (38.72%)
    Total IO delay: 196.01ms
    Input size: 12.97MiB
    Decompressed size: 36.87MiB (compression = 35.17%)
    IO speed: 66.17MiB/s
    Concurrency adjusted uncompressed speed: 62.5MiB/s
    Actual uncompressed speed: 92.65MiB/s
    Actual speed: 32.59MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 124 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    ==================
    High compression: false
    Concurrency: 1
    File size: 6791878
    Write time: 238.31ms

    O. Stats:
    Wall clock time: 239.48ms
    Total CPU time: 165.74ms
    User wait time: 202.74ms
    Serialization time: 75.66ms (45.65%)
    Checksum calculation time: 31.47ms (18.99%)
    Compression time: 56.28ms (33.96%)
    Total IO delay: 36.86ms
    Concurrency overhead: 3.36ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.13%)
    IO speed: 179.92MiB/s
    Concurrency adjusted uncompressed speed: 89.94MiB/s
    Actual uncompressed speed: 77.14MiB/s
    Actual speed: 27.1MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!

    I. Stats 1:
    Wall clock time: 159.07ms
    Total CPU time: 166.75ms
    Serialization time: 57.03ms (34.2%)
    Checksum calculation time: 31.63ms (18.97%)
    Compression time: 77.04ms (46.2%)
    Total IO delay: 37.9ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.13%)
    IO speed: 175.06MiB/s
    Concurrency adjusted uncompressed speed: 90.38MiB/s
    Actual uncompressed speed: 115.96MiB/s
    Actual speed: 40.74MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 348.68ms
    Total CPU time: 331.16ms
    Serialization time: 114.11ms (34.46%)
    Checksum calculation time: 70.25ms (21.21%)
    Compression time: 144.34ms (43.59%)
    Total IO delay: 76.63ms
    Input size: 12.95MiB
    Decompressed size: 36.87MiB (compression = 35.13%)
    IO speed: 170.45MiB/s
    Concurrency adjusted uncompressed speed: 90.6MiB/s
    Actual uncompressed speed: 105.96MiB/s
    Actual speed: 37.23MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 40 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 4

    ==================
    High compression: true
    Concurrency: 4
    File size: 4156299
    Write time: 2.65s

    O. Stats:
    Wall clock time: 2.65s
    Total CPU time: 7.08s
    User wait time: 2.49s
    Serialization time: 73.95ms (1.04%)
    Checksum calculation time: 32.34ms (0.46%)
    Compression time: 6.97s (98.43%)
    Total IO delay: 81.31ms
    Concurrency overhead: 47.37ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.96MiB (~457B per object; compression = 21.5%)
    IO speed: 48.94MiB/s
    Concurrency adjusted uncompressed speed: 10.04MiB/s
    Actual uncompressed speed: 6.97MiB/s
    Actual speed: 1.5MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 112.96ms
    Total CPU time: 153.37ms
    Serialization time: 59.29ms (38.66%)
    Checksum calculation time: 31.96ms (20.84%)
    Compression time: 56.3ms (36.71%)
    Total IO delay: 38.19ms
    Input size: 3.96MiB
    Decompressed size: 18.44MiB (compression = 21.5%)
    IO speed: 104.31MiB/s
    Concurrency adjusted uncompressed speed: 392.27MiB/s
    Actual uncompressed speed: 164.62MiB/s
    Actual speed: 35.39MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 268.66ms
    Total CPU time: 305.99ms
    Serialization time: 118.89ms (38.85%)
    Checksum calculation time: 63.23ms (20.66%)
    Compression time: 112.36ms (36.72%)
    Total IO delay: 87.09ms
    Input size: 7.93MiB
    Decompressed size: 36.87MiB (compression = 21.5%)
    IO speed: 91.12MiB/s
    Concurrency adjusted uncompressed speed: 376.26MiB/s
    Actual uncompressed speed: 137.59MiB/s
    Actual speed: 29.58MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 124 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 1 / 0 / 1

    ==================
    High compression: true
    Concurrency: 4
    File size: 4098671
    Write time: 4.24s

    O. Stats:
    Wall clock time: 4.24s
    Total CPU time: 7.01s
    User wait time: 3.84s
    Serialization time: 76.55ms (1.09%)
    Checksum calculation time: 32.77ms (0.47%)
    Compression time: 6.9s (98.34%)
    Total IO delay: 28.61ms
    Concurrency overhead: 6.57ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.91MiB (~451B per object; compression = 21.2%)
    IO speed: 139.6MiB/s
    Concurrency adjusted uncompressed speed: 10.43MiB/s
    Actual uncompressed speed: 4.35MiB/s
    Actual speed: 943.57KiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 124.56ms
    Total CPU time: 140.64ms
    Serialization time: 46.19ms (32.85%)
    Checksum calculation time: 31.54ms (22.42%)
    Compression time: 61.98ms (44.07%)
    Total IO delay: 18.02ms
    Input size: 3.91MiB
    Decompressed size: 18.44MiB (compression = 21.2%)
    IO speed: 217.16MiB/s
    Concurrency adjusted uncompressed speed: 472.74MiB/s
    Actual uncompressed speed: 148.68MiB/s
    Actual speed: 31.52MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 280.53ms
    Total CPU time: 280.57ms
    Serialization time: 93.47ms (33.32%)
    Checksum calculation time: 62.67ms (22.34%)
    Compression time: 122.62ms (43.7%)
    Total IO delay: 38.86ms
    Input size: 7.82MiB
    Decompressed size: 36.87MiB (compression = 21.2%)
    IO speed: 205.73MiB/s
    Concurrency adjusted uncompressed speed: 466.76MiB/s
    Actual uncompressed speed: 131.69MiB/s
    Actual speed: 27.92MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 40 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1

    ==================
    High compression: true
    Concurrency: 1
    File size: 4156299
    Write time: 6.54s

    O. Stats:
    Wall clock time: 6.54s
    Total CPU time: 6.45s
    User wait time: 6.51s
    Serialization time: 76.32ms (1.18%)
    Checksum calculation time: 31.99ms (0.5%)
    Compression time: 6.33s (98.19%)
    Total IO delay: 45.04ms
    Concurrency overhead: 8.07ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.96MiB (~457B per object; compression = 21.5%)
    IO speed: 88.08MiB/s
    Concurrency adjusted uncompressed speed: 2.83MiB/s
    Actual uncompressed speed: 2.82MiB/s
    Actual speed: 620.53KiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!

    I. Stats 1:
    Wall clock time: 153.14ms
    Total CPU time: 180.56ms
    Serialization time: 83.59ms (46.29%)
    Checksum calculation time: 31.95ms (17.7%)
    Compression time: 60.72ms (33.63%)
    Total IO delay: 48.78ms
    Input size: 3.96MiB
    Decompressed size: 18.44MiB (compression = 21.5%)
    IO speed: 82.58MiB/s
    Concurrency adjusted uncompressed speed: 80.51MiB/s
    Actual uncompressed speed: 120.5MiB/s
    Actual speed: 25.91MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 337.76ms
    Total CPU time: 348ms
    Serialization time: 142.92ms (41.07%)
    Checksum calculation time: 64.45ms (18.52%)
    Compression time: 128.33ms (36.88%)
    Total IO delay: 106.6ms
    Input size: 7.93MiB
    Decompressed size: 36.87MiB (compression = 21.5%)
    IO speed: 74.79MiB/s
    Concurrency adjusted uncompressed speed: 81.22MiB/s
    Actual uncompressed speed: 109.42MiB/s
    Actual speed: 23.52MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 124 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1

    ==================
    High compression: true
    Concurrency: 1
    File size: 4098671
    Write time: 7.19s

    O. Stats:
    Wall clock time: 7.19s
    Total CPU time: 7.12s
    User wait time: 7.17s
    Serialization time: 65.98ms (0.93%)
    Checksum calculation time: 34.48ms (0.48%)
    Compression time: 7.02s (98.55%)
    Total IO delay: 41.06ms
    Concurrency overhead: 2.61ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.91MiB (~451B per object; compression = 21.2%)
    IO speed: 95.34MiB/s
    Concurrency adjusted uncompressed speed: 2.57MiB/s
    Actual uncompressed speed: 2.56MiB/s
    Actual speed: 556.46KiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!

    I. Stats 1:
    Wall clock time: 136.18ms
    Total CPU time: 145.63ms
    Serialization time: 51.03ms (35.04%)
    Checksum calculation time: 34.23ms (23.5%)
    Compression time: 59.36ms (40.76%)
    Total IO delay: 23.41ms
    Input size: 3.91MiB
    Decompressed size: 18.44MiB (compression = 21.2%)
    IO speed: 169.95MiB/s
    Concurrency adjusted uncompressed speed: 109.09MiB/s
    Actual uncompressed speed: 135.57MiB/s
    Actual speed: 28.74MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 290.16ms
    Total CPU time: 285.09ms
    Serialization time: 97.71ms (34.27%)
    Checksum calculation time: 72.65ms (25.48%)
    Compression time: 112.66ms (39.52%)
    Total IO delay: 43.64ms
    Input size: 7.82MiB
    Decompressed size: 36.87MiB (compression = 21.2%)
    IO speed: 181.8MiB/s
    Concurrency adjusted uncompressed speed: 112.42MiB/s
    Actual uncompressed speed: 127.15MiB/s
    Actual speed: 26.96MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 40 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 3000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 8000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 13000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 18000
    O. Stats:
    Wall clock time: 8.82s
    Total CPU time: 7.06s
    User wait time: 445.74us
    Serialization time: 1.39s (19.73%)
    Checksum calculation time: 3.63s (51.35%)
    Compression time: 1.13s (15.97%)
    Total IO delay: 5.83s
    Concurrency overhead: 11.71ms
    Uncompressed size: 1.86GiB (~97.66KiB per object)
    Output size: 1.86GiB (~97.66KiB per object; compression = 100%)
    IO speed: 327.07MiB/s
    Concurrency adjusted uncompressed speed: 1.15GiB/s
    Actual uncompressed speed: 216.31MiB/s
    Actual speed: 216.31MiB/s
    Objects: 20000
    Average object size uncompressed: 97.66KiB
    Average object size compressed: 97.66KiB
    Blocks: 20 (~95.37MiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT
     0 ATTWCCGACA 9
       |||   ||||
    20 ATTT--GACA 27
    [S3:W->T,D4:C,D5:C]
    24
    -26

com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT
    1000001
    1010100
    1000111
    1000011

    1000010

com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT
    8 AGACACAGATACA 20
      ||||||| |||||
    0 AGACACATATACA 12
    0 AGACACATATACA 12
      ||||||| |||||
    8 AGACACAGATACA 20

    0 GATACATTAGACACAGATACA--- 20
              ||||||| |||||   
    0 --------AGACACATATACACAG 15
    0 --------AGACACATATACACAG 15
              ||||||| |||||   
    0 GATACATTAGACACAGATACA--- 20

    0 GATACATTAGA---CACAGATACA 20
      |||||||||||   ||||||||||
    5 GATACATTAGAGACCACAGATACA 28
    5 GATACATTAGAGACCACAGATACA 28
      |||||||||||   ||||||||||
    0 GATACATTAGA---CACAGATACA 20

    0 GATAC-----ATTAGA---CACAGATACA 20
      |||||     ||||||   ||||||||||
    0 GATACGATACATTAGAGACCACAGATACA 28
    0 GATACGATACATTAGAGACCACAGATACA 28
      |||||     ||||||   ||||||||||
    0 GATAC-----ATTAGA---CACAGATACA 20


com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT
    0 -ATT-AGACA-- 7
       |||  || |  
    0 AATTGGGA-ATT 10
    I0AI3GSA3GDC6I8TI8T

com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT
    lTrimmed = 1683
    rTrimmed = 1694
    lTrimmed = 2774
    rTrimmed = 2733

com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED

com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED

com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT
    4946

com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT
    52
     0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51
       ||||||||||||||||||||||||||||||||||||||||||||||||||| 
    55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106
    [S51:A->G]
    (0->52)
    (55->107)

com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED

com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT
    Time per query: 1.12ms
    Processed queries: 33
    Bad percent: 0.0
    False positive percent: 0.5918506715228773
    Scoring error percent: 0.0

com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT
      ID: 0
      Score: 1665
      Cluster 0:
      Q 27 -> T 15 - -12
      Q 39 -> T 28 - -11
      Q 42 -> T 31 - -11
      Q 45 -> T 34 - -11
      Q 48 -> T 37 - -11
      Q 51 -> T 40 - -11
      Cluster 1:
      Q 84 -> T 50 - -34
      Q 87 -> T 53 - -34
      Q 90 -> T 56 - -34
      Q 93 -> T 59 - -34
      Q 96 -> T 62 - -34
      Q 99 -> T 65 - -34
      Q 114 -> T 82 - -32
      Cluster 2:
      Q 150 -> T 92 - -58
      Q 153 -> T 95 - -58
      Q 156 -> T 98 - -58
      Q 159 -> T 101 - -58
      Cluster 3:
      Q 198 -> T 120 - -78
      Q 201 -> T 123 - -78
      Q 204 -> T 126 - -78
      Q 207 -> T 129 - -78
      Q 216 -> T 139 - -77
      Q 219 -> T 142 - -77
      Q 222 -> T 145 - -77
      Q 231 -> T 153 - -78
      Q 234 -> T 156 - -78
      Q 237 -> T 159 - -78
      Q 240 -> T 162 - -78
      Cluster 4:
      Q 246 -> T 178 - -68
      Q 249 -> T 181 - -68
      Q 252 -> T 184 - -68
      Q 255 -> T 187 - -68
      Q 258 -> T 190 - -68
      Q 261 -> T 193 - -68
      Q 262 -> T 194 - -68


com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT
      ID: 0
      Score: 1110
      Cluster 0:
      Q 9 -> T 15 - 6
      Q 12 -> T 18 - 6
      Q 15 -> T 21 - 6
      Q 18 -> T 24 - 6
      Q 21 -> T 27 - 6
      Q 24 -> T 30 - 6
      Q 27 -> T 33 - 6
      Q 30 -> T 36 - 6
      Cluster 1:
      Q 60 -> T 51 - -9
      Q 69 -> T 61 - -8
      Q 78 -> T 69 - -9
      Q 81 -> T 72 - -9
      Q 84 -> T 75 - -9
      Cluster 2:
      Q 123 -> T 89 - -34
      Q 126 -> T 92 - -34
      Q 129 -> T 95 - -34
      Q 132 -> T 98 - -34
      Q 150 -> T 116 - -34
      Q 168 -> T 132 - -36
      Q 171 -> T 135 - -36
      Q 174 -> T 138 - -36
      Q 177 -> T 141 - -36
      Q 180 -> T 144 - -36
      Q 185 -> T 149 - -36


com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT
    noHits: 263
    noHits2: 0
    noHits3: 0
    wrongTopHit: 39
    wrongTopHitS: 33
    noCorrectHitInList: 21




    Timings:
    DescriptiveStatistics:
    n: 100000
    min: 13879.0
    max: 4.56632476E8
    mean: 194746.172119998
    std dev: 2389767.044577958
    median: 160514.0
    skewness: 125.9969190939178
    kurtosis: 18524.397188255018





    Clusters basicSize
    DescriptiveStatistics:
    n: 99698
    min: 1.0
    max: 6.0
    mean: 2.8647515496800415
    std dev: 1.0956461260244197
    median: 3.0
    skewness: 0.2913897903324683
    kurtosis: -0.6654608636172918





    Top Delta
    DescriptiveStatistics:
    n: 99716
    min: -31.0
    max: 0.0
    mean: -0.001795098078542935
    std dev: 0.18027592765848582
    median: 0.0
    skewness: -116.2495863418463
    kurtosis: 15125.436703214804


com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED

com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT
    -205

com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT
    C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 334.60us
    C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 290.39us
    C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 186.83us
    C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 194.48us

com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT
    ##teamcity[buildStatisticValue key='kmFound' value='0.9449']
    ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4']
    ##teamcity[buildStatisticValue key='kmFalse' value='0.0058']

com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT
    C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 476.17us
    C=2998;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 648.02us
    C=2999;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 449.12us
    C=2997;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 469.94us

com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT
    3.44us
    3.42us
    2.78us

com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT
    4 hits.

com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT
    GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT
    AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT
    1 AATTGACA 8
       |||||| 
    0 TATTGACT 7

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT
    1 AATTGACAG 9
       |||||| |
    0 TATTGAC-G 7

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT
    0 TATTGACT 7
       |||||| 
    1 AATTGACA 8

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT
    0 TATTGAC-G 7
       |||||| |
    1 AATTGACAG 9

com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT
    8 AGACACAGATACA 20
      ||||||| |||||
    0 AGACACATATACA 12

    0 GATACATTAGACACAGATACA--- 20
              ||||||| |||||   
    0 --------AGACACATATACACAG 15

    0 GATACATTAGA---CACAGATACA 20
      |||||||||||   ||||||||||
    5 GATACATTAGAGACCACAGATACA 28

    0 GATAC-----ATTAGA---CACAGATACA 20
      |||||     ||||||   ||||||||||
    0 GATACGATACATTAGAGACCACAGATACA 28

    Quality   78778     878777   7778887878      
    Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 
     Query0 0              aga---cacaTataca    12
     Query1 0 -------------aga---cacaTatacaCAG 15
     Query2 5 gatac-----attagaGACcacagataca    28
     Query3 0 gatacGATACattagaGACcacagataca    28

    Quality   78778  
    Subject 0 GATAC 4 
     Query1 0 ----- 0
     Query2 5 gatac 9
     Query3 0 gatac 4

    Quality            
    Subject  5 ----- 5  
     Query1  0 ----- 0 
     Query2 10 ----- 10
     Query3  5 GATAC 9 

    Quality    87877   
    Subject  5 ATTAG 9  
     Query0  0    ag 1 
     Query1  0 ---ag 1 
     Query2 10 attag 14
     Query3 10 attag 14

    Quality    7   7   
    Subject 10 A---C 11 
     Query0  2 a---c 3 
     Query1  2 a---c 3 
     Query2 15 aGACc 19
     Query3 15 aGACc 19

    Quality    77888   
    Subject 12 ACAGA 16 
     Query0  4 acaTa 8 
     Query1  4 acaTa 8 
     Query2 20 acaga 24
     Query3 20 acaga 24

    Quality    7878    
    Subject 17 TACA- 20 
     Query0  9 taca  12
     Query1  9 tacaC 13
     Query2 25 taca  28
     Query3 25 taca  28

    Quality         
    Subject 21 -- 21 
     Query1 14 AG 15

     0 GATAC-----ATTAGA---CACAGATACA--- 20 
     0              ...---....T.....    12
     0 -------------...---....T.....CAG 15
     5 .....-----......GAC..........    28
     0 .....GATAC......GAC..........    28

       787788787777778887878   
     0 GATACATTAGACACAGATACA 20 

com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT
    15 TATAGGGAGAACTCCGATCGACATCG 40
       |||||||||  |||||||||||||||
     0 TATAGGGAG--CTCCGATCGACATCG 23

    56 CGATCC--CGGTGACAAAGCGTTCGGACC 82
       ||||||  |||||||||||||||||||||
     0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28

    36 CATCGGGTATCGCCCTGGTACG 57
       |||| |||||||||||||||||
     0 CATCAGGTATCGCCCTGGTACG 21

     0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 
     0                tatagggag--ctccgatcgacatcg                                                                23 
     0                                                         cgatccTTcggtgacaaagcgttcggacc                    28 
     0                                     catcAggtatcgccctggtacg                                               21 

com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT
    0 --------------------- -1
    0 ATAAAAAAAAAAACGAGCTAG 20
    0 --------------------- -1
    0 ATAAAAAAAAAAACGAGCTAG 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT
    0 atgcggggatgc 11
    0 atgcggggatgc 11

com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT
    0 at-----------cgagctagTTTTTTTTTTT 20
    0 atAAAAAAAAAAAcgagctag----------- 20
    0 at-----------cgagctagTTTTTTTTTTT 20
    0 atAAAAAAAAAAAcgagctag----------- 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT
    0 atgcGGGGatgc 11
    0 atgcTA--atgc 9
    0 atgcGGGGatgc----------- 11
    0 atgcTA--atgcTTTTTTTTTTT 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT
     0 cgtaGGGGcgta 11
    11 cgta--ATcgta 20
    0 -----------cgtaGGGGcgta 11
    0 TTTTTTTTTTTcgtaAT--cgta 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT
    0 atgcggggat-gTTTTT 15
    0 atgcggggatAg----- 11
    0 atgcggggat-gTTTTTTT 17
    0 atgcggggatAg------- 11

com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT
    7 g-taggggcgta 17
    0 gAtaggggcgta 11

    0 TTTTTTTg-taggggcgta 17
    0 -------gAtaggggcgta 11

com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT
    0  0
    0  0

com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT
    0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260
    1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200

com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT
    29.0
    2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27
    0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35
    29.0
    2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27
    0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35

com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT
        0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29
          ||||||||||||||||||||||||||||||
        0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29

       30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58
           |||| | |||||||||||||| |||||| 
       30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58

       59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88
          |||||||||||||||||||||| |||||||
       59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88

       89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117
          || | |||||||||||||||||||||||||
       89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117

      118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147
          ||||||||||||||||||||||||| ||||
      118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147

      148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176
           |||||||||| ||||||| || |||||| 
      148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176

      177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206
          ||||||||||| ||||||||||||||||||
      177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206

      207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236
          |||||||||||||| |||||||||||||||
      207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236

      237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266
          ||||||||||||||||||||||||| ||||
      237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266

      267 GACACGGCTGTGTATTACTGTGC 289
          |||||||||||||||||||||||
      267 GACACGGCTGTGTATTACTGTGC 289


com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT
    {
      "qualityMergingAlgorithm": "SumSubtraction",
      "partsLayout": "Collinear",
      "minimalOverlap": 15,
      "maxQuality": 50,
      "minimalIdentity": 0.8,
      "identityType": "Unweighted"
    }

com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT
    3
    3
    -2147483648
    -9223372036854775808

com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR
    Indexing milib_135fcd542f3d3a022939ebe27736449c718e8f079698438381718984365.fasta: 0%
    Indexing milib_135fcd542f3d3a022939ebe27736449c718e8f079698438381718984365.fasta: done

com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR
    Indexing milib_135fcd542f3d3a022939ebe27736449c718e8f079698438381718984365.fasta: 0%
    Indexing milib_135fcd542f3d3a022939ebe27736449c718e8f079698438381718984365.fasta: done

com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR
    Indexing milib_788d39453c88a89d299ee2436b15062dfbf4c2f76101256545941360960.tmp: 0%
    Indexing milib_788d39453c88a89d299ee2436b15062dfbf4c2f76101256545941360960.tmp: done

com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED

com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED

com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT
    46

com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT
    657

com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT
    2410

com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT
    {
      "averageQualityThreshold": 7.0,
      "windowSize": 6
    }

com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT
    99951 elements with 366.25KiB in raw nucleotide entropy serialized into 273.04KiB

com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT
    3

com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT
    FromCenter
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromLeftWithoutIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromLeftWithIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromRightWithoutIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromRightWithIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19

com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED

com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT
    Hit 1
    0 ac-gacTtgactg 11
    0 acTgac-tgactg 11

    Hit 2
    0 ac-gactTgactg 11
    0 acTgact-gactg 11


com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT
    --NW  alignments--
    CASSLAPGATN-KLFF
    CASS-APGATNEKLFF

    CASSLAPGATN-KLFF
    CASSLAPG-TNEKLFF

    CASSLAPGATN-KLfF
    CASSLAPG-TNEKLyF

    --STM alignments--
    CASSLAPGATN-KLFF
    CASS-APGATNEKLFF

    CASSLAPGATN-KLFF
    CASSLAPG-TNEKLFF

    CASSlAPGATN-KLFF
    CASSa-PGATNEKLFF

    CASSLAPGaTN-KLFF
    CASSLAPGt-NEKLFF

    CASSlAPGATN-KLFF
    CA-SsAPGATNEKLFF

    CASSlAPGATN-KLFF
    CAS-sAPGATNEKLFF

    CASSLAPGATNk-LFF
    CASS-APGATNeKLFF

    CASSLAPGaTN-KLFF
    CASSLAP-gTNEKLFF

    CASSLAPGATNk-LFF
    CASSLAPG-TNeKLFF

    CASSLAPGATN-KLfF
    CASSLAPG-TNEKLyF

    ------------------

com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED

com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT
    TTGTGTAGAATTGGATGCAGCACCACTGTCGTTTCGAACCCAGGTCCAAATCGAACTATGGGACCAGACTAGCTACCATAAGCGGTCATAGGTCGCCTACTCCGCTCCGTTTCGCTCATCCTACCCGGGCCCCCGCAATTCGTTAATTGAATTATGATGATTACTCTCGACAAGCGCTCCCTAGATAGATTTACTATACGACCGACCACACCCTAGCATATGACTCGCGTTTGTTCGGAATGTCGAATTCCGTAACCCGATCGAACTCACATGTACATAGGAGTAGGTCACGGCCCACAAAACAGCACCAACTCAGAAACGGTTCGGGAACGTGTCAATAGGGCCTGTGATCTAGATGTTTTCGTCTTAGGCCTGATAAGTGATTATCAAAAACGCTATAATCATACTTTCTGGTCTAATCCAGGCCGTTGCTAACTTCGTCAATTCTAAATGCCGATCTGGCACAGCAGGGCGAATTATCAAGGAGCTTCGGGACCACCAACGGGGGTTGGACCTTACATCCCGATCAGGTGAAAGACACTTACAGCGACGTTACGCCTAATAAAGTTTTTTAGCGTGAGGGGGACGCTCTGAGATTGTAATCTGTAAGCCTAATCGTTGTGTCGGGCATCTAGGTCGCCTTCCTCGGTACCAAACGCCATTTCCTGGTCGCTAAAGTTCATGGCCGCTGCATCGGTTTGACTCAAGTGGGATGCTCGTGTGATGACACAAAATCTTGGCCAAGGAAAGCGCCCCGGTTCGTGTTCCAATATACTACTTAAGG
    TTTGTAGAATTGGATCAGCACCACTGTCTGTTTCGAAGCCAGGTCCAAACCGAACTATGGGACCAGACTAGCTACCATGCGGTCATAGGTCGCCTGACTCCATCTCGTTTCGCTCTCCTACCCGGGACCCCGCATTCGTTATTGAATTATGCATATTATCTCGACAGCGCTCCCTAGATAGATTTACTATACGACCGAATCCGCACCCTAGATATGACTCGCGTTTGTGTCGGATTGTCGAATTCCGTGACCCGATCGAACTCCATGTATGAGGAGTAGGTCACGGCCCACAAAACAGCACCAACTCAGAACGGTTCGGTGAACGTGTGATATGGCCTGTGATCTAATGTTTCGTCTTAGGACCTTATAATGATTATCAAAAACGCTATAATCATACTTTCGGTCTAATCCATTCCGTTGCTAACTTCGTCATTTCTAAATGCGATCGGCACAGCTGGGCGAATTATCAAGGAGCTTCGGGACCACAACGAGGGTTGGTCCTTACATCGATCAGGTGAAAGAACTTCACAGCAACGTTACGCCTAATAAAGTTTTTTAGCGTGGGGGGACGCTCTGAGATTGGATCTGTAAGCCTAATTCGTTGTGTCGGGCATCTAGGTCGCCTTCCTCGGTACCAAACCGCCATTTCCTGTTCGCTAAAGTTCATGGCGCTGCATCGGTTTGACTCACGTGTGATGCTCGTGTGATGACACAAAATCTTGGCCAAGGAAATCGCCCCGGTCGTGTTCCAAAACTACTTAGG
    TTTGTAGAATTGGAGTCTGCACCACTGTCTGTTTCTTAAGCCAAGTCCAAACCGAACTATGGGACCAGACTGCTCCTGTCGTCACAGGTCGCCTGCTCCATCTCGTTCCGCTTCCTATCGGGACACCCACATCGTTATTGAATTATGATTTTATCTCGACAGCGCTCCCTAGATCAAATTTACTTACGACCGAATCCGCACCCTAGATATGACTCGCTTTTGTGTCGGATTTGTCGAATTCCGTGACCCGATCGATCTCCAGTATGGAGGATTAGGTCACGGCCCACAAAACAGCACCGATCAGAACGTTCTGTAACGTGTGTTATGGCCTGTGATCGTATGTTTCGTCTTAGGACCTTATATGATTATCAAAAACGCTATAGATCATACTTTCGGTCTAATCCATTCCTTGTTAACTTCGTCATTTCTAAATGCGATCGGCACAGCTGGGCGAATTATCAAGAGTTCGGACCACAACGAATGCTCGGTCCTTACTTGATAGGTGGAAAGACTTCACAGCAACGTTACGCCTAATAAAGTTTTTGCGTGGGGGGACGCTCTGAGATTGGATCTGGATCCTAATCGTTGTGTCGGGCGTCTAGGTCGCCTTCCCAGTACCAAACCGCCATTTCCGTTCGCTAAAGTTCATGCGCTGCATCGGTTTGACTCACGTGTGATGCTTCGTGCGATGACACAAAATCTTTTCCAAGGAAATCGCCCGGTCGTGTTCCAAAACTACTTGGA
    0 TT-TGTAGAATTGGA-GTCTGCACCACTGTCTGTTTCTTAAGCCAAGTCCAAACCGAACTATGGGACCAGACT-GCT-CC-T--GTC-GTCACAGGTCGCCTGCTCC-ATCTCGTTCCGCT--TCCTA-TCGGGACACC-CACA-TCGTT-ATTGAATTATGAT-TTTA-TCTCGAC-AGCGCTCCCTAGATCAAATTTACT-TACGACCGAATCCGCACCCTAG-ATATGACTCGCTTTTGTGTCGGATTTGTCGAATTCCGTGACCCGATCGATCTC-CA-GTATGGAGGATTAGGTCACGGCCCACAAAACAGCACCGA-TCAG-AAC-GTTCTGTAACGTGT-GTTATGGCCTGTGATC--GTATG-TTTCGTCTTAGGACCTTAT-A-TGATTATCAAAAACGCTATAGATCATACTTTC-GGTCTAATCCATTCC-TTGTTAACTTCGTCATTTCTAAATG-CGATC-GGCACAGCTGGGCGAATTATCAA-GAG-TTC-GGACCA-CAACGAATGCTCGGTCCTTAC-T--TGAT-AGGTGGAAAG--ACTTCACAGCAACGTTACGCCTAATAAAG-TTTTT-GCGTG-GGGGGACGCTCTGAGATTG-GATCTG-GATCCTAATCGTTGTGTCGGGCGTCTAGGTCGCCTTCC-CAGTACCAAACCGCCATTTCC-GTTCGCTAAAGTTCAT-G-CGCTGCATCGGTTTGACTCACGTGTGATGCTTCGTGCGATGACACAAAATCTTTTCCAAGGAAATCG-CCCGG-TCGTGTTCCAA-A-ACTACTT--GGA 743
      || |||||||||||| | | ||||||||||| |||||  || ||| ||||||| ||||||||||||||||||| ||| || |  | | |||| ||||||||| ||||  || |||| ||||  |||||  |||| | || || | ||||| |||||||||||||  ||| ||||||| |||||||||||||| | ||||||| |||||||| | || |||||||| ||||||||||| ||||| |||||  ||||||||||||| |||||||||| ||| || |||   |||| |||||||||||||||||||||||||| | |||| ||| |||| | |||||||   || |||||||||||  | ||| |||||||||||| ||| || | |||||||||||||||||||| ||||||||||| |||||||||||  || ||| ||||||||||| ||||||||| ||||| |||||||| |||||||||||||| ||| ||| |||||| |||||   | | || |||||| |   ||| |||| |||||  |||| ||||| |||||||||||||||||| ||||| ||||| |||||||||||||||||||  |||||  | ||||||||||||||||||| ||||||||||||||| | |||||||| |||||||||| | |||||||||||||| | |||||||||||||||||||| ||| ||||| ||||| ||||||||||||||||  ||||||||| || ||||| ||||||||||| | |||||||  || 
    0 TTGTGTAGAATTGGATG-CAGCACCACTGTC-GTTTC-GAACCCAGGTCCAAATCGAACTATGGGACCAGACTAGCTACCATAAG-CGGTCATAGGTCGCCTACTCCGCTC-CGTTTCGCTCATCCTACCCGGGCCCCCGCA-ATTCGTTAATTGAATTATGATGATTACTCTCGACAAGCGCTCCCTAGAT-AGATTTACTATACGACCG-A-CCACACCCTAGCATATGACTCGCGTTTGT-TCGGA-ATGTCGAATTCCGTAACCCGATCGAACTCACATGTACATAGGAGTAGGTCACGGCCCACAAAACAGCACCAACTCAGAAACGGTTCGGGAACGTGTCAATAGGGCCTGTGATCTAG-ATGTTTTCGTCTTAGG-CCTGATAAGTGATTATCAAAAACGCTATA-ATCATACTTTCTGGTCTAATCCAGGCCGTTGCTAACTTCGTCAATTCTAAATGCCGATCTGGCACAGCAGGGCGAATTATCAAGGAGCTTCGGGACCACCAACG-GGGGTTGGACCTTACATCCCGATCAGGT-GAAAGACACTT-ACAGCGACGTTACGCCTAATAAAGTTTTTTAGCGTGAGGGGGACGCTCTGAGATTGTAATCTGTAAGCCTAATCGTTGTGTCGGGCATCTAGGTCGCCTTCCTCGGTACCAAA-CGCCATTTCCTGGTCGCTAAAGTTCATGGCCGCTGCATCGGTTTGACTCAAGTGGGATGC-TCGTGTGATGACACAAAATCTTGGCCAAGGAAAGCGCCCCGGTTCGTGTTCCAATATACTACTTAAGG- 783
    [I15:T,S15:T->G,D16:G,I79:A,D80:A,I103:G,I103:C,S103:G->T,D105:T,D106:C,I116:C,S116:C->A,D117:A,I123:C,D124:C,I129:C,I130:C,D131:C,I133:G,S134:G->A,D135:C,D136:A,I144:A,D145:A,D239:A,S240:T->A,I241:T,D275:C,D276:A,S277:T->C,I278:A,I278:T,I309:A,S310:A->C,D311:C,I320:G,D321:G,I352:T,I352:A,S352:T->G,D353:A,D354:G,I377:A,S378:A->G,D379:G,I453:C,D454:C,I483:G,D484:G,I491:G,D493:G,I498:C,D499:C,D507:G,S508:T->G,I510:T,I519:A,S519:A->T,I520:C,I520:C,S520:T->C,D521:C,D522:C,D523:C,I537:A,S537:A->C,D538:C,I567:T,S572:T->A,D573:A,I683:G,S684:G->C,D686:C,I758:T,D759:T,I780:A,S781:A->G,D782:G]
    0 TTGTGTAGAATTGGA-TGCAGCACCACTGTCGTTTCGAACCCAGGTCCAAATCGAACTATGGGACCAGACTAGCTACCAT-AAGCGGTCATAGGTCGCCTACTCC--GCTCCGTTTCGCT-CATCCTA-CCCGGG-C-CCC-CGCAATTCGTT-AATTGAATTATGATGATTACTCTCGACAAGCGCTCCCTAGATAGATTTACTATACGACCGACCACACCCTAGCATATGACTCGCGTTTGTTCGGAAT-GTCGAATTCCGTAACCCGATCGAACTCACATGTACAT--AGGAGTAGGTCACGGCCCACAAAACAGCACC-AACTCAGAAAC-GGTTCGGGAACGTGTCAATAGGGCCTGTGATC--TAGATGTTTTCGTCTTAGGCCTGAT-AAGTGATTATCAAAAACGCTATAATCATACTTTCTGGTCTAATCCAGGCCGTTGCTAACTTCGTCAATTCTAAATG-CCGATCTGGCACAGCAGGGCGAATTATCAA-GGAGCTTC-GGGACCA-CCAACGGGGGTT-GGACCTTAC-A--TCCCGATCAGGTGAAAG-ACACTTACAGCGACGTTACGCCTAATAAAG-TTTTTTAGCGTGAGGGGGACGCTCTGAGATTGTAATCTGTAAGCCTAATCGTTGTGTCGGGCATCTAGGTCGCCTTCCTCGGTACCAAACGCCATTTCCTGGTCGCTAAAGTTCAT-GGCCGCTGCATCGGTTTGACTCAAGTGGGATGCTCGTGTGATGACACAAAATCTTGGCCAAGGAAAGCGCCCCGG-TTCGTGTTCCAATATACTACTT-AAGG 783
      |||||||||||||||   |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||   |  |||||||||   ||||| | |||| | | | |   ||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||   ||||||||||||||||||||||||||||||||||     ||||||||||||||||||||||||||||||| |  |||||||| | ||||||||||||||||||||||||||||||     |||||||||||||||||||||| |  ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||| | |||||| || |||| | |||||||  | |||||||||        |||||||||||||   |||||||||||||||||||||||||||| |||||  ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||| |  |
    0 TTGTGTAGAATTGGATG-CAGCACCACTGTCGTTTCGAACCCAGGTCCAAATCGAACTATGGGACCAGACTAGCTACCATAA-GCGGTCATAGGTCGCCTACTCCGCTC--CGTTTCGCTCA-TCCTACC-CGGGCCCC-CGCA--ATTCGTTAA-TTGAATTATGATGATTACTCTCGACAAGCGCTCCCTAGATAGATTTACTATACGACCGACCACACCCTAGCATATGACTCGCGTTTGTTCGGA-ATGTCGAATTCCGTAACCCGATCGAACTCACATGTA--CATAGGAGTAGGTCACGGCCCACAAAACAGCACCAAC-TCAGAAACGG-TTCGGGAACGTGTCAATAGGGCCTGTGATCTAG--ATGTTTTCGTCTTAGGCCTGATAAG-TGATTATCAAAAACGCTATAATCATACTTTCTGGTCTAATCCAGGCCGTTGCTAACTTCGTCAATTCTAAATGCC-GATCTGGCACAGCAGGGCGAATTATCAAGG-AGCTTCGGG-ACCACC-AACGGGG-GTTGGACCTTACATCCC---GATCAGGTGAAAGAC-ACTTACAGCGACGTTACGCCTAATAAAGTTTTTTA-GCGTGAGGGGGACGCTCTGAGATTGTAATCTGTAAGCCTAATCGTTGTGTCGGGCATCTAGGTCGCCTTCCTCGGTACCAAACGCCATTTCCTGGTCGCTAAAGTTCATGGCC-GCTGCATCGGTTTGACTCAAGTGGGATGCTCGTGTGATGACACAAAATCTTGGCCAAGGAAAGCGCCCCGGTT-CGTGTTCCAATATACTACTTAAG-G 783

com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT
    S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E])
    S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])

com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT
    S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E])
    S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT
    [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A]

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT
    [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S]
    [-1, -1, 9, 15]

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT
    0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295
      ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || |||||     |||   || ||||||||||||||
    0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290
    [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R]
    QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER
    QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER
    [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R]
    [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12]

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT
    [S3:S->M,D4:D,S5:_->I]

com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT
    [0, 1]
    [0, 2]
    [1, 2]

com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT
    Time per hash: 254ns
    Addition to hash set (per operation): 812ns
    Hash set removal (per operation): 423ns
    a

com.milaboratory.util.VersionInfoTest > test3 SKIPPED

com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED

com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT
    Collation: 233.64ms
    Sorting: 194.91ms
    1
    217
    41477
    99501
    99998

com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT
    /tmp/milib_f340c6bda2607c49968352cb1fe6141ffb13c82d7145097387323968912
    timeInCollate: 7.15s
    timeInCollatorInit: 4.78s
    timeAwaitingO: 1.55ms
    timeAwaitingI: 1.63s
    timeInFinalSorting1: 0ns
    timeInFinalSorting2: 21.14ms
    timeInFinalSorting3: 83.67ms
    /16S (5|27|32):  objs=50000 size=3.45MiB

com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT
    /tmp/milib_1de1d9c6ad1aad94371baf9819640a44943645457259090008860625555
    timeInCollate: 18.21s
    timeInCollatorInit: 1.28s
    timeAwaitingO: 1.52s
    timeAwaitingI: 5.74s
    timeInFinalSorting1: 2.2s
    timeInFinalSorting2: 2.14s
    timeInFinalSorting3: 1.48s
    /0N (5|27|32):  objs=158464 size=8.93MiB
    /1N (5|27|32):  objs=158842 size=9.04MiB
    /2N (5|27|32):  objs=158801 size=8.96MiB
    /3N (5|27|32):  objs=158078 size=8.71MiB
    /4N (5|27|32):  objs=161809 size=9.41MiB
    /5N (5|27|32):  objs=155453 size=8.88MiB
    /6N (5|27|32):  objs=157264 size=8.59MiB
    /7N (5|27|32):  objs=161496 size=9.33MiB
    /8N (5|27|32):  objs=157865 size=8.69MiB
    /9N (5|27|32):  objs=161658 size=9.6MiB
    /10N (5|27|32):  objs=156022 size=9.07MiB
    /11N (5|27|32):  objs=162378 size=9.26MiB
    /12N (5|27|32):  objs=147501 size=8.32MiB
    /13N (5|27|32):  objs=155777 size=8.73MiB
    /14N (5|27|32):  objs=158527 size=9.39MiB
    /15N (5|27|32):  objs=151241 size=8.24MiB
    /16N (5|27|32):  objs=153470 size=8.75MiB
    /17N (5|27|32):  objs=157629 size=9.02MiB
    /18N (5|27|32):  objs=145855 size=8.12MiB
    /19N (5|27|32):  objs=157891 size=8.86MiB
    /20N (5|27|32):  objs=153741 size=8.45MiB
    /21N (5|27|32):  objs=152207 size=8.44MiB
    /22N (5|27|32):  objs=159241 size=9.08MiB
    /23N (5|27|32):  objs=152665 size=8.4MiB
    /24N (5|27|32):  objs=156239 size=8.83MiB
    /25N (5|27|32):  objs=157136 size=9.05MiB
    /26N (5|27|32):  objs=154951 size=8.87MiB
    /27N (5|27|32):  objs=163413 size=9.05MiB
    /28N (5|27|32):  objs=154287 size=8.8MiB
    /29N (5|27|32):  objs=159675 size=9.01MiB
    /30N (5|27|32):  objs=148775 size=8.44MiB
    /31N (5|27|32):  objs=151649 size=8.55MiB
    /0/0N (2|25|36):  objs=36792 size=860.74KiB
    /0/1S (2|25|36):  objs=144 size=196B
    /0/2N (2|25|36):  objs=2651 size=11.21KiB
    /0/3N (2|25|36):  objs=41706 size=947.37KiB
    /0/4N (2|25|36):  objs=9780 size=55.14KiB
    /0/5S (2|25|36):  objs=163 size=320B
    /0/6N (2|25|36):  objs=27380 size=415.5KiB
    /0/7N (2|25|36):  objs=988 size=4.04KiB
    /0/8S (2|25|36):  objs=159 size=247B
    /0/9S (2|25|36):  objs=161 size=317B
    /0/10S (2|25|36):  objs=163 size=219B
    /0/11N (2|25|36):  objs=1348 size=5.38KiB
    /0/12S (2|25|36):  objs=145 size=337B
    /0/13N (2|25|36):  objs=2199 size=9.16KiB
    /0/14S (2|25|36):  objs=147 size=243B
    /0/15N (2|25|36):  objs=1270 size=5.1KiB
    /0/16S (2|25|36):  objs=160 size=149B
    /0/17N (2|25|36):  objs=3527 size=14.76KiB
    /0/18S (2|25|36):  objs=183 size=261B
    /0/19N (2|25|36):  objs=4216 size=19.73KiB
    /0/20S (2|25|36):  objs=152 size=132B
    /0/21N (2|25|36):  objs=435 size=1.51KiB
    /0/22S (2|25|36):  objs=160 size=100B
    /0/23N (2|25|36):  objs=4457 size=20.89KiB
    /0/24S (2|25|36):  objs=147 size=284B
    /0/25N (2|25|36):  objs=892 size=3.49KiB
    /0/26S (2|25|36):  objs=160 size=111B
    /0/27N (2|25|36):  objs=5364 size=23.4KiB
    /0/28S (2|25|36):  objs=146 size=279B
    /0/29N (2|25|36):  objs=3755 size=16.73KiB
    /0/30S (2|25|36):  objs=172 size=168B
    /0/31N (2|25|36):  objs=5891 size=30.34KiB
    /0/32S (2|25|36):  objs=152 size=131B
    /0/33N (2|25|36):  objs=1302 size=5.31KiB
    /0/34S (2|25|36):  objs=154 size=128B
    /0/35N (2|25|36):  objs=1843 size=7.75KiB
    /1/0N (2|25|36):  objs=42853 size=1.07MiB
    /1/1N (2|25|36):  objs=34272 size=652.13KiB
    /1/2N (2|25|36):  objs=41073 size=894.09KiB
    /1/4S (2|25|36):  objs=147 size=299B
    /1/5N (2|25|36):  objs=3694 size=16.67KiB
    /1/6S (2|25|36):  objs=148 size=303B
    /1/7N (2|25|36):  objs=2120 size=9.27KiB
    /1/8S (2|25|36):  objs=125 size=275B
    /1/9N (2|25|36):  objs=9542 size=52.92KiB
    /1/10S (2|25|36):  objs=161 size=303B
    /1/11N (2|25|36):  objs=454 size=1.66KiB
    /1/12S (2|25|36):  objs=146 size=145B
    /1/13N (2|25|36):  objs=1162 size=4.89KiB
    /1/14S (2|25|36):  objs=154 size=278B
    /1/15N (2|25|36):  objs=1572 size=6.42KiB
    /1/16S (2|25|36):  objs=145 size=293B
    /1/17N (2|25|36):  objs=1537 size=6.46KiB
    /1/18S (2|25|36):  objs=145 size=322B
    /1/19N (2|25|36):  objs=3090 size=13.73KiB
    /1/20S (2|25|36):  objs=134 size=295B
    /1/21S (2|25|36):  objs=153 size=328B
    /1/22S (2|25|36):  objs=148 size=83B
    /1/23N (2|25|36):  objs=2572 size=10.86KiB
    /1/24S (2|25|36):  objs=147 size=209B
    /1/25N (2|25|36):  objs=462 size=1.77KiB
    /1/26S (2|25|36):  objs=161 size=324B
    /1/27N (2|25|36):  objs=2664 size=11.13KiB
    /1/28S (2|25|36):  objs=155 size=110B
    /1/29N (2|25|36):  objs=1095 size=4.53KiB
    /1/30S (2|25|36):  objs=147 size=193B
    /1/31S (2|25|36):  objs=136 size=310B
    /1/32S (2|25|36):  objs=155 size=234B
    /1/33N (2|25|36):  objs=863 size=3.27KiB
    /1/34S (2|25|36):  objs=165 size=173B
    /1/35N (2|25|36):  objs=7145 size=33.8KiB
    /2/0N (2|25|36):  objs=10535 size=50.52KiB
    /2/1S (2|25|36):  objs=133 size=243B
    /2/2N (2|25|36):  objs=27369 size=429.72KiB
    /2/3N (2|25|36):  objs=38254 size=780.26KiB
    /2/4N (2|25|36):  objs=41405 size=976.6KiB
    /2/5N (2|25|36):  objs=18344 size=143.74KiB
    /2/6S (2|25|36):  objs=160 size=330B
    /2/7N (2|25|36):  objs=942 size=3.78KiB
    /2/8S (2|25|36):  objs=136 size=306B
    /2/9N (2|25|36):  objs=656 size=2.33KiB
    /2/10S (2|25|36):  objs=165 size=189B
    /2/12S (2|25|36):  objs=169 size=349B
    /2/13N (2|25|36):  objs=1067 size=4.03KiB
    /2/14S (2|25|36):  objs=143 size=185B
    /2/15N (2|25|36):  objs=1636 size=6.77KiB
    /2/16S (2|25|36):  objs=145 size=289B
    /2/17N (2|25|36):  objs=727 size=2.67KiB
    /2/18S (2|25|36):  objs=160 size=292B
    /2/19N (2|25|36):  objs=3333 size=15.29KiB
    /2/20S (2|25|36):  objs=160 size=320B
    /2/21N (2|25|36):  objs=2073 size=8.52KiB
    /2/22S (2|25|36):  objs=157 size=316B
    /2/23N (2|25|36):  objs=1011 size=4.01KiB
    /2/24S (2|25|36):  objs=149 size=95B
    /2/25N (2|25|36):  objs=4512 size=19.14KiB
    /2/26S (2|25|36):  objs=160 size=223B
    /2/27N (2|25|36):  objs=295 size=943B
    /2/28S (2|25|36):  objs=135 size=194B
    /2/29N (2|25|36):  objs=1369 size=5.43KiB
    /2/30S (2|25|36):  objs=165 size=198B
    /2/31N (2|25|36):  objs=1113 size=4.27KiB
    /2/32S (2|25|36):  objs=159 size=137B
    /2/33N (2|25|36):  objs=956 size=3.77KiB
    /2/34S (2|25|36):  objs=140 size=218B
    /2/35N (2|25|36):  objs=768 size=2.8KiB
    /3/0N (2|25|36):  objs=38585 size=927.55KiB
    /3/1N (2|25|36):  objs=35574 size=674.73KiB
    /3/2S (2|25|36):  objs=138 size=256B
    /3/3N (2|25|36):  objs=4440 size=22.31KiB
    /3/4N (2|25|36):  objs=38248 size=840.36KiB
    /3/5S (2|25|36):  objs=158 size=278B
    /3/6N (2|25|36):  objs=2760 size=12KiB
    /3/7N (2|25|36):  objs=1799 size=7.29KiB
    /3/8S (2|25|36):  objs=149 size=156B
    /3/9N (2|25|36):  objs=2957 size=12.47KiB
    /3/10S (2|25|36):  objs=147 size=242B
    /3/11N (2|25|36):  objs=2175 size=8.94KiB
    /3/12S (2|25|36):  objs=154 size=282B
    /3/13N (2|25|36):  objs=1372 size=5.46KiB
    /3/14S (2|25|36):  objs=172 size=333B
    /3/15N (2|25|36):  objs=1564 size=6.03KiB
    /3/16S (2|25|36):  objs=135 size=129B
    /3/17N (2|25|36):  objs=4996 size=23.01KiB
    /3/18S (2|25|36):  objs=152 size=137B
    /3/19N (2|25|36):  objs=6917 size=34.6KiB
    /3/20S (2|25|36):  objs=123 size=180B
    /3/21N (2|25|36):  objs=2225 size=9.14KiB
    /3/22S (2|25|36):  objs=170 size=283B
    /3/23N (2|25|36):  objs=2593 size=11.06KiB
    /3/24S (2|25|36):  objs=183 size=344B
    /3/25N (2|25|36):  objs=1525 size=6.23KiB
    /3/26S (2|25|36):  objs=155 size=92B
    /3/27N (2|25|36):  objs=1764 size=7.01KiB
    /3/28S (2|25|36):  objs=169 size=229B
    /3/29N (2|25|36):  objs=1315 size=5.4KiB
    /3/30S (2|25|36):  objs=153 size=286B
    /3/31N (2|25|36):  objs=3057 size=12.83KiB
    /3/32S (2|25|36):  objs=145 size=295B
    /3/33N (2|25|36):  objs=432 size=1.26KiB
    /3/34S (2|25|36):  objs=156 size=196B
    /3/35N (2|25|36):  objs=1321 size=5.15KiB
    /4/0N (2|25|36):  objs=42316 size=986.06KiB
    /4/1N (2|25|36):  objs=38471 size=879.79KiB
    /4/2N (2|25|36):  objs=42734 size=1014.06KiB
    /4/3N (2|25|36):  objs=4179 size=19.5KiB
    /4/4S (2|25|36):  objs=172 size=259B
    /4/5N (2|25|36):  objs=1041 size=4.29KiB
    /4/6S (2|25|36):  objs=145 size=324B
    /4/7N (2|25|36):  objs=630 size=2.35KiB
    /4/8S (2|25|36):  objs=164 size=181B
    /4/9N (2|25|36):  objs=788 size=3.04KiB
    /4/10S (2|25|36):  objs=145 size=222B
    /4/11N (2|25|36):  objs=2050 size=8.83KiB
    /4/12S (2|25|36):  objs=159 size=114B
    /4/13N (2|25|36):  objs=3682 size=16.08KiB
    /4/14S (2|25|36):  objs=158 size=112B
    /4/15N (2|25|36):  objs=288 size=854B
    /4/16S (2|25|36):  objs=150 size=314B
    /4/17N (2|25|36):  objs=4495 size=20.1KiB
    /4/18S (2|25|36):  objs=159 size=154B
    /4/19N (2|25|36):  objs=6726 size=32.87KiB
    /4/20S (2|25|36):  objs=122 size=231B
    /4/21N (2|25|36):  objs=4224 size=18.81KiB
    /4/22S (2|25|36):  objs=148 size=305B
    /4/23N (2|25|36):  objs=290 size=783B
    /4/24S (2|25|36):  objs=156 size=330B
    /4/26S (2|25|36):  objs=135 size=330B
    /4/27N (2|25|36):  objs=4930 size=22.06KiB
    /4/28S (2|25|36):  objs=157 size=333B
    /4/29S (2|25|36):  objs=141 size=256B
    /4/30S (2|25|36):  objs=169 size=97B
    /4/31N (2|25|36):  objs=746 size=3.09KiB
    /4/32S (2|25|36):  objs=155 size=288B
    /4/33N (2|25|36):  objs=1202 size=4.82KiB
    /4/34S (2|25|36):  objs=151 size=109B
    /4/35N (2|25|36):  objs=431 size=1.59KiB
    /5/0N (2|25|36):  objs=36833 size=709.83KiB
    /5/1N (2|25|36):  objs=37847 size=952.76KiB
    /5/2N (2|25|36):  objs=10681 size=58.89KiB
    /5/3S (2|25|36):  objs=170 size=349B
    /5/4N (2|25|36):  objs=22475 size=261.68KiB
    /5/5S (2|25|36):  objs=172 size=93B
    /5/6N (2|25|36):  objs=6588 size=33.07KiB
    /5/7N (2|25|36):  objs=12621 size=73.15KiB
    /5/8S (2|25|36):  objs=158 size=130B
    /5/9N (2|25|36):  objs=2308 size=9.65KiB
    /5/10S (2|25|36):  objs=152 size=123B
    /5/11N (2|25|36):  objs=918 size=3.68KiB
    /5/12S (2|25|36):  objs=176 size=356B
    /5/13N (2|25|36):  objs=3631 size=15.89KiB
    /5/14S (2|25|36):  objs=157 size=192B
    /5/15N (2|25|36):  objs=2641 size=11.05KiB
    /5/16S (2|25|36):  objs=145 size=240B
    /5/17N (2|25|36):  objs=2298 size=9.54KiB
    /5/18S (2|25|36):  objs=146 size=146B
    /5/19N (2|25|36):  objs=2372 size=10.23KiB
    /5/20S (2|25|36):  objs=170 size=293B
    /5/21N (2|25|36):  objs=3840 size=19.32KiB
    /5/22S (2|25|36):  objs=152 size=253B
    /5/23N (2|25|36):  objs=735 size=3.02KiB
    /5/24S (2|25|36):  objs=150 size=203B
    /5/25N (2|25|36):  objs=4134 size=18.69KiB
    /5/26S (2|25|36):  objs=169 size=157B
    /5/27N (2|25|36):  objs=890 size=3.34KiB
    /5/28S (2|25|36):  objs=139 size=292B
    /5/29N (2|25|36):  objs=1042 size=4.19KiB
    /5/30S (2|25|36):  objs=152 size=183B
    /5/31N (2|25|36):  objs=316 size=1.03KiB
    /5/32S (2|25|36):  objs=145 size=319B
    /5/33N (2|25|36):  objs=748 size=2.91KiB
    /5/34S (2|25|36):  objs=182 size=363B
    /6/0N (2|25|36):  objs=35970 size=701.46KiB
    /6/1S (2|25|36):  objs=145 size=93B
    /6/2N (2|25|36):  objs=6137 size=31.6KiB
    /6/3N (2|25|36):  objs=33795 size=568.05KiB
    /6/4N (2|25|36):  objs=19107 size=171.91KiB
    /6/5S (2|25|36):  objs=176 size=149B
    /6/6N (2|25|36):  objs=20146 size=198.88KiB
    /6/7N (2|25|36):  objs=4147 size=17.71KiB
    /6/8S (2|25|36):  objs=164 size=151B
    /6/9N (2|25|36):  objs=6008 size=27.07KiB
    /6/10S (2|25|36):  objs=138 size=201B
    /6/11N (2|25|36):  objs=3057 size=13.01KiB
    /6/12S (2|25|36):  objs=143 size=114B
    /6/13N (2|25|36):  objs=1276 size=5.01KiB
    /6/14S (2|25|36):  objs=169 size=180B
    /6/15N (2|25|36):  objs=3255 size=13.94KiB
    /6/16S (2|25|36):  objs=184 size=287B
    /6/17N (2|25|36):  objs=1482 size=6.25KiB
    /6/18S (2|25|36):  objs=147 size=172B
    /6/19N (2|25|36):  objs=4298 size=20.5KiB
    /6/20S (2|25|36):  objs=168 size=260B
    /6/21N (2|25|36):  objs=1071 size=4.24KiB
    /6/22S (2|25|36):  objs=149 size=317B
    /6/23N (2|25|36):  objs=3432 size=15.02KiB
    /6/24S (2|25|36):  objs=160 size=143B
    /6/25N (2|25|36):  objs=2816 size=11.86KiB
    /6/26S (2|25|36):  objs=176 size=196B
    /6/27N (2|25|36):  objs=288 size=876B
    /6/28S (2|25|36):  objs=168 size=107B
    /6/29N (2|25|36):  objs=3151 size=14.34KiB
    /6/30S (2|25|36):  objs=142 size=192B
    /6/31N (2|25|36):  objs=463 size=1.6KiB
    /6/32S (2|25|36):  objs=149 size=332B
    /6/33N (2|25|36):  objs=3962 size=17.4KiB
    /6/34S (2|25|36):  objs=145 size=158B
    /6/35N (2|25|36):  objs=880 size=3.55KiB
    /7/0N (2|25|36):  objs=40823 size=900.3KiB
    /7/1N (2|25|36):  objs=41090 size=977.74KiB
    /7/2N (2|25|36):  objs=40319 size=1.03MiB
    /7/3N (2|25|36):  objs=5509 size=24.44KiB
    /7/4S (2|25|36):  objs=157 size=330B
    /7/5N (2|25|36):  objs=455 size=1.46KiB
    /7/6S (2|25|36):  objs=161 size=300B
    /7/7N (2|25|36):  objs=1331 size=5.22KiB
    /7/8S (2|25|36):  objs=151 size=113B
    /7/9N (2|25|36):  objs=8347 size=44.7KiB
    /7/10S (2|25|36):  objs=153 size=107B
    /7/11N (2|25|36):  objs=2095 size=9.06KiB
    /7/12S (2|25|36):  objs=162 size=238B
    /7/13N (2|25|36):  objs=2136 size=8.78KiB
    /7/14S (2|25|36):  objs=151 size=119B
    /7/15N (2|25|36):  objs=4852 size=21.33KiB
    /7/16S (2|25|36):  objs=139 size=275B
    /7/17N (2|25|36):  objs=308 size=829B
    /7/18S (2|25|36):  objs=144 size=221B
    /7/19N (2|25|36):  objs=441 size=1.34KiB
    /7/20S (2|25|36):  objs=147 size=218B
    /7/21N (2|25|36):  objs=948 size=3.78KiB
    /7/22S (2|25|36):  objs=165 size=296B
    /7/23N (2|25|36):  objs=2373 size=10.42KiB
    /7/24S (2|25|36):  objs=164 size=122B
    /7/25S (2|25|36):  objs=156 size=216B
    /7/26S (2|25|36):  objs=196 size=356B
    /7/27N (2|25|36):  objs=739 size=2.69KiB
    /7/28S (2|25|36):  objs=148 size=238B
    /7/29N (2|25|36):  objs=580 size=2.18KiB
    /7/30S (2|25|36):  objs=160 size=225B
    /7/31N (2|25|36):  objs=586 size=2.09KiB
    /7/32S (2|25|36):  objs=153 size=100B
    /7/34S (2|25|36):  objs=163 size=356B
    /7/35N (2|25|36):  objs=5894 size=28.6KiB
    /8/0N (2|25|36):  objs=36330 size=733.08KiB
    /8/1N (2|25|36):  objs=41588 size=987.06KiB
    /8/2N (2|25|36):  objs=8587 size=48.09KiB
    /8/3S (2|25|36):  objs=151 size=207B
    /8/4N (2|25|36):  objs=16628 size=150.9KiB
    /8/5S (2|25|36):  objs=146 size=170B
    /8/6N (2|25|36):  objs=2624 size=11.19KiB
    /8/7S (2|25|36):  objs=163 size=293B
    /8/8N (2|25|36):  objs=8584 size=43.62KiB
    /8/9S (2|25|36):  objs=149 size=278B
    /8/10N (2|25|36):  objs=4909 size=22.57KiB
    /8/11N (2|25|36):  objs=1746 size=7.31KiB
    /8/12S (2|25|36):  objs=163 size=267B
    /8/13N (2|25|36):  objs=620 size=2.4KiB
    /8/14S (2|25|36):  objs=141 size=125B
    /8/15S (2|25|36):  objs=143 size=280B
    /8/16S (2|25|36):  objs=169 size=336B
    /8/17N (2|25|36):  objs=6634 size=33.83KiB
    /8/18S (2|25|36):  objs=155 size=225B
    /8/19N (2|25|36):  objs=4533 size=21.93KiB
    /8/20S (2|25|36):  objs=144 size=109B
    /8/21N (2|25|36):  objs=1818 size=7.47KiB
    /8/22S (2|25|36):  objs=150 size=332B
    /8/24S (2|25|36):  objs=148 size=248B
    /8/25N (2|25|36):  objs=8029 size=46.9KiB
    /8/26S (2|25|36):  objs=161 size=206B
    /8/27N (2|25|36):  objs=1658 size=6.79KiB
    /8/28S (2|25|36):  objs=166 size=87B
    /8/29N (2|25|36):  objs=289 size=946B
    /8/30S (2|25|36):  objs=152 size=271B
    /8/31N (2|25|36):  objs=1483 size=6.13KiB
    /8/32S (2|25|36):  objs=165 size=118B
    /8/33N (2|25|36):  objs=4867 size=21.89KiB
    /8/34S (2|25|36):  objs=163 size=335B
    /8/35N (2|25|36):  objs=4309 size=18.38KiB
    /9/0N (2|25|36):  objs=40918 size=1.05MiB
    /9/1N (2|25|36):  objs=39901 size=914.36KiB
    /9/2N (2|25|36):  objs=15205 size=102.97KiB
    /9/3S (2|25|36):  objs=159 size=113B
    /9/4N (2|25|36):  objs=26455 size=387KiB
    /9/5N (2|25|36):  objs=10008 size=55.45KiB
    /9/6S (2|25|36):  objs=144 size=314B
    /9/8S (2|25|36):  objs=170 size=300B
    /9/10S (2|25|36):  objs=138 size=255B
    /9/11N (2|25|36):  objs=307 size=985B
    /9/12S (2|25|36):  objs=164 size=220B
    /9/13N (2|25|36):  objs=1603 size=6.52KiB
    /9/14S (2|25|36):  objs=161 size=200B
    /9/15N (2|25|36):  objs=4952 size=25.1KiB
    /9/16S (2|25|36):  objs=148 size=126B
    /9/17N (2|25|36):  objs=745 size=2.89KiB
    /9/18S (2|25|36):  objs=148 size=334B
    /9/19N (2|25|36):  objs=3109 size=13.75KiB
    /9/20S (2|25|36):  objs=164 size=274B
    /9/21N (2|25|36):  objs=316 size=1.05KiB
    /9/22S (2|25|36):  objs=158 size=274B
    /9/23N (2|25|36):  objs=1068 size=4.27KiB
    /9/24S (2|25|36):  objs=139 size=305B
    /9/25N (2|25|36):  objs=2170 size=9KiB
    /9/26S (2|25|36):  objs=155 size=290B
    /9/27N (2|25|36):  objs=2172 size=9.72KiB
    /9/28S (2|25|36):  objs=167 size=301B
    /9/29N (2|25|36):  objs=4918 size=22.47KiB
    /9/30S (2|25|36):  objs=164 size=227B
    /9/31N (2|25|36):  objs=4105 size=18.87KiB
    /9/32S (2|25|36):  objs=148 size=309B
    /9/33N (2|25|36):  objs=594 size=2.13KiB
    /9/34S (2|25|36):  objs=151 size=200B
    /9/35N (2|25|36):  objs=634 size=2.35KiB
    /10/0N (2|25|36):  objs=38972 size=859.41KiB
    /10/1N (2|25|36):  objs=36739 size=743.96KiB
    /10/2N (2|25|36):  objs=42467 size=1.08MiB
    /10/3N (2|25|36):  objs=7883 size=39.17KiB
    /10/4S (2|25|36):  objs=154 size=271B
    /10/5N (2|25|36):  objs=913 size=3.87KiB
    /10/6S (2|25|36):  objs=176 size=137B
    /10/7N (2|25|36):  objs=2640 size=11.31KiB
    /10/8S (2|25|36):  objs=143 size=283B
    /10/9N (2|25|36):  objs=3732 size=17.23KiB
    /10/10S (2|25|36):  objs=155 size=280B
    /10/11S (2|25|36):  objs=152 size=265B
    /10/12S (2|25|36):  objs=132 size=233B
    /10/14S (2|25|36):  objs=154 size=204B
    /10/15N (2|25|36):  objs=1260 size=5.08KiB
    /10/16S (2|25|36):  objs=154 size=273B
    /10/17N (2|25|36):  objs=466 size=1.58KiB
    /10/18S (2|25|36):  objs=123 size=213B
    /10/19N (2|25|36):  objs=4499 size=19.71KiB
    /10/20S (2|25|36):  objs=151 size=278B
    /10/21N (2|25|36):  objs=2158 size=9.28KiB
    /10/22S (2|25|36):  objs=150 size=278B
    /10/23N (2|25|36):  objs=463 size=1.66KiB
    /10/24S (2|25|36):  objs=167 size=208B
    /10/25S (2|25|36):  objs=145 size=271B
    /10/26S (2|25|36):  objs=141 size=105B
    /10/27N (2|25|36):  objs=3362 size=14.79KiB
    /10/28S (2|25|36):  objs=136 size=277B
    /10/29N (2|25|36):  objs=3195 size=13.85KiB
    /10/30S (2|25|36):  objs=172 size=123B
    /10/31N (2|25|36):  objs=2720 size=11.89KiB
    /10/32S (2|25|36):  objs=162 size=324B
    /10/33N (2|25|36):  objs=1345 size=5.73KiB
    /10/34S (2|25|36):  objs=163 size=220B
    /10/35N (2|25|36):  objs=478 size=1.51KiB
    /11/0N (2|25|36):  objs=39410 size=809.25KiB
    /11/1N (2|25|36):  objs=39874 size=838.81KiB
    /11/2N (2|25|36):  objs=36760 size=818.6KiB
    /11/3S (2|25|36):  objs=170 size=157B
    /11/4N (2|25|36):  objs=1534 size=6.56KiB
    /11/5N (2|25|36):  objs=1366 size=5.59KiB
    /11/6S (2|25|36):  objs=154 size=332B
    /11/7N (2|25|36):  objs=2089 size=8.57KiB
    /11/8S (2|25|36):  objs=149 size=167B
    /11/9N (2|25|36):  objs=3339 size=14.86KiB
    /11/10S (2|25|36):  objs=150 size=324B
    /11/11N (2|25|36):  objs=294 size=808B
    /11/12S (2|25|36):  objs=131 size=246B
    /11/13N (2|25|36):  objs=309 size=775B
    /11/14S (2|25|36):  objs=147 size=279B
    /11/15N (2|25|36):  objs=3811 size=16.62KiB
    /11/16S (2|25|36):  objs=167 size=314B
    /11/17N (2|25|36):  objs=315 size=974B
    /11/18S (2|25|36):  objs=151 size=340B
    /11/19N (2|25|36):  objs=1675 size=6.69KiB
    /11/20S (2|25|36):  objs=153 size=191B
    /11/21N (2|25|36):  objs=6781 size=30.84KiB
    /11/22S (2|25|36):  objs=152 size=267B
    /11/23N (2|25|36):  objs=3679 size=15.66KiB
    /11/24S (2|25|36):  objs=150 size=183B
    /11/25N (2|25|36):  objs=2427 size=11.01KiB
    /11/26S (2|25|36):  objs=175 size=113B
    /11/27N (2|25|36):  objs=7001 size=42.83KiB
    /11/28S (2|25|36):  objs=162 size=338B
    /11/29N (2|25|36):  objs=2421 size=10.62KiB
    /11/30S (2|25|36):  objs=176 size=338B
    /11/31N (2|25|36):  objs=3311 size=15.38KiB
    /11/32S (2|25|36):  objs=158 size=173B
    /11/33N (2|25|36):  objs=2437 size=10.32KiB
    /11/34S (2|25|36):  objs=147 size=181B
    /11/35N (2|25|36):  objs=1053 size=4.17KiB
    /12/0N (2|25|36):  objs=37388 size=801.83KiB
    /12/1N (2|25|36):  objs=36640 size=750.73KiB
    /12/2N (2|25|36):  objs=24731 size=321.07KiB
    /12/3S (2|25|36):  objs=178 size=229B
    /12/4N (2|25|36):  objs=9322 size=50.83KiB
    /12/5S (2|25|36):  objs=160 size=127B
    /12/6N (2|25|36):  objs=1526 size=6.43KiB
    /12/7S (2|25|36):  objs=167 size=339B
    /12/8N (2|25|36):  objs=2129 size=8.82KiB
    /12/9N (2|25|36):  objs=5925 size=29.9KiB
    /12/10S (2|25|36):  objs=160 size=125B
    /12/11N (2|25|36):  objs=4418 size=22.47KiB
    /12/12S (2|25|36):  objs=140 size=118B
    /12/14S (2|25|36):  objs=155 size=264B
    /12/15N (2|25|36):  objs=4934 size=25.51KiB
    /12/16S (2|25|36):  objs=143 size=273B
    /12/17N (2|25|36):  objs=1213 size=4.8KiB
    /12/18S (2|25|36):  objs=172 size=239B
    /12/19N (2|25|36):  objs=5658 size=26.36KiB
    /12/20S (2|25|36):  objs=156 size=286B
    /12/21N (2|25|36):  objs=3262 size=15.28KiB
    /12/22S (2|25|36):  objs=156 size=222B
    /12/23S (2|25|36):  objs=129 size=307B
    /12/24S (2|25|36):  objs=147 size=134B
    /12/25N (2|25|36):  objs=962 size=3.88KiB
    /12/26S (2|25|36):  objs=158 size=242B
    /12/27N (2|25|36):  objs=2705 size=11.22KiB
    /12/28S (2|25|36):  objs=150 size=239B
    /12/29N (2|25|36):  objs=2747 size=11.61KiB
    /12/30S (2|25|36):  objs=141 size=317B
    /12/31S (2|25|36):  objs=149 size=158B
    /12/32S (2|25|36):  objs=157 size=100B
    /12/33N (2|25|36):  objs=293 size=759B
    /12/34S (2|25|36):  objs=158 size=90B
    /12/35N (2|25|36):  objs=872 size=3.46KiB
    /13/0N (2|25|36):  objs=43086 size=995.71KiB
    /13/1N (2|25|36):  objs=35794 size=811.23KiB
    /13/2N (2|25|36):  objs=37130 size=705.43KiB
    /13/3S (2|25|36):  objs=151 size=221B
    /13/4N (2|25|36):  objs=1476 size=6.32KiB
    /13/5N (2|25|36):  objs=1840 size=7.87KiB
    /13/6S (2|25|36):  objs=155 size=162B
    /13/7N (2|25|36):  objs=600 size=2.29KiB
    /13/8S (2|25|36):  objs=166 size=239B
    /13/9N (2|25|36):  objs=1107 size=4.38KiB
    /13/10S (2|25|36):  objs=131 size=222B
    /13/11N (2|25|36):  objs=1702 size=6.78KiB
    /13/12S (2|25|36):  objs=174 size=271B
    /13/13N (2|25|36):  objs=330 size=814B
    /13/14S (2|25|36):  objs=143 size=168B
    /13/16S (2|25|36):  objs=177 size=257B
    /13/17N (2|25|36):  objs=2975 size=12.56KiB
    /13/18S (2|25|36):  objs=166 size=245B
    /13/19N (2|25|36):  objs=1505 size=6.18KiB
    /13/20S (2|25|36):  objs=146 size=115B
    /13/21N (2|25|36):  objs=441 size=1.27KiB
    /13/22S (2|25|36):  objs=169 size=213B
    /13/23S (2|25|36):  objs=138 size=111B
    /13/24S (2|25|36):  objs=166 size=220B
    /13/25N (2|25|36):  objs=9522 size=48.15KiB
    /13/26S (2|25|36):  objs=130 size=208B
    /13/27N (2|25|36):  objs=446 size=1.42KiB
    /13/28S (2|25|36):  objs=143 size=108B
    /13/30S (2|25|36):  objs=152 size=148B
    /13/31N (2|25|36):  objs=11320 size=73.88KiB
    /13/32S (2|25|36):  objs=174 size=138B
    /13/33N (2|25|36):  objs=1662 size=6.63KiB
    /13/34S (2|25|36):  objs=137 size=186B
    /13/35N (2|25|36):  objs=2223 size=9.07KiB
    /14/0N (2|25|36):  objs=41912 size=1002.62KiB
    /14/1N (2|25|36):  objs=37178 size=803.6KiB
    /14/2N (2|25|36):  objs=37791 size=848.43KiB
    /14/3N (2|25|36):  objs=6050 size=28.72KiB
    /14/4S (2|25|36):  objs=139 size=267B
    /14/6S (2|25|36):  objs=148 size=101B
    /14/7N (2|25|36):  objs=1500 size=6.32KiB
    /14/8S (2|25|36):  objs=149 size=233B
    /14/9N (2|25|36):  objs=745 size=2.82KiB
    /14/10S (2|25|36):  objs=153 size=270B
    /14/11N (2|25|36):  objs=324 size=1.13KiB
    /14/12S (2|25|36):  objs=148 size=156B
    /14/13S (2|25|36):  objs=156 size=257B
    /14/14S (2|25|36):  objs=139 size=248B
    /14/15N (2|25|36):  objs=2896 size=12.94KiB
    /14/16S (2|25|36):  objs=167 size=183B
    /14/17N (2|25|36):  objs=2132 size=8.73KiB
    /14/18S (2|25|36):  objs=141 size=242B
    /14/19N (2|25|36):  objs=3944 size=16.78KiB
    /14/20S (2|25|36):  objs=125 size=102B
    /14/21N (2|25|36):  objs=1974 size=8.22KiB
    /14/22S (2|25|36):  objs=161 size=177B
    /14/23N (2|25|36):  objs=3659 size=15.78KiB
    /14/24S (2|25|36):  objs=135 size=246B
    /14/25N (2|25|36):  objs=6283 size=28.53KiB
    /14/26S (2|25|36):  objs=165 size=194B
    /14/27N (2|25|36):  objs=278 size=843B
    /14/28S (2|25|36):  objs=141 size=131B
    /14/29N (2|25|36):  objs=4206 size=17.96KiB
    /14/30S (2|25|36):  objs=146 size=164B
    /14/31N (2|25|36):  objs=1429 size=5.79KiB
    /14/32S (2|25|36):  objs=157 size=302B
    /14/33N (2|25|36):  objs=2610 size=12.28KiB
    /14/34S (2|25|36):  objs=174 size=333B
    /14/35N (2|25|36):  objs=1072 size=4.39KiB
    /15/0N (2|25|36):  objs=35533 size=637.27KiB
    /15/1N (2|25|36):  objs=34528 size=626.53KiB
    /15/2S (2|25|36):  objs=167 size=106B
    /15/3N (2|25|36):  objs=5072 size=27.35KiB
    /15/4N (2|25|36):  objs=37955 size=725.73KiB
    /15/5N (2|25|36):  objs=10046 size=60.44KiB
    /15/6S (2|25|36):  objs=152 size=285B
    /15/7N (2|25|36):  objs=2133 size=9.4KiB
    /15/8S (2|25|36):  objs=161 size=325B
    /15/9N (2|25|36):  objs=1531 size=6.42KiB
    /15/10S (2|25|36):  objs=143 size=318B
    /15/11N (2|25|36):  objs=894 size=3.42KiB
    /15/12S (2|25|36):  objs=165 size=234B
    /15/13N (2|25|36):  objs=1222 size=4.91KiB
    /15/14S (2|25|36):  objs=149 size=312B
    /15/15N (2|25|36):  objs=4678 size=20.83KiB
    /15/16S (2|25|36):  objs=137 size=325B
    /15/17N (2|25|36):  objs=880 size=3.55KiB
    /15/18S (2|25|36):  objs=161 size=332B
    /15/19N (2|25|36):  objs=932 size=3.42KiB
    /15/20S (2|25|36):  objs=152 size=149B
    /15/22S (2|25|36):  objs=164 size=176B
    /15/23N (2|25|36):  objs=1298 size=5.32KiB
    /15/24S (2|25|36):  objs=144 size=185B
    /15/25N (2|25|36):  objs=898 size=3.43KiB
    /15/26S (2|25|36):  objs=176 size=131B
    /15/27N (2|25|36):  objs=864 size=3.39KiB
    /15/28S (2|25|36):  objs=140 size=216B
    /15/29N (2|25|36):  objs=2754 size=11.52KiB
    /15/30S (2|25|36):  objs=161 size=265B
    /15/31N (2|25|36):  objs=4037 size=18.77KiB
    /15/32S (2|25|36):  objs=150 size=176B
    /15/33N (2|25|36):  objs=601 size=2.32KiB
    /15/34S (2|25|36):  objs=147 size=201B
    /15/35N (2|25|36):  objs=2916 size=12.56KiB
    /16/0N (2|25|36):  objs=40092 size=972.08KiB
    /16/1N (2|25|36):  objs=38225 size=820.04KiB
    /16/2N (2|25|36):  objs=36357 size=709.94KiB
    /16/3N (2|25|36):  objs=4707 size=20.31KiB
    /16/4S (2|25|36):  objs=168 size=319B
    /16/5N (2|25|36):  objs=1417 size=5.74KiB
    /16/6S (2|25|36):  objs=144 size=153B
    /16/7N (2|25|36):  objs=1900 size=7.97KiB
    /16/8S (2|25|36):  objs=156 size=220B
    /16/9N (2|25|36):  objs=1732 size=7.3KiB
    /16/10S (2|25|36):  objs=169 size=261B
    /16/11N (2|25|36):  objs=3301 size=15.8KiB
    /16/12S (2|25|36):  objs=155 size=149B
    /16/13N (2|25|36):  objs=3227 size=14.12KiB
    /16/14S (2|25|36):  objs=128 size=298B
    /16/15N (2|25|36):  objs=1726 size=7.19KiB
    /16/16S (2|25|36):  objs=152 size=217B
    /16/17N (2|25|36):  objs=1960 size=8.26KiB
    /16/18S (2|25|36):  objs=143 size=141B
    /16/20S (2|25|36):  objs=168 size=184B
    /16/21N (2|25|36):  objs=4624 size=22.07KiB
    /16/22S (2|25|36):  objs=148 size=274B
    /16/23N (2|25|36):  objs=294 size=866B
    /16/24S (2|25|36):  objs=142 size=310B
    /16/25N (2|25|36):  objs=772 size=2.7KiB
    /16/26S (2|25|36):  objs=155 size=242B
    /16/27N (2|25|36):  objs=1500 size=6.41KiB
    /16/28S (2|25|36):  objs=146 size=235B
    /16/29N (2|25|36):  objs=1186 size=4.67KiB
    /16/30S (2|25|36):  objs=144 size=207B
    /16/31N (2|25|36):  objs=440 size=1.48KiB
    /16/32S (2|25|36):  objs=162 size=170B
    /16/33N (2|25|36):  objs=3576 size=16.52KiB
    /16/34S (2|25|36):  objs=161 size=132B
    /16/35N (2|25|36):  objs=3993 size=19.86KiB
    /17/0N (2|25|36):  objs=39013 size=870.19KiB
    /17/1N (2|25|36):  objs=40337 size=875.38KiB
    /17/2N (2|25|36):  objs=28186 size=400.96KiB
    /17/3S (2|25|36):  objs=167 size=167B
    /17/4N (2|25|36):  objs=3267 size=14.15KiB
    /17/5S (2|25|36):  objs=166 size=119B
    /17/6N (2|25|36):  objs=7011 size=36.82KiB
    /17/7N (2|25|36):  objs=1053 size=4.28KiB
    /17/8S (2|25|36):  objs=134 size=85B
    /17/9N (2|25|36):  objs=8690 size=51.8KiB
    /17/10S (2|25|36):  objs=159 size=310B
    /17/11N (2|25|36):  objs=736 size=2.81KiB
    /17/12S (2|25|36):  objs=134 size=207B
    /17/13N (2|25|36):  objs=4385 size=22.63KiB
    /17/14S (2|25|36):  objs=158 size=239B
    /17/15N (2|25|36):  objs=666 size=2.36KiB
    /17/16S (2|25|36):  objs=146 size=214B
    /17/17N (2|25|36):  objs=3679 size=15.68KiB
    /17/18S (2|25|36):  objs=159 size=307B
    /17/19N (2|25|36):  objs=942 size=3.61KiB
    /17/20S (2|25|36):  objs=158 size=305B
    /17/21N (2|25|36):  objs=3040 size=13.66KiB
    /17/22S (2|25|36):  objs=142 size=124B
    /17/23N (2|25|36):  objs=1226 size=5.09KiB
    /17/24S (2|25|36):  objs=172 size=203B
    /17/25N (2|25|36):  objs=1072 size=4.23KiB
    /17/26S (2|25|36):  objs=137 size=269B
    /17/27N (2|25|36):  objs=3128 size=13.2KiB
    /17/28S (2|25|36):  objs=150 size=167B
    /17/29N (2|25|36):  objs=3188 size=13.45KiB
    /17/30S (2|25|36):  objs=148 size=202B
    /17/31N (2|25|36):  objs=2101 size=9.02KiB
    /17/32S (2|25|36):  objs=159 size=307B
    /17/33N (2|25|36):  objs=3180 size=14.39KiB
    /17/34S (2|25|36):  objs=145 size=204B
    /17/35N (2|25|36):  objs=295 size=934B
    /18/0N (2|25|36):  objs=35171 size=741.22KiB
    /18/1N (2|25|36):  objs=37118 size=684.07KiB
    /18/2N (2|25|36):  objs=37527 size=794.03KiB
    /18/3N (2|25|36):  objs=5097 size=22.27KiB
    /18/4S (2|25|36):  objs=141 size=286B
    /18/5N (2|25|36):  objs=1222 size=4.82KiB
    /18/6S (2|25|36):  objs=146 size=111B
    /18/7N (2|25|36):  objs=1422 size=5.93KiB
    /18/8S (2|25|36):  objs=148 size=111B
    /18/9N (2|25|36):  objs=735 size=2.95KiB
    /18/10S (2|25|36):  objs=162 size=192B
    /18/11N (2|25|36):  objs=753 size=2.87KiB
    /18/12S (2|25|36):  objs=154 size=286B
    /18/13N (2|25|36):  objs=6804 size=33.18KiB
    /18/14S (2|25|36):  objs=152 size=320B
    /18/15N (2|25|36):  objs=1415 size=5.94KiB
    /18/16S (2|25|36):  objs=161 size=312B
    /18/17N (2|25|36):  objs=427 size=1.34KiB
    /18/18S (2|25|36):  objs=136 size=227B
    /18/19N (2|25|36):  objs=3033 size=13KiB
    /18/20S (2|25|36):  objs=164 size=173B
    /18/21N (2|25|36):  objs=2825 size=12.04KiB
    /18/22S (2|25|36):  objs=150 size=197B
    /18/23N (2|25|36):  objs=614 size=2.09KiB
    /18/24S (2|25|36):  objs=138 size=82B
    /18/26S (2|25|36):  objs=175 size=297B
    /18/27N (2|25|36):  objs=4395 size=19.56KiB
    /18/28S (2|25|36):  objs=165 size=141B
    /18/29N (2|25|36):  objs=454 size=1.61KiB
    /18/30S (2|25|36):  objs=148 size=292B
    /18/31N (2|25|36):  objs=446 size=1.45KiB
    /18/32S (2|25|36):  objs=138 size=312B
    /18/33S (2|25|36):  objs=150 size=280B
    /18/34S (2|25|36):  objs=144 size=318B
    /18/35N (2|25|36):  objs=3825 size=18.67KiB
    /19/0N (2|25|36):  objs=36179 size=664.57KiB
    /19/1N (2|25|36):  objs=39016 size=918.37KiB
    /19/2N (2|25|36):  objs=39297 size=918.95KiB
    /19/3N (2|25|36):  objs=16341 size=115.89KiB
    /19/4S (2|25|36):  objs=131 size=101B
    /19/6S (2|25|36):  objs=172 size=239B
    /19/7S (2|25|36):  objs=149 size=242B
    /19/8S (2|25|36):  objs=163 size=141B
    /19/9N (2|25|36):  objs=633 size=2.2KiB
    /19/10S (2|25|36):  objs=162 size=332B
    /19/11N (2|25|36):  objs=4257 size=19.87KiB
    /19/12S (2|25|36):  objs=152 size=96B
    /19/13N (2|25|36):  objs=2617 size=11.38KiB
    /19/14S (2|25|36):  objs=161 size=286B
    /19/15N (2|25|36):  objs=1026 size=4.02KiB
    /19/16S (2|25|36):  objs=176 size=127B
    /19/17N (2|25|36):  objs=3251 size=15.12KiB
    /19/18S (2|25|36):  objs=137 size=258B
    /19/19N (2|25|36):  objs=1034 size=4.24KiB
    /19/20S (2|25|36):  objs=164 size=140B
    /19/21N (2|25|36):  objs=1521 size=6.37KiB
    /19/22S (2|25|36):  objs=155 size=270B
    /19/24S (2|25|36):  objs=159 size=234B
    /19/25N (2|25|36):  objs=1112 size=4.26KiB
    /19/26S (2|25|36):  objs=182 size=186B
    /19/27N (2|25|36):  objs=3366 size=15.35KiB
    /19/28S (2|25|36):  objs=140 size=192B
    /19/29N (2|25|36):  objs=966 size=3.7KiB
    /19/30S (2|25|36):  objs=143 size=204B
    /19/31N (2|25|36):  objs=3730 size=15.56KiB
    /19/32S (2|25|36):  objs=149 size=235B
    /19/33S (2|25|36):  objs=137 size=304B
    /19/34S (2|25|36):  objs=161 size=223B
    /19/35N (2|25|36):  objs=752 size=2.84KiB
    /20/0N (2|25|36):  objs=32483 size=617.81KiB
    /20/1N (2|25|36):  objs=42413 size=1.05MiB
    /20/2N (2|25|36):  objs=36236 size=738.85KiB
    /20/3S (2|25|36):  objs=151 size=249B
    /20/4N (2|25|36):  objs=4824 size=20.87KiB
    /20/5N (2|25|36):  objs=3559 size=14.99KiB
    /20/6S (2|25|36):  objs=166 size=288B
    /20/7S (2|25|36):  objs=155 size=267B
    /20/8S (2|25|36):  objs=150 size=169B
    /20/9N (2|25|36):  objs=565 size=1.95KiB
    /20/10S (2|25|36):  objs=146 size=276B
    /20/11N (2|25|36):  objs=1478 size=6.2KiB
    /20/12S (2|25|36):  objs=153 size=261B
    /20/13N (2|25|36):  objs=2231 size=9.21KiB
    /20/14S (2|25|36):  objs=151 size=167B
    /20/15N (2|25|36):  objs=5999 size=27.45KiB
    /20/16S (2|25|36):  objs=166 size=160B
    /20/17N (2|25|36):  objs=870 size=3.4KiB
    /20/18S (2|25|36):  objs=177 size=154B
    /20/19N (2|25|36):  objs=6293 size=32.26KiB
    /20/20S (2|25|36):  objs=160 size=301B
    /20/21N (2|25|36):  objs=2347 size=10.2KiB
    /20/22S (2|25|36):  objs=159 size=119B
    /20/23N (2|25|36):  objs=1594 size=6.87KiB
    /20/24S (2|25|36):  objs=145 size=87B
    /20/25N (2|25|36):  objs=4695 size=20.38KiB
    /20/26S (2|25|36):  objs=157 size=324B
    /20/27N (2|25|36):  objs=603 size=2.42KiB
    /20/28S (2|25|36):  objs=167 size=314B
    /20/29N (2|25|36):  objs=1197 size=4.68KiB
    /20/30S (2|25|36):  objs=154 size=209B
    /20/31N (2|25|36):  objs=754 size=2.91KiB
    /20/32S (2|25|36):  objs=164 size=254B
    /20/33N (2|25|36):  objs=2671 size=11.27KiB
    /20/34S (2|25|36):  objs=128 size=194B
    /20/35N (2|25|36):  objs=280 size=938B
    /21/0N (2|25|36):  objs=40162 size=977.67KiB
    /21/1N (2|25|36):  objs=36097 size=733.19KiB
    /21/2N (2|25|36):  objs=40770 size=853.31KiB
    /21/3N (2|25|36):  objs=12044 size=65.51KiB
    /21/4S (2|25|36):  objs=143 size=85B
    /21/5N (2|25|36):  objs=463 size=1.64KiB
    /21/6S (2|25|36):  objs=134 size=296B
    /21/7N (2|25|36):  objs=445 size=1.54KiB
    /21/8S (2|25|36):  objs=150 size=313B
    /21/9N (2|25|36):  objs=285 size=770B
    /21/10S (2|25|36):  objs=157 size=307B
    /21/11N (2|25|36):  objs=2448 size=10.18KiB
    /21/12S (2|25|36):  objs=149 size=346B
    /21/13N (2|25|36):  objs=322 size=915B
    /21/14S (2|25|36):  objs=136 size=192B
    /21/15N (2|25|36):  objs=2080 size=9.07KiB
    /21/16S (2|25|36):  objs=150 size=133B
    /21/17N (2|25|36):  objs=1633 size=6.83KiB
    /21/18S (2|25|36):  objs=163 size=165B
    /21/19S (2|25|36):  objs=170 size=209B
    /21/20S (2|25|36):  objs=159 size=113B
    /21/21N (2|25|36):  objs=1715 size=7.17KiB
    /21/22S (2|25|36):  objs=139 size=256B
    /21/23N (2|25|36):  objs=1209 size=4.68KiB
    /21/24S (2|25|36):  objs=149 size=237B
    /21/25N (2|25|36):  objs=1528 size=6.26KiB
    /21/26S (2|25|36):  objs=141 size=275B
    /21/27N (2|25|36):  objs=903 size=3.53KiB
    /21/28S (2|25|36):  objs=161 size=148B
    /21/29N (2|25|36):  objs=444 size=1.52KiB
    /21/30S (2|25|36):  objs=150 size=213B
    /21/31N (2|25|36):  objs=1617 size=6.42KiB
    /21/32S (2|25|36):  objs=157 size=289B
    /21/33N (2|25|36):  objs=2419 size=12.29KiB
    /21/34S (2|25|36):  objs=135 size=269B
    /21/35N (2|25|36):  objs=3080 size=13.85KiB
    /22/0N (2|25|36):  objs=40478 size=891.18KiB
    /22/1N (2|25|36):  objs=39936 size=841KiB
    /22/2N (2|25|36):  objs=32591 size=680.36KiB
    /22/3S (2|25|36):  objs=151 size=87B
    /22/4N (2|25|36):  objs=5883 size=28.18KiB
    /22/5N (2|25|36):  objs=5128 size=22.39KiB
    /22/6S (2|25|36):  objs=140 size=232B
    /22/8S (2|25|36):  objs=144 size=330B
    /22/9N (2|25|36):  objs=1929 size=8.04KiB
    /22/10S (2|25|36):  objs=149 size=142B
    /22/11N (2|25|36):  objs=6332 size=33.3KiB
    /22/12S (2|25|36):  objs=163 size=275B
    /22/13N (2|25|36):  objs=3405 size=14.78KiB
    /22/14S (2|25|36):  objs=158 size=263B
    /22/15N (2|25|36):  objs=1653 size=6.56KiB
    /22/16S (2|25|36):  objs=165 size=104B
    /22/17N (2|25|36):  objs=2790 size=12.09KiB
    /22/18S (2|25|36):  objs=157 size=193B
    /22/19N (2|25|36):  objs=465 size=1.43KiB
    /22/20S (2|25|36):  objs=160 size=102B
    /22/21N (2|25|36):  objs=1147 size=4.19KiB
    /22/22S (2|25|36):  objs=166 size=276B
    /22/23S (2|25|36):  objs=159 size=284B
    /22/24S (2|25|36):  objs=128 size=286B
    /22/25N (2|25|36):  objs=2175 size=8.95KiB
    /22/26S (2|25|36):  objs=155 size=255B
    /22/27N (2|25|36):  objs=1012 size=4.3KiB
    /22/28S (2|25|36):  objs=154 size=270B
    /22/29N (2|25|36):  objs=2011 size=8.46KiB
    /22/30S (2|25|36):  objs=163 size=166B
    /22/31N (2|25|36):  objs=1334 size=5.42KiB
    /22/32S (2|25|36):  objs=168 size=254B
    /22/33N (2|25|36):  objs=2756 size=12.63KiB
    /22/34S (2|25|36):  objs=174 size=175B
    /22/35N (2|25|36):  objs=5562 size=32.82KiB
    /23/0N (2|25|36):  objs=39198 size=901.07KiB
    /23/1N (2|25|36):  objs=39829 size=871.29KiB
    /23/2N (2|25|36):  objs=32519 size=550.5KiB
    /23/3S (2|25|36):  objs=166 size=299B
    /23/4N (2|25|36):  objs=885 size=3.15KiB
    /23/5S (2|25|36):  objs=147 size=142B
    /23/6N (2|25|36):  objs=324 size=814B
    /23/7S (2|25|36):  objs=145 size=268B
    /23/8N (2|25|36):  objs=274 size=871B
    /23/9S (2|25|36):  objs=183 size=93B
    /23/10N (2|25|36):  objs=3215 size=13.38KiB
    /23/11S (2|25|36):  objs=137 size=134B
    /23/12N (2|25|36):  objs=303 size=816B
    /23/13S (2|25|36):  objs=178 size=186B
    /23/14N (2|25|36):  objs=444 size=1.62KiB
    /23/15N (2|25|36):  objs=304 size=889B
    /23/16S (2|25|36):  objs=150 size=118B
    /23/17N (2|25|36):  objs=6494 size=35.03KiB
    /23/18S (2|25|36):  objs=153 size=98B
    /23/19N (2|25|36):  objs=7053 size=35.07KiB
    /23/20S (2|25|36):  objs=149 size=97B
    /23/21N (2|25|36):  objs=4821 size=22.59KiB
    /23/22S (2|25|36):  objs=147 size=123B
    /23/23N (2|25|36):  objs=481 size=1.49KiB
    /23/24S (2|25|36):  objs=163 size=136B
    /23/25N (2|25|36):  objs=1261 size=4.99KiB
    /23/26S (2|25|36):  objs=146 size=291B
    /23/27N (2|25|36):  objs=748 size=2.9KiB
    /23/28S (2|25|36):  objs=160 size=188B
    /23/29N (2|25|36):  objs=3458 size=15.21KiB
    /23/30S (2|25|36):  objs=142 size=96B
    /23/31N (2|25|36):  objs=2432 size=10.28KiB
    /23/32S (2|25|36):  objs=159 size=123B
    /23/33N (2|25|36):  objs=4030 size=17.71KiB
    /23/34S (2|25|36):  objs=135 size=176B
    /23/35N (2|25|36):  objs=2132 size=9.24KiB
    /24/0N (2|25|36):  objs=37052 size=895.81KiB
    /24/1N (2|25|36):  objs=40869 size=973.84KiB
    /24/2N (2|25|36):  objs=33883 size=670.77KiB
    /24/3S (2|25|36):  objs=153 size=102B
    /24/4N (2|25|36):  objs=2440 size=10.34KiB
    /24/5N (2|25|36):  objs=11962 size=65.6KiB
    /24/6S (2|25|36):  objs=128 size=278B
    /24/7N (2|25|36):  objs=463 size=1.49KiB
    /24/8S (2|25|36):  objs=143 size=300B
    /24/9N (2|25|36):  objs=1349 size=5.55KiB
    /24/10S (2|25|36):  objs=173 size=196B
    /24/11N (2|25|36):  objs=918 size=3.52KiB
    /24/12S (2|25|36):  objs=154 size=144B
    /24/13N (2|25|36):  objs=1047 size=4.03KiB
    /24/14S (2|25|36):  objs=135 size=282B
    /24/15N (2|25|36):  objs=2102 size=8.76KiB
    /24/16S (2|25|36):  objs=151 size=157B
    /24/17N (2|25|36):  objs=6191 size=34.85KiB
    /24/18S (2|25|36):  objs=128 size=256B
    /24/19N (2|25|36):  objs=1060 size=4.27KiB
    /24/20S (2|25|36):  objs=139 size=211B
    /24/21N (2|25|36):  objs=2328 size=9.61KiB
    /24/22S (2|25|36):  objs=147 size=145B
    /24/23N (2|25|36):  objs=5347 size=24.7KiB
    /24/24S (2|25|36):  objs=136 size=290B
    /24/25N (2|25|36):  objs=1242 size=4.93KiB
    /24/26S (2|25|36):  objs=145 size=236B
    /24/27S (2|25|36):  objs=155 size=269B
    /24/28S (2|25|36):  objs=152 size=165B
    /24/29N (2|25|36):  objs=1342 size=5.73KiB
    /24/30S (2|25|36):  objs=149 size=175B
    /24/31N (2|25|36):  objs=1648 size=6.78KiB
    /24/32S (2|25|36):  objs=168 size=342B
    /24/33N (2|25|36):  objs=2332 size=9.81KiB
    /24/34S (2|25|36):  objs=175 size=322B
    /24/35S (2|25|36):  objs=133 size=125B
    /25/0N (2|25|36):  objs=35979 size=714.07KiB
    /25/1N (2|25|36):  objs=15006 size=108.67KiB
    /25/2S (2|25|36):  objs=150 size=190B
    /25/3N (2|25|36):  objs=24910 size=349.7KiB
    /25/4N (2|25|36):  objs=38605 size=969.01KiB
    /25/5N (2|25|36):  objs=14509 size=87.22KiB
    /25/6S (2|25|36):  objs=154 size=336B
    /25/7N (2|25|36):  objs=1059 size=4.4KiB
    /25/8S (2|25|36):  objs=151 size=121B
    /25/9N (2|25|36):  objs=3561 size=15.57KiB
    /25/10S (2|25|36):  objs=139 size=286B
    /25/11N (2|25|36):  objs=749 size=2.78KiB
    /25/12S (2|25|36):  objs=149 size=273B
    /25/13N (2|25|36):  objs=275 size=900B
    /25/14S (2|25|36):  objs=148 size=127B
    /25/15N (2|25|36):  objs=5007 size=22.79KiB
    /25/16S (2|25|36):  objs=155 size=247B
    /25/18S (2|25|36):  objs=158 size=255B
    /25/19N (2|25|36):  objs=1854 size=7.78KiB
    /25/20S (2|25|36):  objs=157 size=173B
    /25/21N (2|25|36):  objs=1308 size=5.47KiB
    /25/22S (2|25|36):  objs=151 size=91B
    /25/23N (2|25|36):  objs=760 size=2.92KiB
    /25/24S (2|25|36):  objs=169 size=348B
    /25/25N (2|25|36):  objs=768 size=2.97KiB
    /25/26S (2|25|36):  objs=148 size=216B
    /25/27N (2|25|36):  objs=2669 size=11.52KiB
    /25/28S (2|25|36):  objs=140 size=317B
    /25/29N (2|25|36):  objs=3804 size=17.47KiB
    /25/30S (2|25|36):  objs=144 size=322B
    /25/31N (2|25|36):  objs=1228 size=4.77KiB
    /25/32S (2|25|36):  objs=144 size=273B
    /25/33N (2|25|36):  objs=1290 size=5.26KiB
    /25/34S (2|25|36):  objs=156 size=293B
    /25/35N (2|25|36):  objs=1382 size=5.72KiB
    /26/0N (2|25|36):  objs=39203 size=878.21KiB
    /26/1N (2|25|36):  objs=39298 size=854.25KiB
    /26/2N (2|25|36):  objs=39504 size=1001.22KiB
    /26/3S (2|25|36):  objs=151 size=165B
    /26/4S (2|25|36):  objs=177 size=126B
    /26/5N (2|25|36):  objs=302 size=1.02KiB
    /26/6S (2|25|36):  objs=162 size=320B
    /26/7N (2|25|36):  objs=2752 size=11.45KiB
    /26/8S (2|25|36):  objs=121 size=234B
    /26/9N (2|25|36):  objs=2662 size=11.24KiB
    /26/10S (2|25|36):  objs=131 size=188B
    /26/11N (2|25|36):  objs=745 size=2.73KiB
    /26/12S (2|25|36):  objs=160 size=144B
    /26/13N (2|25|36):  objs=1590 size=6.3KiB
    /26/14S (2|25|36):  objs=131 size=298B
    /26/15N (2|25|36):  objs=2697 size=12.09KiB
    /26/16S (2|25|36):  objs=143 size=323B
    /26/17N (2|25|36):  objs=3784 size=16.2KiB
    /26/18S (2|25|36):  objs=157 size=134B
    /26/19N (2|25|36):  objs=4261 size=18.42KiB
    /26/20S (2|25|36):  objs=158 size=158B
    /26/21N (2|25|36):  objs=2286 size=9.5KiB
    /26/22S (2|25|36):  objs=149 size=89B
    /26/23S (2|25|36):  objs=154 size=163B
    /26/24S (2|25|36):  objs=161 size=343B
    /26/25N (2|25|36):  objs=294 size=942B
    /26/26S (2|25|36):  objs=170 size=120B
    /26/27N (2|25|36):  objs=2654 size=11.12KiB
    /26/28S (2|25|36):  objs=148 size=150B
    /26/29N (2|25|36):  objs=3482 size=16.92KiB
    /26/30S (2|25|36):  objs=150 size=195B
    /26/31N (2|25|36):  objs=5816 size=27.61KiB
    /26/32S (2|25|36):  objs=146 size=295B
    /26/33N (2|25|36):  objs=907 size=3.57KiB
    /26/34S (2|25|36):  objs=145 size=305B
    /27/0N (2|25|36):  objs=39435 size=874.29KiB
    /27/1N (2|25|36):  objs=43030 size=1006.6KiB
    /27/2N (2|25|36):  objs=38655 size=747.66KiB
    /27/3S (2|25|36):  objs=169 size=110B
    /27/4N (2|25|36):  objs=3941 size=17.09KiB
    /27/5N (2|25|36):  objs=5974 size=25.95KiB
    /27/6S (2|25|36):  objs=150 size=317B
    /27/7N (2|25|36):  objs=1077 size=4.12KiB
    /27/8S (2|25|36):  objs=163 size=319B
    /27/9N (2|25|36):  objs=915 size=3.73KiB
    /27/10S (2|25|36):  objs=165 size=318B
    /27/11N (2|25|36):  objs=499 size=1.7KiB
    /27/12S (2|25|36):  objs=155 size=86B
    /27/13S (2|25|36):  objs=164 size=361B
    /27/14S (2|25|36):  objs=158 size=277B
    /27/15N (2|25|36):  objs=291 size=842B
    /27/16S (2|25|36):  objs=145 size=321B
    /27/17N (2|25|36):  objs=1057 size=4.31KiB
    /27/18S (2|25|36):  objs=165 size=214B
    /27/19N (2|25|36):  objs=3312 size=14.47KiB
    /27/20S (2|25|36):  objs=174 size=301B
    /27/21N (2|25|36):  objs=4082 size=18.88KiB
    /27/22S (2|25|36):  objs=157 size=100B
    /27/23N (2|25|36):  objs=10919 size=65.67KiB
    /27/24S (2|25|36):  objs=161 size=157B
    /27/25N (2|25|36):  objs=1399 size=5.55KiB
    /27/26S (2|25|36):  objs=149 size=129B
    /27/27N (2|25|36):  objs=629 size=2.28KiB
    /27/28S (2|25|36):  objs=157 size=250B
    /27/29N (2|25|36):  objs=745 size=2.71KiB
    /27/30S (2|25|36):  objs=153 size=208B
    /27/31N (2|25|36):  objs=1820 size=7.55KiB
    /27/32S (2|25|36):  objs=178 size=343B
    /27/33N (2|25|36):  objs=305 size=944B
    /27/34S (2|25|36):  objs=146 size=289B
    /27/35N (2|25|36):  objs=2619 size=11.48KiB
    /28/0N (2|25|36):  objs=36230 size=669.16KiB
    /28/1N (2|25|36):  objs=36910 size=693.07KiB
    /28/2N (2|25|36):  objs=31152 size=533.79KiB
    /28/3S (2|25|36):  objs=151 size=135B
    /28/4N (2|25|36):  objs=291 size=882B
    /28/5S (2|25|36):  objs=171 size=277B
    /28/6N (2|25|36):  objs=909 size=3.72KiB
    /28/7S (2|25|36):  objs=150 size=260B
    /28/8N (2|25|36):  objs=2410 size=10.15KiB
    /28/9S (2|25|36):  objs=151 size=326B
    /28/10N (2|25|36):  objs=2933 size=12.57KiB
    /28/11S (2|25|36):  objs=133 size=118B
    /28/12N (2|25|36):  objs=4303 size=18.57KiB
    /28/14S (2|25|36):  objs=161 size=200B
    /28/16S (2|25|36):  objs=166 size=94B
    /28/17N (2|25|36):  objs=5310 size=27.83KiB
    /28/18S (2|25|36):  objs=141 size=126B
    /28/19N (2|25|36):  objs=902 size=3.56KiB
    /28/20S (2|25|36):  objs=151 size=294B
    /28/21N (2|25|36):  objs=1048 size=4.24KiB
    /28/22S (2|25|36):  objs=166 size=210B
    /28/23N (2|25|36):  objs=4049 size=18.71KiB
    /28/24S (2|25|36):  objs=138 size=317B
    /28/25N (2|25|36):  objs=459 size=1.64KiB
    /28/26S (2|25|36):  objs=150 size=116B
    /28/27N (2|25|36):  objs=3597 size=15.18KiB
    /28/28S (2|25|36):  objs=157 size=269B
    /28/29N (2|25|36):  objs=5140 size=22.43KiB
    /28/30S (2|25|36):  objs=168 size=110B
    /28/31N (2|25|36):  objs=4329 size=20.21KiB
    /28/32S (2|25|36):  objs=160 size=110B
    /28/33N (2|25|36):  objs=5331 size=26.08KiB
    /28/34S (2|25|36):  objs=161 size=315B
    /28/35N (2|25|36):  objs=6509 size=33.16KiB
    /29/0N (2|25|36):  objs=37863 size=773.44KiB
    /29/1N (2|25|36):  objs=39711 size=935.49KiB
    /29/2N (2|25|36):  objs=39609 size=844.89KiB
    /29/3N (2|25|36):  objs=18032 size=123.32KiB
    /29/4S (2|25|36):  objs=143 size=176B
    /29/5N (2|25|36):  objs=1354 size=5.56KiB
    /29/6S (2|25|36):  objs=140 size=296B
    /29/7N (2|25|36):  objs=2773 size=11.99KiB
    /29/8S (2|25|36):  objs=146 size=240B
    /29/9N (2|25|36):  objs=306 size=966B
    /29/10S (2|25|36):  objs=159 size=115B
    /29/11N (2|25|36):  objs=3025 size=13.93KiB
    /29/12S (2|25|36):  objs=162 size=208B
    /29/13N (2|25|36):  objs=3074 size=13.58KiB
    /29/14S (2|25|36):  objs=176 size=331B
    /29/15N (2|25|36):  objs=1224 size=4.85KiB
    /29/16S (2|25|36):  objs=116 size=216B
    /29/17N (2|25|36):  objs=1341 size=5.28KiB
    /29/18S (2|25|36):  objs=154 size=152B
    /29/20S (2|25|36):  objs=163 size=198B
    /29/22S (2|25|36):  objs=137 size=127B
    /29/24S (2|25|36):  objs=152 size=325B
    /29/26S (2|25|36):  objs=162 size=116B
    /29/27N (2|25|36):  objs=2947 size=13.24KiB
    /29/28S (2|25|36):  objs=165 size=86B
    /29/29N (2|25|36):  objs=2147 size=8.97KiB
    /29/30S (2|25|36):  objs=152 size=211B
    /29/31N (2|25|36):  objs=3848 size=16.61KiB
    /29/32S (2|25|36):  objs=153 size=245B
    /29/34S (2|25|36):  objs=141 size=113B
    /30/0N (2|25|36):  objs=21678 size=220.74KiB
    /30/1S (2|25|36):  objs=156 size=266B
    /30/2N (2|25|36):  objs=18618 size=181.99KiB
    /30/3N (2|25|36):  objs=37810 size=900.58KiB
    /30/4N (2|25|36):  objs=33266 size=694.72KiB
    /30/5S (2|25|36):  objs=132 size=208B
    /30/6N (2|25|36):  objs=296 size=1.07KiB
    /30/7S (2|25|36):  objs=155 size=201B
    /30/8N (2|25|36):  objs=1091 size=4.31KiB
    /30/9N (2|25|36):  objs=2770 size=12.63KiB
    /30/10S (2|25|36):  objs=150 size=221B
    /30/11N (2|25|36):  objs=7153 size=37.75KiB
    /30/12S (2|25|36):  objs=153 size=198B
    /30/13N (2|25|36):  objs=736 size=2.7KiB
    /30/14S (2|25|36):  objs=137 size=171B
    /30/15N (2|25|36):  objs=866 size=3.24KiB
    /30/16S (2|25|36):  objs=154 size=99B
    /30/17N (2|25|36):  objs=5255 size=22.55KiB
    /30/18S (2|25|36):  objs=156 size=120B
    /30/19N (2|25|36):  objs=1526 size=6.33KiB
    /30/20S (2|25|36):  objs=153 size=290B
    /30/21N (2|25|36):  objs=771 size=3.05KiB
    /30/22S (2|25|36):  objs=157 size=188B
    /30/23N (2|25|36):  objs=3831 size=18.37KiB
    /30/24S (2|25|36):  objs=161 size=202B
    /30/25N (2|25|36):  objs=1303 size=5.21KiB
    /30/26S (2|25|36):  objs=140 size=327B
    /30/27N (2|25|36):  objs=5122 size=23.72KiB
    /30/28S (2|25|36):  objs=148 size=92B
    /30/29N (2|25|36):  objs=1919 size=7.66KiB
    /30/30S (2|25|36):  objs=142 size=297B
    /30/31N (2|25|36):  objs=677 size=2.61KiB
    /30/32S (2|25|36):  objs=156 size=249B
    /30/33N (2|25|36):  objs=1342 size=5.46KiB
    /30/34S (2|25|36):  objs=153 size=319B
    /30/35N (2|25|36):  objs=342 size=1013B
    /31/0N (2|25|36):  objs=38571 size=866.51KiB
    /31/1N (2|25|36):  objs=36318 size=628.5KiB
    /31/2N (2|25|36):  objs=39982 size=852.63KiB
    /31/3N (2|25|36):  objs=1682 size=7.05KiB
    /31/4S (2|25|36):  objs=152 size=174B
    /31/5N (2|25|36):  objs=1686 size=6.84KiB
    /31/6S (2|25|36):  objs=148 size=313B
    /31/7N (2|25|36):  objs=5305 size=25.13KiB
    /31/8S (2|25|36):  objs=144 size=177B
    /31/9S (2|25|36):  objs=134 size=299B
    /31/10S (2|25|36):  objs=155 size=137B
    /31/11N (2|25|36):  objs=1582 size=6.47KiB
    /31/12S (2|25|36):  objs=151 size=231B
    /31/13N (2|25|36):  objs=3375 size=14.53KiB
    /31/14S (2|25|36):  objs=153 size=272B
    /31/15N (2|25|36):  objs=2043 size=8.71KiB
    /31/16S (2|25|36):  objs=166 size=283B
    /31/17N (2|25|36):  objs=1077 size=4.23KiB
    /31/18S (2|25|36):  objs=172 size=202B
    /31/19S (2|25|36):  objs=151 size=315B
    /31/20S (2|25|36):  objs=162 size=101B
    /31/21N (2|25|36):  objs=2692 size=11.6KiB
    /31/22S (2|25|36):  objs=128 size=150B
    /31/23N (2|25|36):  objs=1799 size=7.66KiB
    /31/24S (2|25|36):  objs=153 size=148B
    /31/25N (2|25|36):  objs=602 size=2.28KiB
    /31/26S (2|25|36):  objs=176 size=344B
    /31/27N (2|25|36):  objs=4079 size=18.75KiB
    /31/28S (2|25|36):  objs=162 size=243B
    /31/29N (2|25|36):  objs=748 size=2.74KiB
    /31/30S (2|25|36):  objs=162 size=130B
    /31/31N (2|25|36):  objs=649 size=2.24KiB
    /31/32S (2|25|36):  objs=149 size=305B
    /31/33N (2|25|36):  objs=5637 size=25.92KiB
    /31/34S (2|25|36):  objs=155 size=321B
    /31/35N (2|25|36):  objs=1049 size=4.22KiB

com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED

com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT
    /tmp/milib_f1c12268769cbc5c043dd6ae8da89396bef283c52701323645752760993

com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT
    /tmp/milib_d0af91ffde77aaa8b23b6749390d015a36122ac412443255009360770876.tmp

com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT
    WARNING: unnecessary override -Ob= with the same value.

com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT
    {"labels":["A","B","C","null"],"hist":[1,2,0,1]}

com.milaboratory.util.CacheTest > test1 STANDARD_OUT
    Cache misses:400
    Cache hits:800

com.milaboratory.test.TestUtil > testLT STANDARD_OUT
    Short tests.
    No system env properties.
Gradle Test Executor 1 finished executing tests.
Finished generating test XML results (0.151 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test
Generating HTML test report...
Finished generating test html results (0.303 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test
:test (Thread[#41,Task worker for ':',5,main]) completed. Took 5 mins 25.396 secs.

BUILD SUCCESSFUL in 6m 3s
5 actionable tasks: 3 executed, 2 up-to-date
   create-stamp debian/debhelper-build-stamp
   dh_prep
   dh_auto_install --destdir=debian/libmilib-java/
   mh_install
   jh_installjavadoc
   dh_installdocs
   dh_installchangelogs
   dh_perl
   dh_link
   jh_installlibs
   jh_classpath
Duplicate specification "version|V" for option "V"
   jh_manifest
   jh_depends
   dh_strip_nondeterminism
   dh_compress
   dh_fixperms
   dh_missing
   dh_installdeb
   dh_gencontrol
   dh_md5sums
   dh_builddeb
dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'.
 dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_armhf.buildinfo
 dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_armhf.changes
dpkg-genchanges: info: binary-only upload (no source code included)
 dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
dpkg-genchanges: info: including full source code in upload
I: copying local configuration
I: unmounting dev/ptmx filesystem
I: unmounting dev/pts filesystem
I: unmounting dev/shm filesystem
I: unmounting proc filesystem
I: unmounting sys filesystem
I: cleaning the build env 
I: removing directory /srv/workspace/pbuilder/17152 and its subdirectories
I: Current time: Tue Dec 17 03:34:51 -12 2024
I: pbuilder-time-stamp: 1734449691