Sun Apr 23 18:01:49 UTC 2023 I: starting to build libedlib/bookworm/i386 on jenkins on '2023-04-23 18:01' Sun Apr 23 18:01:49 UTC 2023 I: The jenkins build log is/was available at https://jenkins.debian.net/userContent/reproducible/debian/build_service/i386_9/11569/console.log Sun Apr 23 18:01:49 UTC 2023 I: Downloading source for bookworm/libedlib=1.2.7-4 --2023-04-23 18:01:49-- http://cdn-fastly.deb.debian.org/debian/pool/main/libe/libedlib/libedlib_1.2.7-4.dsc Connecting to 78.137.99.97:3128... connected. Proxy request sent, awaiting response... 200 OK Length: 2221 (2.2K) [text/prs.lines.tag] Saving to: ‘libedlib_1.2.7-4.dsc’ 0K .. 100% 136M=0s 2023-04-23 18:01:49 (136 MB/s) - ‘libedlib_1.2.7-4.dsc’ saved [2221/2221] Sun Apr 23 18:01:49 UTC 2023 I: libedlib_1.2.7-4.dsc -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA512 Format: 3.0 (quilt) Source: libedlib Binary: libedlib1, libedlib-dev, edlib-aligner, python3-edlib Architecture: any Version: 1.2.7-4 Maintainer: Debian Med Packaging Team Uploaders: Andreas Tille Homepage: https://github.com/Martinsos/edlib Standards-Version: 4.6.1 Vcs-Browser: https://salsa.debian.org/med-team/libedlib Vcs-Git: https://salsa.debian.org/med-team/libedlib.git Testsuite: autopkgtest Build-Depends: debhelper-compat (= 13), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools Package-List: edlib-aligner deb science optional arch=any libedlib-dev deb libdevel optional arch=any libedlib1 deb libs optional arch=any python3-edlib deb python optional arch=any Checksums-Sha1: 9e3702547e7c789015df742f84b987bec43811c5 4318998 libedlib_1.2.7.orig.tar.gz cbaac45947c481349b8255e63f0c41eb1b72f8b2 7316 libedlib_1.2.7-4.debian.tar.xz Checksums-Sha256: 8767bc1b04a1a67282d57662e5702c4908996e96b1753b5520921ff189974621 4318998 libedlib_1.2.7.orig.tar.gz e0bcce9c5b8c17054cdd3567fb5f199ed5cc6710645ad2f8d108ed87190fe5d6 7316 libedlib_1.2.7-4.debian.tar.xz Files: 77917d44bfd08216f2dd4480578688c2 4318998 libedlib_1.2.7.orig.tar.gz 8ebf952e748a4e70df5541c9b65df27f 7316 libedlib_1.2.7-4.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQJEBAEBCgAvFiEE8fAHMgoDVUHwpmPKV4oElNHGRtEFAmOHpq4RHHRpbGxlQGRl Ymlhbi5vcmcACgkQV4oElNHGRtFz8w/4zk5rPjXM5uPMSPDufDZ/A+OPu/a5MhCT X3ojTduWhUH8fanOS8ftQ9Qt27okzjafAgJ/cJOdCMcpmL9WMtzRMHw9xDDEvkcu rtzVv8rtyv004bp+XQHFz+pjmz0L+aocA5dvLlwnNBbUCLa0NEzk+qdXW46ZKm3T b9VWKeUT6laEzhFfkafkuiM8E84OjCZtJypiZLo+x1xlOUzaREOIt5r1MvOzZZmn efkTiUQPQzA7stWUC9a2dJ7c18JwcPiKnheE+oGSV0979JSsSVkCeHh55iPzennK U5kSwLDjMosjRY27qHjlBGWxgMhbP47ZJL76WOIJqhgNoBzvyylm/N7hnbacavQm fmTSm3TJXtEvzpWzPv7h54vJ58LWW9omS0FUehp3hqHuiYfO/mVOSnsVN7L+/IIv 1ESsV61WsXSbEt0D6gaAf7VH/A5ljLjdzFGvtMyCe6ct03XCnFdLJuFOx0sdp2Tf hV/IbC5c8Dy+eF3jOuHBYM2nRwhZ70toAJgF3y0O8hcnsMTzYkWoYxjNOrzHobJx +zQm0ftWh/3BRuOdHv0BqCDZ6vgRpEXxUE+K2cmghL7QL7PmDmu0H9NmrpUcPI6H 9Qzsw/12iyIVcmrASX5svuk6uwjXfBvx1vnJdHG5a7LUZA+cbUmGZnvrJjTs6I+5 /ZmuQi7LoA== =4UtM -----END PGP SIGNATURE----- Sun Apr 23 18:01:49 UTC 2023 I: Checking whether the package is not for us Sun Apr 23 18:01:49 UTC 2023 I: Starting 1st build on remote node ionos2-i386.debian.net. Sun Apr 23 18:01:49 UTC 2023 I: Preparing to do remote build '1' on ionos2-i386.debian.net. Sun Apr 23 18:03:31 UTC 2023 I: Deleting $TMPDIR on ionos2-i386.debian.net. W: cgroups are not available on the host, not using them. I: pbuilder: network access will be disabled during build I: Current time: Sun Apr 23 06:01:51 -12 2023 I: pbuilder-time-stamp: 1682272911 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bookworm-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: using eatmydata during job I: Copying source file I: copying [libedlib_1.2.7-4.dsc] I: copying [./libedlib_1.2.7.orig.tar.gz] I: copying [./libedlib_1.2.7-4.debian.tar.xz] I: Extracting source gpgv: Signature made Wed Nov 30 06:53:34 2022 -12 gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-4.dsc: no acceptable signature found dpkg-source: info: extracting libedlib in libedlib-1.2.7 dpkg-source: info: unpacking libedlib_1.2.7.orig.tar.gz dpkg-source: info: unpacking libedlib_1.2.7-4.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying cython3.patch dpkg-source: info: applying enable_shared_and_static.patch dpkg-source: info: applying really_exclude_readme.rst.patch dpkg-source: info: applying fix-package-version.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/27547/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='i386' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=8' DISTRIBUTION='bookworm' HOME='/root' HOST_ARCH='i386' IFS=' ' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' LD_LIBRARY_PATH='/usr/lib/libeatmydata' LD_PRELOAD='libeatmydata.so' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='27547' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.l6kt8foT/pbuilderrc_vFy6 --distribution bookworm --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.l6kt8foT/b1 --logfile b1/build.log libedlib_1.2.7-4.dsc' SUDO_GID='112' SUDO_UID='107' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/sbin/chroot' http_proxy='http://78.137.99.97:3128' I: uname -a Linux ionos2-i386 5.10.0-21-686-pae #1 SMP Debian 5.10.162-1 (2023-01-21) i686 GNU/Linux I: ls -l /bin total 6036 -rwxr-xr-x 1 root root 1408088 Feb 12 08:21 bash -rwxr-xr-x 3 root root 38404 Sep 18 2022 bunzip2 -rwxr-xr-x 3 root root 38404 Sep 18 2022 bzcat lrwxrwxrwx 1 root root 6 Sep 18 2022 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Sep 18 2022 bzdiff lrwxrwxrwx 1 root root 6 Sep 18 2022 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4893 Nov 27 2021 bzexe lrwxrwxrwx 1 root root 6 Sep 18 2022 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Sep 18 2022 bzgrep -rwxr-xr-x 3 root root 38404 Sep 18 2022 bzip2 -rwxr-xr-x 1 root root 17892 Sep 18 2022 bzip2recover lrwxrwxrwx 1 root root 6 Sep 18 2022 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Sep 18 2022 bzmore -rwxr-xr-x 1 root root 42920 Sep 20 2022 cat -rwxr-xr-x 1 root root 79816 Sep 20 2022 chgrp -rwxr-xr-x 1 root root 67496 Sep 20 2022 chmod -rwxr-xr-x 1 root root 79816 Sep 20 2022 chown -rwxr-xr-x 1 root root 162024 Sep 20 2022 cp -rwxr-xr-x 1 root root 136916 Jan 5 01:20 dash -rwxr-xr-x 1 root root 137160 Sep 20 2022 date -rwxr-xr-x 1 root root 100364 Sep 20 2022 dd -rwxr-xr-x 1 root root 108940 Sep 20 2022 df -rwxr-xr-x 1 root root 162152 Sep 20 2022 dir -rwxr-xr-x 1 root root 87760 Mar 22 22:20 dmesg lrwxrwxrwx 1 root root 8 Dec 19 01:33 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Dec 19 01:33 domainname -> hostname -rwxr-xr-x 1 root root 38760 Sep 20 2022 echo -rwxr-xr-x 1 root root 41 Jan 24 02:43 egrep -rwxr-xr-x 1 root root 34664 Sep 20 2022 false -rwxr-xr-x 1 root root 41 Jan 24 02:43 fgrep -rwxr-xr-x 1 root root 84272 Mar 22 22:20 findmnt -rwsr-xr-x 1 root root 30240 Mar 22 20:38 fusermount -rwxr-xr-x 1 root root 218680 Jan 24 02:43 grep -rwxr-xr-x 2 root root 2346 Apr 9 2022 gunzip -rwxr-xr-x 1 root root 6447 Apr 9 2022 gzexe -rwxr-xr-x 1 root root 100952 Apr 9 2022 gzip -rwxr-xr-x 1 root root 21916 Dec 19 01:33 hostname -rwxr-xr-x 1 root root 75756 Sep 20 2022 ln -rwxr-xr-x 1 root root 55600 Mar 22 23:43 login -rwxr-xr-x 1 root root 162152 Sep 20 2022 ls -rwxr-xr-x 1 root root 214568 Mar 22 22:20 lsblk -rwxr-xr-x 1 root root 96328 Sep 20 2022 mkdir -rwxr-xr-x 1 root root 84008 Sep 20 2022 mknod -rwxr-xr-x 1 root root 38792 Sep 20 2022 mktemp -rwxr-xr-x 1 root root 63016 Mar 22 22:20 more -rwsr-xr-x 1 root root 58912 Mar 22 22:20 mount -rwxr-xr-x 1 root root 13856 Mar 22 22:20 mountpoint -rwxr-xr-x 1 root root 157932 Sep 20 2022 mv lrwxrwxrwx 1 root root 8 Dec 19 01:33 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 2 18:25 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 38792 Sep 20 2022 pwd lrwxrwxrwx 1 root root 4 Feb 12 08:21 rbash -> bash -rwxr-xr-x 1 root root 51080 Sep 20 2022 readlink -rwxr-xr-x 1 root root 75720 Sep 20 2022 rm -rwxr-xr-x 1 root root 51080 Sep 20 2022 rmdir -rwxr-xr-x 1 root root 22308 Nov 2 04:31 run-parts -rwxr-xr-x 1 root root 133224 Jan 5 07:55 sed lrwxrwxrwx 1 root root 4 Jan 5 01:20 sh -> dash -rwxr-xr-x 1 root root 38760 Sep 20 2022 sleep -rwxr-xr-x 1 root root 87976 Sep 20 2022 stty -rwsr-xr-x 1 root root 83492 Mar 22 22:20 su -rwxr-xr-x 1 root root 38792 Sep 20 2022 sync -rwxr-xr-x 1 root root 598456 Apr 6 02:25 tar -rwxr-xr-x 1 root root 13860 Nov 2 04:31 tempfile -rwxr-xr-x 1 root root 120776 Sep 20 2022 touch -rwxr-xr-x 1 root root 34664 Sep 20 2022 true -rwxr-xr-x 1 root root 17892 Mar 22 20:38 ulockmgr_server -rwsr-xr-x 1 root root 30236 Mar 22 22:20 umount -rwxr-xr-x 1 root root 38760 Sep 20 2022 uname -rwxr-xr-x 2 root root 2346 Apr 9 2022 uncompress -rwxr-xr-x 1 root root 162152 Sep 20 2022 vdir -rwxr-xr-x 1 root root 71216 Mar 22 22:20 wdctl lrwxrwxrwx 1 root root 8 Dec 19 01:33 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Apr 9 2022 zcat -rwxr-xr-x 1 root root 1678 Apr 9 2022 zcmp -rwxr-xr-x 1 root root 6460 Apr 9 2022 zdiff -rwxr-xr-x 1 root root 29 Apr 9 2022 zegrep -rwxr-xr-x 1 root root 29 Apr 9 2022 zfgrep -rwxr-xr-x 1 root root 2081 Apr 9 2022 zforce -rwxr-xr-x 1 root root 8103 Apr 9 2022 zgrep -rwxr-xr-x 1 root root 2206 Apr 9 2022 zless -rwxr-xr-x 1 root root 1842 Apr 9 2022 zmore -rwxr-xr-x 1 root root 4577 Apr 9 2022 znew I: user script /srv/workspace/pbuilder/27547/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: i386 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on cmake; however: Package cmake is not installed. pbuilder-satisfydepends-dummy depends on dh-python; however: Package dh-python is not installed. pbuilder-satisfydepends-dummy depends on d-shlibs; however: Package d-shlibs is not installed. pbuilder-satisfydepends-dummy depends on rename; however: Package rename is not installed. pbuilder-satisfydepends-dummy depends on cython3; however: Package cython3 is not installed. pbuilder-satisfydepends-dummy depends on python3-all-dev; however: Package python3-all-dev is not installed. pbuilder-satisfydepends-dummy depends on python3-setuptools; however: Package python3-setuptools is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: autoconf{a} automake{a} autopoint{a} autotools-dev{a} bsdextrautils{a} cmake{a} cmake-data{a} cython3{a} d-shlibs{a} debhelper{a} dh-autoreconf{a} dh-python{a} dh-strip-nondeterminism{a} dwz{a} file{a} gettext{a} gettext-base{a} groff-base{a} intltool-debian{a} libarchive-zip-perl{a} libarchive13{a} libbrotli1{a} libcurl4{a} libdebhelper-perl{a} libelf1{a} libexpat1{a} libexpat1-dev{a} libfile-stripnondeterminism-perl{a} libicu72{a} libjs-jquery{a} libjs-sphinxdoc{a} libjs-underscore{a} libjsoncpp25{a} libldap-2.5-0{a} libmagic-mgc{a} libmagic1{a} libnghttp2-14{a} libpipeline1{a} libproc2-0{a} libpsl5{a} libpython3-all-dev{a} libpython3-dev{a} libpython3-stdlib{a} libpython3.11{a} libpython3.11-dev{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libreadline8{a} librhash0{a} librtmp1{a} libsasl2-2{a} libsasl2-modules-db{a} libssh2-1{a} libsub-override-perl{a} libtool{a} libuchardet0{a} libuv1{a} libxml2{a} m4{a} man-db{a} media-types{a} po-debconf{a} procps{a} python3{a} python3-all{a} python3-all-dev{a} python3-dev{a} python3-distutils{a} python3-lib2to3{a} python3-minimal{a} python3-pkg-resources{a} python3-setuptools{a} python3.11{a} python3.11-dev{a} python3.11-minimal{a} readline-common{a} rename{a} sensible-utils{a} zlib1g-dev{a} The following packages are RECOMMENDED but will NOT be installed: ca-certificates curl javascript-common libarchive-cpio-perl libldap-common libltdl-dev libmail-sendmail-perl libsasl2-modules lynx psmisc publicsuffix wget 0 packages upgraded, 79 newly installed, 0 to remove and 0 not upgraded. Need to get 51.1 MB of archives. After unpacking 190 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bookworm/main i386 libpython3.11-minimal i386 3.11.2-6 [813 kB] Get: 2 http://deb.debian.org/debian bookworm/main i386 libexpat1 i386 2.5.0-1 [103 kB] Get: 3 http://deb.debian.org/debian bookworm/main i386 python3.11-minimal i386 3.11.2-6 [2130 kB] Get: 4 http://deb.debian.org/debian bookworm/main i386 python3-minimal i386 3.11.2-1+b1 [26.3 kB] Get: 5 http://deb.debian.org/debian bookworm/main i386 media-types all 10.0.0 [26.1 kB] Get: 6 http://deb.debian.org/debian bookworm/main i386 readline-common all 8.2-1.3 [69.0 kB] Get: 7 http://deb.debian.org/debian bookworm/main i386 libreadline8 i386 8.2-1.3 [171 kB] Get: 8 http://deb.debian.org/debian bookworm/main i386 libpython3.11-stdlib i386 3.11.2-6 [1799 kB] Get: 9 http://deb.debian.org/debian bookworm/main i386 python3.11 i386 3.11.2-6 [572 kB] Get: 10 http://deb.debian.org/debian bookworm/main i386 libpython3-stdlib i386 3.11.2-1+b1 [9308 B] Get: 11 http://deb.debian.org/debian bookworm/main i386 python3 i386 3.11.2-1+b1 [26.3 kB] Get: 12 http://deb.debian.org/debian bookworm/main i386 libproc2-0 i386 2:4.0.2-3 [63.7 kB] Get: 13 http://deb.debian.org/debian bookworm/main i386 procps i386 2:4.0.2-3 [706 kB] Get: 14 http://deb.debian.org/debian bookworm/main i386 sensible-utils all 0.0.17+nmu1 [19.0 kB] Get: 15 http://deb.debian.org/debian bookworm/main i386 libmagic-mgc i386 1:5.44-3 [305 kB] Get: 16 http://deb.debian.org/debian bookworm/main i386 libmagic1 i386 1:5.44-3 [114 kB] Get: 17 http://deb.debian.org/debian bookworm/main i386 file i386 1:5.44-3 [42.5 kB] Get: 18 http://deb.debian.org/debian bookworm/main i386 gettext-base i386 0.21-12 [162 kB] Get: 19 http://deb.debian.org/debian bookworm/main i386 libuchardet0 i386 0.0.7-1 [67.9 kB] Get: 20 http://deb.debian.org/debian bookworm/main i386 groff-base i386 1.22.4-10 [932 kB] Get: 21 http://deb.debian.org/debian bookworm/main i386 bsdextrautils i386 2.38.1-5+b1 [90.3 kB] Get: 22 http://deb.debian.org/debian bookworm/main i386 libpipeline1 i386 1.5.7-1 [40.0 kB] Get: 23 http://deb.debian.org/debian bookworm/main i386 man-db i386 2.11.2-2 [1397 kB] Get: 24 http://deb.debian.org/debian bookworm/main i386 m4 i386 1.4.19-3 [294 kB] Get: 25 http://deb.debian.org/debian bookworm/main i386 autoconf all 2.71-3 [332 kB] Get: 26 http://deb.debian.org/debian bookworm/main i386 autotools-dev all 20220109.1 [51.6 kB] Get: 27 http://deb.debian.org/debian bookworm/main i386 automake all 1:1.16.5-1.3 [823 kB] Get: 28 http://deb.debian.org/debian bookworm/main i386 autopoint all 0.21-12 [495 kB] Get: 29 http://deb.debian.org/debian bookworm/main i386 libicu72 i386 72.1-3 [9541 kB] Get: 30 http://deb.debian.org/debian bookworm/main i386 libxml2 i386 2.9.14+dfsg-1.2 [720 kB] Get: 31 http://deb.debian.org/debian bookworm/main i386 libarchive13 i386 3.6.2-1 [385 kB] Get: 32 http://deb.debian.org/debian bookworm/main i386 libbrotli1 i386 1.0.9-2+b6 [275 kB] Get: 33 http://deb.debian.org/debian bookworm/main i386 libsasl2-modules-db i386 2.1.28+dfsg-10 [21.4 kB] Get: 34 http://deb.debian.org/debian bookworm/main i386 libsasl2-2 i386 2.1.28+dfsg-10 [62.7 kB] Get: 35 http://deb.debian.org/debian bookworm/main i386 libldap-2.5-0 i386 2.5.13+dfsg-5 [196 kB] Get: 36 http://deb.debian.org/debian bookworm/main i386 libnghttp2-14 i386 1.52.0-1 [79.8 kB] Get: 37 http://deb.debian.org/debian bookworm/main i386 libpsl5 i386 0.21.2-1 [59.3 kB] Get: 38 http://deb.debian.org/debian bookworm/main i386 librtmp1 i386 2.4+20151223.gitfa8646d.1-2+b2 [64.3 kB] Get: 39 http://deb.debian.org/debian bookworm/main i386 libssh2-1 i386 1.10.0-3+b1 [187 kB] Get: 40 http://deb.debian.org/debian bookworm/main i386 libcurl4 i386 7.88.1-8 [419 kB] Get: 41 http://deb.debian.org/debian bookworm/main i386 libjsoncpp25 i386 1.9.5-4 [86.2 kB] Get: 42 http://deb.debian.org/debian bookworm/main i386 librhash0 i386 1.4.3-3 [149 kB] Get: 43 http://deb.debian.org/debian bookworm/main i386 libuv1 i386 1.44.2-1 [147 kB] Get: 44 http://deb.debian.org/debian bookworm/main i386 cmake-data all 3.25.1-1 [2026 kB] Get: 45 http://deb.debian.org/debian bookworm/main i386 cmake i386 3.25.1-1 [9767 kB] Get: 46 http://deb.debian.org/debian bookworm/main i386 cython3 i386 0.29.32-2+b1 [1297 kB] Get: 47 http://deb.debian.org/debian bookworm/main i386 d-shlibs all 0.104 [18.6 kB] Get: 48 http://deb.debian.org/debian bookworm/main i386 libdebhelper-perl all 13.11.4 [81.2 kB] Get: 49 http://deb.debian.org/debian bookworm/main i386 libtool all 2.4.7-5 [517 kB] Get: 50 http://deb.debian.org/debian bookworm/main i386 dh-autoreconf all 20 [17.1 kB] Get: 51 http://deb.debian.org/debian bookworm/main i386 libarchive-zip-perl all 1.68-1 [104 kB] Get: 52 http://deb.debian.org/debian bookworm/main i386 libsub-override-perl all 0.09-4 [9304 B] Get: 53 http://deb.debian.org/debian bookworm/main i386 libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 54 http://deb.debian.org/debian bookworm/main i386 dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 55 http://deb.debian.org/debian bookworm/main i386 libelf1 i386 0.188-2.1 [179 kB] Get: 56 http://deb.debian.org/debian bookworm/main i386 dwz i386 0.15-1 [118 kB] Get: 57 http://deb.debian.org/debian bookworm/main i386 gettext i386 0.21-12 [1311 kB] Get: 58 http://deb.debian.org/debian bookworm/main i386 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 59 http://deb.debian.org/debian bookworm/main i386 po-debconf all 1.0.21+nmu1 [248 kB] Get: 60 http://deb.debian.org/debian bookworm/main i386 debhelper all 13.11.4 [942 kB] Get: 61 http://deb.debian.org/debian bookworm/main i386 python3-lib2to3 all 3.11.2-2 [76.2 kB] Get: 62 http://deb.debian.org/debian bookworm/main i386 python3-distutils all 3.11.2-2 [131 kB] Get: 63 http://deb.debian.org/debian bookworm/main i386 dh-python all 5.20230130 [104 kB] Get: 64 http://deb.debian.org/debian bookworm/main i386 libexpat1-dev i386 2.5.0-1 [158 kB] Get: 65 http://deb.debian.org/debian bookworm/main i386 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 66 http://deb.debian.org/debian bookworm/main i386 libjs-underscore all 1.13.4~dfsg+~1.11.4-3 [116 kB] Get: 67 http://deb.debian.org/debian bookworm/main i386 libjs-sphinxdoc all 5.3.0-4 [130 kB] Get: 68 http://deb.debian.org/debian bookworm/main i386 libpython3.11 i386 3.11.2-6 [2013 kB] Get: 69 http://deb.debian.org/debian bookworm/main i386 zlib1g-dev i386 1:1.2.13.dfsg-1 [913 kB] Get: 70 http://deb.debian.org/debian bookworm/main i386 libpython3.11-dev i386 3.11.2-6 [4906 kB] Get: 71 http://deb.debian.org/debian bookworm/main i386 libpython3-dev i386 3.11.2-1+b1 [9580 B] Get: 72 http://deb.debian.org/debian bookworm/main i386 libpython3-all-dev i386 3.11.2-1+b1 [1068 B] Get: 73 http://deb.debian.org/debian bookworm/main i386 python3-all i386 3.11.2-1+b1 [1056 B] Get: 74 http://deb.debian.org/debian bookworm/main i386 python3.11-dev i386 3.11.2-6 [615 kB] Get: 75 http://deb.debian.org/debian bookworm/main i386 python3-dev i386 3.11.2-1+b1 [26.2 kB] Get: 76 http://deb.debian.org/debian bookworm/main i386 python3-all-dev i386 3.11.2-1+b1 [1072 B] Get: 77 http://deb.debian.org/debian bookworm/main i386 python3-pkg-resources all 66.1.1-1 [296 kB] Get: 78 http://deb.debian.org/debian bookworm/main i386 python3-setuptools all 66.1.1-1 [521 kB] Get: 79 http://deb.debian.org/debian bookworm/main i386 rename all 2.01-1 [21.0 kB] Fetched 51.1 MB in 3s (20.4 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:i386. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../libpython3.11-minimal_3.11.2-6_i386.deb ... Unpacking libpython3.11-minimal:i386 (3.11.2-6) ... Selecting previously unselected package libexpat1:i386. Preparing to unpack .../libexpat1_2.5.0-1_i386.deb ... Unpacking libexpat1:i386 (2.5.0-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.2-6_i386.deb ... Unpacking python3.11-minimal (3.11.2-6) ... Setting up libpython3.11-minimal:i386 (3.11.2-6) ... Setting up libexpat1:i386 (2.5.0-1) ... Setting up python3.11-minimal (3.11.2-6) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19920 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.2-1+b1_i386.deb ... Unpacking python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.0.0_all.deb ... Unpacking media-types (10.0.0) ... Selecting previously unselected package readline-common. Preparing to unpack .../2-readline-common_8.2-1.3_all.deb ... Unpacking readline-common (8.2-1.3) ... Selecting previously unselected package libreadline8:i386. Preparing to unpack .../3-libreadline8_8.2-1.3_i386.deb ... Unpacking libreadline8:i386 (8.2-1.3) ... Selecting previously unselected package libpython3.11-stdlib:i386. Preparing to unpack .../4-libpython3.11-stdlib_3.11.2-6_i386.deb ... Unpacking libpython3.11-stdlib:i386 (3.11.2-6) ... Selecting previously unselected package python3.11. Preparing to unpack .../5-python3.11_3.11.2-6_i386.deb ... Unpacking python3.11 (3.11.2-6) ... Selecting previously unselected package libpython3-stdlib:i386. Preparing to unpack .../6-libpython3-stdlib_3.11.2-1+b1_i386.deb ... Unpacking libpython3-stdlib:i386 (3.11.2-1+b1) ... Setting up python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20354 files and directories currently installed.) Preparing to unpack .../00-python3_3.11.2-1+b1_i386.deb ... Unpacking python3 (3.11.2-1+b1) ... Selecting previously unselected package libproc2-0:i386. Preparing to unpack .../01-libproc2-0_2%3a4.0.2-3_i386.deb ... Unpacking libproc2-0:i386 (2:4.0.2-3) ... Selecting previously unselected package procps. Preparing to unpack .../02-procps_2%3a4.0.2-3_i386.deb ... Unpacking procps (2:4.0.2-3) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../03-sensible-utils_0.0.17+nmu1_all.deb ... Unpacking sensible-utils (0.0.17+nmu1) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../04-libmagic-mgc_1%3a5.44-3_i386.deb ... Unpacking libmagic-mgc (1:5.44-3) ... Selecting previously unselected package libmagic1:i386. Preparing to unpack .../05-libmagic1_1%3a5.44-3_i386.deb ... Unpacking libmagic1:i386 (1:5.44-3) ... Selecting previously unselected package file. Preparing to unpack .../06-file_1%3a5.44-3_i386.deb ... Unpacking file (1:5.44-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../07-gettext-base_0.21-12_i386.deb ... Unpacking gettext-base (0.21-12) ... Selecting previously unselected package libuchardet0:i386. Preparing to unpack .../08-libuchardet0_0.0.7-1_i386.deb ... Unpacking libuchardet0:i386 (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../09-groff-base_1.22.4-10_i386.deb ... Unpacking groff-base (1.22.4-10) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../10-bsdextrautils_2.38.1-5+b1_i386.deb ... Unpacking bsdextrautils (2.38.1-5+b1) ... Selecting previously unselected package libpipeline1:i386. Preparing to unpack .../11-libpipeline1_1.5.7-1_i386.deb ... Unpacking libpipeline1:i386 (1.5.7-1) ... Selecting previously unselected package man-db. Preparing to unpack .../12-man-db_2.11.2-2_i386.deb ... Unpacking man-db (2.11.2-2) ... Selecting previously unselected package m4. Preparing to unpack .../13-m4_1.4.19-3_i386.deb ... Unpacking m4 (1.4.19-3) ... Selecting previously unselected package autoconf. Preparing to unpack .../14-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../15-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../16-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../17-autopoint_0.21-12_all.deb ... Unpacking autopoint (0.21-12) ... Selecting previously unselected package libicu72:i386. Preparing to unpack .../18-libicu72_72.1-3_i386.deb ... Unpacking libicu72:i386 (72.1-3) ... Selecting previously unselected package libxml2:i386. Preparing to unpack .../19-libxml2_2.9.14+dfsg-1.2_i386.deb ... Unpacking libxml2:i386 (2.9.14+dfsg-1.2) ... Selecting previously unselected package libarchive13:i386. Preparing to unpack .../20-libarchive13_3.6.2-1_i386.deb ... Unpacking libarchive13:i386 (3.6.2-1) ... Selecting previously unselected package libbrotli1:i386. Preparing to unpack .../21-libbrotli1_1.0.9-2+b6_i386.deb ... Unpacking libbrotli1:i386 (1.0.9-2+b6) ... Selecting previously unselected package libsasl2-modules-db:i386. Preparing to unpack .../22-libsasl2-modules-db_2.1.28+dfsg-10_i386.deb ... Unpacking libsasl2-modules-db:i386 (2.1.28+dfsg-10) ... Selecting previously unselected package libsasl2-2:i386. Preparing to unpack .../23-libsasl2-2_2.1.28+dfsg-10_i386.deb ... Unpacking libsasl2-2:i386 (2.1.28+dfsg-10) ... Selecting previously unselected package libldap-2.5-0:i386. Preparing to unpack .../24-libldap-2.5-0_2.5.13+dfsg-5_i386.deb ... Unpacking libldap-2.5-0:i386 (2.5.13+dfsg-5) ... Selecting previously unselected package libnghttp2-14:i386. Preparing to unpack .../25-libnghttp2-14_1.52.0-1_i386.deb ... Unpacking libnghttp2-14:i386 (1.52.0-1) ... Selecting previously unselected package libpsl5:i386. Preparing to unpack .../26-libpsl5_0.21.2-1_i386.deb ... Unpacking libpsl5:i386 (0.21.2-1) ... Selecting previously unselected package librtmp1:i386. Preparing to unpack .../27-librtmp1_2.4+20151223.gitfa8646d.1-2+b2_i386.deb ... Unpacking librtmp1:i386 (2.4+20151223.gitfa8646d.1-2+b2) ... Selecting previously unselected package libssh2-1:i386. Preparing to unpack .../28-libssh2-1_1.10.0-3+b1_i386.deb ... Unpacking libssh2-1:i386 (1.10.0-3+b1) ... Selecting previously unselected package libcurl4:i386. Preparing to unpack .../29-libcurl4_7.88.1-8_i386.deb ... Unpacking libcurl4:i386 (7.88.1-8) ... Selecting previously unselected package libjsoncpp25:i386. Preparing to unpack .../30-libjsoncpp25_1.9.5-4_i386.deb ... Unpacking libjsoncpp25:i386 (1.9.5-4) ... Selecting previously unselected package librhash0:i386. Preparing to unpack .../31-librhash0_1.4.3-3_i386.deb ... Unpacking librhash0:i386 (1.4.3-3) ... Selecting previously unselected package libuv1:i386. Preparing to unpack .../32-libuv1_1.44.2-1_i386.deb ... Unpacking libuv1:i386 (1.44.2-1) ... Selecting previously unselected package cmake-data. Preparing to unpack .../33-cmake-data_3.25.1-1_all.deb ... Unpacking cmake-data (3.25.1-1) ... Selecting previously unselected package cmake. Preparing to unpack .../34-cmake_3.25.1-1_i386.deb ... Unpacking cmake (3.25.1-1) ... Selecting previously unselected package cython3. Preparing to unpack .../35-cython3_0.29.32-2+b1_i386.deb ... Unpacking cython3 (0.29.32-2+b1) ... Selecting previously unselected package d-shlibs. Preparing to unpack .../36-d-shlibs_0.104_all.deb ... Unpacking d-shlibs (0.104) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../37-libdebhelper-perl_13.11.4_all.deb ... Unpacking libdebhelper-perl (13.11.4) ... Selecting previously unselected package libtool. Preparing to unpack .../38-libtool_2.4.7-5_all.deb ... Unpacking libtool (2.4.7-5) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../39-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../40-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../41-libsub-override-perl_0.09-4_all.deb ... Unpacking libsub-override-perl (0.09-4) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../42-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../43-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:i386. Preparing to unpack .../44-libelf1_0.188-2.1_i386.deb ... Unpacking libelf1:i386 (0.188-2.1) ... Selecting previously unselected package dwz. Preparing to unpack .../45-dwz_0.15-1_i386.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../46-gettext_0.21-12_i386.deb ... Unpacking gettext (0.21-12) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../47-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../48-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../49-debhelper_13.11.4_all.deb ... Unpacking debhelper (13.11.4) ... Selecting previously unselected package python3-lib2to3. Preparing to unpack .../50-python3-lib2to3_3.11.2-2_all.deb ... Unpacking python3-lib2to3 (3.11.2-2) ... Selecting previously unselected package python3-distutils. Preparing to unpack .../51-python3-distutils_3.11.2-2_all.deb ... Unpacking python3-distutils (3.11.2-2) ... Selecting previously unselected package dh-python. Preparing to unpack .../52-dh-python_5.20230130_all.deb ... Unpacking dh-python (5.20230130) ... Selecting previously unselected package libexpat1-dev:i386. Preparing to unpack .../53-libexpat1-dev_2.5.0-1_i386.deb ... Unpacking libexpat1-dev:i386 (2.5.0-1) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../54-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libjs-underscore. Preparing to unpack .../55-libjs-underscore_1.13.4~dfsg+~1.11.4-3_all.deb ... Unpacking libjs-underscore (1.13.4~dfsg+~1.11.4-3) ... Selecting previously unselected package libjs-sphinxdoc. Preparing to unpack .../56-libjs-sphinxdoc_5.3.0-4_all.deb ... Unpacking libjs-sphinxdoc (5.3.0-4) ... Selecting previously unselected package libpython3.11:i386. Preparing to unpack .../57-libpython3.11_3.11.2-6_i386.deb ... Unpacking libpython3.11:i386 (3.11.2-6) ... Selecting previously unselected package zlib1g-dev:i386. Preparing to unpack .../58-zlib1g-dev_1%3a1.2.13.dfsg-1_i386.deb ... Unpacking zlib1g-dev:i386 (1:1.2.13.dfsg-1) ... Selecting previously unselected package libpython3.11-dev:i386. Preparing to unpack .../59-libpython3.11-dev_3.11.2-6_i386.deb ... Unpacking libpython3.11-dev:i386 (3.11.2-6) ... Selecting previously unselected package libpython3-dev:i386. Preparing to unpack .../60-libpython3-dev_3.11.2-1+b1_i386.deb ... Unpacking libpython3-dev:i386 (3.11.2-1+b1) ... Selecting previously unselected package libpython3-all-dev:i386. Preparing to unpack .../61-libpython3-all-dev_3.11.2-1+b1_i386.deb ... Unpacking libpython3-all-dev:i386 (3.11.2-1+b1) ... Selecting previously unselected package python3-all. Preparing to unpack .../62-python3-all_3.11.2-1+b1_i386.deb ... Unpacking python3-all (3.11.2-1+b1) ... Selecting previously unselected package python3.11-dev. Preparing to unpack .../63-python3.11-dev_3.11.2-6_i386.deb ... Unpacking python3.11-dev (3.11.2-6) ... Selecting previously unselected package python3-dev. Preparing to unpack .../64-python3-dev_3.11.2-1+b1_i386.deb ... Unpacking python3-dev (3.11.2-1+b1) ... Selecting previously unselected package python3-all-dev. Preparing to unpack .../65-python3-all-dev_3.11.2-1+b1_i386.deb ... Unpacking python3-all-dev (3.11.2-1+b1) ... Selecting previously unselected package python3-pkg-resources. Preparing to unpack .../66-python3-pkg-resources_66.1.1-1_all.deb ... Unpacking python3-pkg-resources (66.1.1-1) ... Selecting previously unselected package python3-setuptools. Preparing to unpack .../67-python3-setuptools_66.1.1-1_all.deb ... Unpacking python3-setuptools (66.1.1-1) ... Selecting previously unselected package rename. Preparing to unpack .../68-rename_2.01-1_all.deb ... Unpacking rename (2.01-1) ... Setting up media-types (10.0.0) ... Setting up libpipeline1:i386 (1.5.7-1) ... Setting up libpsl5:i386 (0.21.2-1) ... Setting up libicu72:i386 (72.1-3) ... Setting up bsdextrautils (2.38.1-5+b1) ... Setting up libmagic-mgc (1:5.44-3) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libdebhelper-perl (13.11.4) ... Setting up libbrotli1:i386 (1.0.9-2+b6) ... Setting up libnghttp2-14:i386 (1.52.0-1) ... Setting up libmagic1:i386 (1:5.44-3) ... Setting up gettext-base (0.21-12) ... Setting up m4 (1.4.19-3) ... Setting up rename (2.01-1) ... update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode Setting up file (1:5.44-3) ... Setting up libsasl2-modules-db:i386 (2.1.28+dfsg-10) ... Setting up autotools-dev (20220109.1) ... Setting up libuv1:i386 (1.44.2-1) ... Setting up libexpat1-dev:i386 (2.5.0-1) ... Setting up librtmp1:i386 (2.4+20151223.gitfa8646d.1-2+b2) ... Setting up libproc2-0:i386 (2:4.0.2-3) ... Setting up autopoint (0.21-12) ... Setting up libjsoncpp25:i386 (1.9.5-4) ... Setting up d-shlibs (0.104) ... Setting up libsasl2-2:i386 (2.1.28+dfsg-10) ... Setting up autoconf (2.71-3) ... Setting up zlib1g-dev:i386 (1:1.2.13.dfsg-1) ... Setting up sensible-utils (0.0.17+nmu1) ... Setting up librhash0:i386 (1.4.3-3) ... Setting up libuchardet0:i386 (0.0.7-1) ... Setting up procps (2:4.0.2-3) ... Setting up libsub-override-perl (0.09-4) ... Setting up libssh2-1:i386 (1.10.0-3+b1) ... Setting up cmake-data (3.25.1-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libelf1:i386 (0.188-2.1) ... Setting up readline-common (8.2-1.3) ... Setting up libxml2:i386 (2.9.14+dfsg-1.2) ... Setting up libjs-underscore (1.13.4~dfsg+~1.11.4-3) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up gettext (0.21-12) ... Setting up libtool (2.4.7-5) ... Setting up libarchive13:i386 (3.6.2-1) ... Setting up libreadline8:i386 (8.2-1.3) ... Setting up libldap-2.5-0:i386 (2.5.13+dfsg-5) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up dh-autoreconf (20) ... Setting up libjs-sphinxdoc (5.3.0-4) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up dwz (0.15-1) ... Setting up groff-base (1.22.4-10) ... Setting up libcurl4:i386 (7.88.1-8) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libpython3.11-stdlib:i386 (3.11.2-6) ... Setting up man-db (2.11.2-2) ... Not building database; man-db/auto-update is not 'true'. Setting up cmake (3.25.1-1) ... Setting up libpython3-stdlib:i386 (3.11.2-1+b1) ... Setting up python3.11 (3.11.2-6) ... Setting up libpython3.11:i386 (3.11.2-6) ... Setting up debhelper (13.11.4) ... Setting up python3 (3.11.2-1+b1) ... Setting up libpython3.11-dev:i386 (3.11.2-6) ... Setting up cython3 (0.29.32-2+b1) ... Setting up python3-lib2to3 (3.11.2-2) ... Setting up python3-pkg-resources (66.1.1-1) ... Setting up python3-distutils (3.11.2-2) ... Setting up dh-python (5.20230130) ... Setting up libpython3-dev:i386 (3.11.2-1+b1) ... Setting up python3-setuptools (66.1.1-1) ... Setting up python3.11-dev (3.11.2-6) ... Setting up python3-all (3.11.2-1+b1) ... Setting up libpython3-all-dev:i386 (3.11.2-1+b1) ... Setting up python3-dev (3.11.2-1+b1) ... Setting up python3-all-dev (3.11.2-1+b1) ... Processing triggers for libc-bin (2.36-9) ... Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/libedlib-1.2.7/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../libedlib_1.2.7-4_source.changes dpkg-buildpackage: info: source package libedlib dpkg-buildpackage: info: source version 1.2.7-4 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Andreas Tille dpkg-source --before-build . dpkg-buildpackage: info: host architecture i386 debian/rules clean dh clean --with python3 dh_auto_clean make -j8 clean make[1]: Entering directory '/build/libedlib-1.2.7' rm -rf meson-build make[1]: Leaving directory '/build/libedlib-1.2.7' dh_clean debian/rules binary dh binary --with python3 dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/libedlib-1.2.7' dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release -DEDLIB_BUILD_EXAMPLES=False -DBUILD_TESTING=False -DEDLIB_OMIT_README_RST=1 -DBUILD_SHARED_LIBS=ON cd obj-i686-linux-gnu && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_USE_PACKAGE_REGISTRY=OFF -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DFETCHCONTENT_FULLY_DISCONNECTED=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run -DCMAKE_SKIP_INSTALL_ALL_DEPENDENCY=ON "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/i386-linux-gnu -DCMAKE_BUILD_TYPE=Release -DEDLIB_BUILD_EXAMPLES=False -DBUILD_TESTING=False -DEDLIB_OMIT_README_RST=1 -DBUILD_SHARED_LIBS=ON .. -- The C compiler identification is GNU 12.2.0 -- The CXX compiler identification is GNU 12.2.0 -- Detecting C compiler ABI info -- Detecting C compiler ABI info - done -- Check for working C compiler: /usr/bin/cc - skipped -- Detecting C compile features -- Detecting C compile features - done -- Detecting CXX compiler ABI info -- Detecting CXX compiler ABI info - done -- Check for working CXX compiler: /usr/bin/c++ - skipped -- Detecting CXX compile features -- Detecting CXX compile features - done Setting warning flags -- Performing Test WOLD_STYLE_CAST -- Performing Test WOLD_STYLE_CAST - Success -- Performing Test WSHADOW -- Performing Test WSHADOW - Success -- Configuring done -- Generating done CMake Warning: Manually-specified variables were not used by the project: CMAKE_EXPORT_NO_PACKAGE_REGISTRY CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY CMAKE_FIND_USE_PACKAGE_REGISTRY EDLIB_OMIT_README_RST FETCHCONTENT_FULLY_DISCONNECTED -- Build files have been written to: /build/libedlib-1.2.7/obj-i686-linux-gnu make[1]: Leaving directory '/build/libedlib-1.2.7' debian/rules override_dh_auto_build make[1]: Entering directory '/build/libedlib-1.2.7' dh_auto_build --buildsystem=cmake cd obj-i686-linux-gnu && make -j8 "INSTALL=install --strip-program=true" VERBOSE=1 make[2]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' /usr/bin/cmake -S/build/libedlib-1.2.7 -B/build/libedlib-1.2.7/obj-i686-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.7/obj-i686-linux-gnu/CMakeFiles /build/libedlib-1.2.7/obj-i686-linux-gnu//CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend make[4]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' cd /build/libedlib-1.2.7/obj-i686-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.7 /build/libedlib-1.2.7 /build/libedlib-1.2.7/obj-i686-linux-gnu /build/libedlib-1.2.7/obj-i686-linux-gnu /build/libedlib-1.2.7/obj-i686-linux-gnu/CMakeFiles/edlib.dir/DependInfo.cmake --color= make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend make[4]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' cd /build/libedlib-1.2.7/obj-i686-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.7 /build/libedlib-1.2.7 /build/libedlib-1.2.7/obj-i686-linux-gnu /build/libedlib-1.2.7/obj-i686-linux-gnu /build/libedlib-1.2.7/obj-i686-linux-gnu/CMakeFiles/edlib_static.dir/DependInfo.cmake --color= make[4]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build make[4]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' make[4]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build make[4]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' [ 16%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o /usr/bin/c++ -DDLIB_BUILD -DEDLIB_SHARED -Dedlib_EXPORTS -I/build/libedlib-1.2.7/edlib/include -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -fvisibility=hidden -fvisibility-inlines-hidden -std=c++14 -MD -MT CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -MF CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o.d -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.7/edlib/src/edlib.cpp [ 33%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.7/edlib/include -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++14 -MD -MT CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -MF CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o.d -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.7/edlib/src/edlib.cpp [ 50%] Linking CXX static library lib/libedlib_static.a /usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1 /usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/ranlib lib/libedlib_static.a make[4]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' [ 50%] Built target edlib_static make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend make[4]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' cd /build/libedlib-1.2.7/obj-i686-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.7 /build/libedlib-1.2.7 /build/libedlib-1.2.7/obj-i686-linux-gnu /build/libedlib-1.2.7/obj-i686-linux-gnu /build/libedlib-1.2.7/obj-i686-linux-gnu/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color= make[4]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build make[4]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' [ 66%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.7/edlib/include -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++14 -MD -MT CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -MF CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o.d -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /build/libedlib-1.2.7/apps/aligner/aligner.cpp [ 83%] Linking CXX shared library lib/libedlib.so /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1 /usr/bin/c++ -fPIC -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.1 -o lib/libedlib.so.1.2.7 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o /usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.7 lib/libedlib.so.1 lib/libedlib.so make[4]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' [ 83%] Built target edlib [100%] Linking CXX executable bin/edlib-aligner /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic "CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o" -o bin/edlib-aligner lib/libedlib_static.a make[4]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' [100%] Built target edlib-aligner make[3]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.7/obj-i686-linux-gnu/CMakeFiles 0 make[2]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' # /usr/bin/make --directory=bindings/python EDLIB_OMIT_README_RST=1 /usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp make[2]: Entering directory '/build/libedlib-1.2.7/bindings/python' # create a clean (maybe updated) copy of edlib src rm -rf edlib && cp -r ../../edlib . cython3 --cplus edlib.pyx -o edlib.bycython.cpp /usr/lib/python3/dist-packages/Cython/Compiler/Main.py:369: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /build/libedlib-1.2.7/bindings/python/edlib.pyx tree = Parsing.p_module(s, pxd, full_module_name) make[2]: Leaving directory '/build/libedlib-1.2.7/bindings/python' EDLIB_OMIT_README_RST=1 dh_auto_build --buildsystem=pybuild -- --dir bindings/python I: pybuild base:240: /usr/bin/python3 setup.py build running build running build_ext building 'edlib' extension creating build creating build/temp.linux-i386-cpython-311 creating build/temp.linux-i386-cpython-311/edlib creating build/temp.linux-i386-cpython-311/edlib/src i686-linux-gnu-gcc -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.11 -c edlib.bycython.cpp -o build/temp.linux-i386-cpython-311/edlib.bycython.o -O3 -std=c++11 i686-linux-gnu-gcc -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.11 -c edlib/src/edlib.cpp -o build/temp.linux-i386-cpython-311/edlib/src/edlib.o -O3 -std=c++11 i686-linux-gnu-g++ -shared -Wl,-O1 -Wl,-Bsymbolic-functions -g -fwrapv -O2 -Wl,-z,relro -Wl,-z,now -g -O2 -ffile-prefix-map=/build/libedlib-1.2.7=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-i386-cpython-311/edlib.bycython.o build/temp.linux-i386-cpython-311/edlib/src/edlib.o -L/usr/lib/i386-linux-gnu -o /build/libedlib-1.2.7/.pybuild/cpython3_3.11_edlib/build/edlib.cpython-311-i386-linux-gnu.so make[1]: Leaving directory '/build/libedlib-1.2.7' debian/rules override_dh_auto_test make[1]: Entering directory '/build/libedlib-1.2.7' `find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta Using NW alignment mode. Reading queries... Read 1 queries, 110 residues total. Reading target fasta file... Read target, 109 residues. Comparing queries to target... Query #0 (110 residues): score = 17 T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) ||||||| | |||||||||| ||||||||||||||||||||||||||| Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) | |||||||||||| || |||||||||| ||||||||| |||||| | Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) T: AESIKSKKKKKE-STTB (93 - 108) ||||||||||| ||| Q: -ESIKSKKKKKENSTT- (94 - 109) Cpu time of searching: 0.000171 `find . -name runTests` make[1]: Leaving directory '/build/libedlib-1.2.7' create-stamp debian/debhelper-build-stamp dh_prep debian/rules override_dh_auto_install make[1]: Entering directory '/build/libedlib-1.2.7' dh_auto_install --buildsystem=cmake cd obj-i686-linux-gnu && make -j8 install DESTDIR=/build/libedlib-1.2.7/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true" make[2]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' /usr/bin/cmake -S/build/libedlib-1.2.7 -B/build/libedlib-1.2.7/obj-i686-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 make -f CMakeFiles/Makefile2 preinstall make[3]: Entering directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' make[3]: Nothing to be done for 'preinstall'. make[3]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' Install the project... /usr/bin/cmake -P cmake_install.cmake -- Install configuration: "Release" -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/pkgconfig/edlib-1.pc -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/cmake/edlib/edlib-config.cmake -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/cmake/edlib/edlib-config-version.cmake -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/cmake/edlib/edlib-targets.cmake -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/cmake/edlib/edlib-targets-release.cmake -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/libedlib.so.1.2.7 -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/libedlib.so.1 -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/libedlib.so -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/libedlib_static.a -- Installing: /build/libedlib-1.2.7/debian/tmp/usr/include/edlib.h make[2]: Leaving directory '/build/libedlib-1.2.7/obj-i686-linux-gnu' dh_auto_install --buildsystem=pybuild -- --dir bindings/python I: pybuild base:240: /usr/bin/python3 setup.py install --root /build/libedlib-1.2.7/debian/python3-edlib running install /usr/lib/python3/dist-packages/setuptools/command/install.py:34: SetuptoolsDeprecationWarning: setup.py install is deprecated. Use build and pip and other standards-based tools. warnings.warn( running build running build_ext running install_lib creating /build/libedlib-1.2.7/debian/python3-edlib creating /build/libedlib-1.2.7/debian/python3-edlib/usr creating /build/libedlib-1.2.7/debian/python3-edlib/usr/lib creating /build/libedlib-1.2.7/debian/python3-edlib/usr/lib/python3.11 creating /build/libedlib-1.2.7/debian/python3-edlib/usr/lib/python3.11/dist-packages copying /build/libedlib-1.2.7/.pybuild/cpython3_3.11_edlib/build/edlib.cpython-311-i386-linux-gnu.so -> /build/libedlib-1.2.7/debian/python3-edlib/usr/lib/python3.11/dist-packages running install_egg_info running egg_info creating edlib.egg-info writing edlib.egg-info/PKG-INFO writing dependency_links to edlib.egg-info/dependency_links.txt writing top-level names to edlib.egg-info/top_level.txt writing manifest file 'edlib.egg-info/SOURCES.txt' reading manifest file 'edlib.egg-info/SOURCES.txt' reading manifest template 'MANIFEST.in' writing manifest file 'edlib.egg-info/SOURCES.txt' Copying edlib.egg-info to /build/libedlib-1.2.7/debian/python3-edlib/usr/lib/python3.11/dist-packages/edlib-1.3.8.post2.egg-info Skipping SOURCES.txt running install_scripts make[1]: Leaving directory '/build/libedlib-1.2.7' debian/rules override_dh_install make[1]: Entering directory '/build/libedlib-1.2.7' dh_install file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a` d-shlibmove --commit \ --multiarch \ --devunversioned \ --exclude-la \ --movedev debian/tmp/usr/include/* usr/include \ --movedev debian/tmp/usr/lib/*/cmake usr/lib/i386-linux-gnu \ --movedev debian/tmp/usr/lib/*/pkgconfig usr/lib/i386-linux-gnu \ debian/tmp/usr/lib/*/*.so Library package automatic movement utility set -e install -d -m 755 debian/libedlib-dev/usr/lib/i386-linux-gnu install -d -m 755 debian/libedlib1/usr/lib/i386-linux-gnu mv debian/tmp/usr/lib/i386-linux-gnu/libedlib.a debian/libedlib-dev/usr/lib/i386-linux-gnu mv debian/tmp/usr/lib/i386-linux-gnu/libedlib.so debian/libedlib-dev/usr/lib/i386-linux-gnu mv /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/libedlib.so.1 debian/libedlib1/usr/lib/i386-linux-gnu mv /build/libedlib-1.2.7/debian/tmp/usr/lib/i386-linux-gnu/libedlib.so.1.2.7 debian/libedlib1/usr/lib/i386-linux-gnu PKGDEV=libedlib-dev PKGSHL=libedlib1 install -d -m 755 debian/libedlib-dev/usr/include mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include install -d -m 755 debian/libedlib-dev/usr/lib/i386-linux-gnu mv debian/tmp/usr/lib/i386-linux-gnu/cmake debian/libedlib-dev/usr/lib/i386-linux-gnu install -d -m 755 debian/libedlib-dev/usr/lib/i386-linux-gnu mv debian/tmp/usr/lib/i386-linux-gnu/pkgconfig debian/libedlib-dev/usr/lib/i386-linux-gnu make[1]: Leaving directory '/build/libedlib-1.2.7' dh_installdocs dh_installchangelogs dh_installexamples dh_installman dh_python3 dh_perl dh_link dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_dwz -a dh_strip -a dh_makeshlibs -a dh_shlibdeps -a dh_installdeb dh_gencontrol dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined dh_md5sums dh_builddeb dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.7-4_i386.deb'. dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.7-4_i386.deb'. dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.7-4_i386.deb'. dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.7-4_i386.deb'. dpkg-deb: building package 'libedlib1' in '../libedlib1_1.2.7-4_i386.deb'. dpkg-deb: building package 'libedlib1-dbgsym' in '../libedlib1-dbgsym_1.2.7-4_i386.deb'. dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.7-4_i386.deb'. dpkg-genbuildinfo --build=binary -O../libedlib_1.2.7-4_i386.buildinfo dpkg-genchanges --build=binary -O../libedlib_1.2.7-4_i386.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: not including original source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/27547 and its subdirectories I: Current time: Sun Apr 23 06:03:30 -12 2023 I: pbuilder-time-stamp: 1682273010 Sun Apr 23 18:03:32 UTC 2023 I: 1st build successful. Starting 2nd build on remote node ionos6-i386.debian.net. Sun Apr 23 18:03:32 UTC 2023 I: Preparing to do remote build '2' on ionos6-i386.debian.net. Sun Apr 23 18:04:10 UTC 2023 I: Deleting $TMPDIR on ionos6-i386.debian.net. Sun Apr 23 18:04:10 UTC 2023 I: libedlib_1.2.7-4_i386.changes: Format: 1.8 Date: Wed, 30 Nov 2022 19:51:17 +0100 Source: libedlib Binary: edlib-aligner edlib-aligner-dbgsym libedlib-dev libedlib1 libedlib1-dbgsym python3-edlib python3-edlib-dbgsym Architecture: i386 Version: 1.2.7-4 Distribution: unstable Urgency: medium Maintainer: Debian Med Packaging Team Changed-By: Andreas Tille Description: edlib-aligner - edlib sequence alignment tool using edit distance libedlib-dev - library for sequence alignment using edit distance (devel) libedlib1 - library for sequence alignment using edit distance python3-edlib - library for sequence alignment using edit distance (Python3 modul Changes: libedlib (1.2.7-4) unstable; urgency=medium . * Fix watch file * Standards-Version: 4.6.1 (routine-update) * No tab in license text (routine-update) Checksums-Sha1: 66256221c410f7b67b496a9ec12e0a9788640224 118568 edlib-aligner-dbgsym_1.2.7-4_i386.deb b70872d80475d23d962cd14e7314e2e6ccedbe48 23436 edlib-aligner_1.2.7-4_i386.deb 765e8f13995994d86c9ddfe3a65af502938245a7 21716 libedlib-dev_1.2.7-4_i386.deb 75e5a4d5a9e9a6baef63edb485803c6f97e4d10e 77868 libedlib1-dbgsym_1.2.7-4_i386.deb 1469c932a4ba9bc257a63814ad27c8b60751fe12 17020 libedlib1_1.2.7-4_i386.deb 2958e6f8467aa35a3564287f207617c1e9f240f0 8441 libedlib_1.2.7-4_i386.buildinfo 7de2e33073635e60c9df3254322dd8e62f64c065 298692 python3-edlib-dbgsym_1.2.7-4_i386.deb 235b111d79c03ca8d829c56560e78c1bb611177d 61284 python3-edlib_1.2.7-4_i386.deb Checksums-Sha256: f387ba9974e06b49d21598d36d4d5f4f5fd31c6de8c572a77ef306e31b616ece 118568 edlib-aligner-dbgsym_1.2.7-4_i386.deb 122aac9eb67097a47cd33a39d7506ad3b16e1da6137e8dfb88b84a8b83e416d9 23436 edlib-aligner_1.2.7-4_i386.deb d63847a6b8d9cee4f464f61e8a85d3fa34f2850b23ad4e1b5db1be44097a8e01 21716 libedlib-dev_1.2.7-4_i386.deb 90edac7c67c8086cf6a3c6644dd9d6e378ad25ff04f96193350e3fe27b2a897c 77868 libedlib1-dbgsym_1.2.7-4_i386.deb 45cf9ea711c74150d779a45784c4ff9251fa4b911dd6bc1c8880c47f5b21f1d9 17020 libedlib1_1.2.7-4_i386.deb a04debf895e9b02e06a57e1b40c8d7da63aafb0549505fd5d538eed38e9cfb12 8441 libedlib_1.2.7-4_i386.buildinfo 47060b0dd2d59225b6757cd8dd7e0bb06b6cf86b227e9d71b945ed1ac50d059b 298692 python3-edlib-dbgsym_1.2.7-4_i386.deb 169965a82259553017226bc5840b6cc4143c9c2fd4605dd7f73d71612190972b 61284 python3-edlib_1.2.7-4_i386.deb Files: b616632a1a9720c6faa83e2144520921 118568 debug optional edlib-aligner-dbgsym_1.2.7-4_i386.deb e0194ed153a9ebed9a03bcc41cd28507 23436 science optional edlib-aligner_1.2.7-4_i386.deb 5c7ca1af4d696506866290ba7eb8dbc7 21716 libdevel optional libedlib-dev_1.2.7-4_i386.deb 1c5d1d012db86048fe21ac1b801fe67c 77868 debug optional libedlib1-dbgsym_1.2.7-4_i386.deb 0bf4d52c7e5533b0c8ea17439a20b2ee 17020 libs optional libedlib1_1.2.7-4_i386.deb 26a9c822ec90337d01a26beff642a7d2 8441 science optional libedlib_1.2.7-4_i386.buildinfo 3a80ead72e76c1d1fbbd6b0d3a97683a 298692 debug optional python3-edlib-dbgsym_1.2.7-4_i386.deb 092943cc2be77bf80aa0b6ac24ec1c8b 61284 python optional python3-edlib_1.2.7-4_i386.deb Sun Apr 23 18:04:11 UTC 2023 I: diffoscope 241 will be used to compare the two builds: # Profiling output for: /usr/bin/diffoscope --timeout 7200 --html /srv/reproducible-results/rbuild-debian/r-b-build.l6kt8foT/libedlib_1.2.7-4.diffoscope.html --text /srv/reproducible-results/rbuild-debian/r-b-build.l6kt8foT/libedlib_1.2.7-4.diffoscope.txt --json /srv/reproducible-results/rbuild-debian/r-b-build.l6kt8foT/libedlib_1.2.7-4.diffoscope.json --profile=- /srv/reproducible-results/rbuild-debian/r-b-build.l6kt8foT/b1/libedlib_1.2.7-4_i386.changes /srv/reproducible-results/rbuild-debian/r-b-build.l6kt8foT/b2/libedlib_1.2.7-4_i386.changes ## command (total time: 0.000s) 0.000s 1 call cmp (internal) ## has_same_content_as (total time: 0.000s) 0.000s 1 call abc.DotChangesFile ## main (total time: 0.392s) 0.392s 2 calls outputs 0.000s 1 call cleanup ## recognizes (total time: 0.032s) 0.032s 12 calls diffoscope.comparators.binary.FilesystemFile 0.000s 10 calls abc.DotChangesFile ## specialize (total time: 0.000s) 0.000s 1 call specialize Sun Apr 23 18:07:05 UTC 2023 I: diffoscope 241 found no differences in the changes files, and a .buildinfo file also exists. Sun Apr 23 18:07:05 UTC 2023 I: libedlib from bookworm built successfully and reproducibly on i386. Sun Apr 23 18:07:11 UTC 2023 I: Submitting .buildinfo files to external archives: Sun Apr 23 18:07:11 UTC 2023 I: Submitting 12K b1/libedlib_1.2.7-4_i386.buildinfo.asc Sun Apr 23 18:07:15 UTC 2023 I: Submitting 12K b2/libedlib_1.2.7-4_i386.buildinfo.asc Sun Apr 23 18:07:21 UTC 2023 I: Done submitting .buildinfo files to http://buildinfo.debian.net/api/submit. Sun Apr 23 18:07:21 UTC 2023 I: Done submitting .buildinfo files. Sun Apr 23 18:07:21 UTC 2023 I: Removing signed libedlib_1.2.7-4_i386.buildinfo.asc files: removed './b1/libedlib_1.2.7-4_i386.buildinfo.asc' removed './b2/libedlib_1.2.7-4_i386.buildinfo.asc'