Tue Mar 25 10:14:38 UTC 2025 I: starting to build milib/unstable/arm64 on jenkins on '2025-03-25 10:14' Tue Mar 25 10:14:38 UTC 2025 I: The jenkins build log is/was available at https://jenkins.debian.net/userContent/reproducible/debian/build_service/arm64_12/88109/console.log Tue Mar 25 10:14:38 UTC 2025 I: Downloading source for unstable/milib=2.2.0+dfsg-1 --2025-03-25 10:14:39-- http://deb.debian.org/debian/pool/main/m/milib/milib_2.2.0%2bdfsg-1.dsc Connecting to 46.16.76.132:3128... connected. Proxy request sent, awaiting response... 200 OK Length: 2321 (2.3K) [text/prs.lines.tag] Saving to: ‘milib_2.2.0+dfsg-1.dsc’ 0K .. 100% 328M=0s 2025-03-25 10:14:39 (328 MB/s) - ‘milib_2.2.0+dfsg-1.dsc’ saved [2321/2321] Tue Mar 25 10:14:39 UTC 2025 I: milib_2.2.0+dfsg-1.dsc -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA512 Format: 3.0 (quilt) Source: milib Binary: libmilib-java Architecture: all Version: 2.2.0+dfsg-1 Maintainer: Debian Med Packaging Team Uploaders: Steffen Moeller , Pierre Gruet Homepage: https://milaboratory.com/ Standards-Version: 4.6.2 Vcs-Browser: https://salsa.debian.org/med-team/milib Vcs-Git: https://salsa.debian.org/med-team/milib.git Build-Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper Build-Depends-Indep: junit4 , libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java , libredberry-pipe-java, libtrove3-java Package-List: libmilib-java deb java optional arch=all Checksums-Sha1: 8bdc2c9f5b41fb8f019e40aa92319f8f44cf53b0 297272 milib_2.2.0+dfsg.orig.tar.xz 8679f47ef3b51a7903c90aec7b1cc0f03d5519ba 7164 milib_2.2.0+dfsg-1.debian.tar.xz Checksums-Sha256: fcb526a82893ed03e0e2ee03fc903068ab0e1ba3756882fde5772570d925bea8 297272 milib_2.2.0+dfsg.orig.tar.xz 3580819348a335020267872364231b07d94acc187fe8f8d1e725cd435ca99da0 7164 milib_2.2.0+dfsg-1.debian.tar.xz Files: 0f3366106ffc38854a4ecb1291948b37 297272 milib_2.2.0+dfsg.orig.tar.xz 1ccdc6feb357479034ab0802e1ec790f 7164 milib_2.2.0+dfsg-1.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEEM8soQxPpC9J9y0UjYAMWptwndHYFAmOu8MEACgkQYAMWptwn dHb8exAAgNgcLCIp51bVmOXq+5+TMCGtZH0+gUjZYfnhqvzgRcVtjsY4KyVRaxvv 43ldjF+xJOnapBdgG9Yk/JwyooGIk3L7x2d2fSflxqfvCqjRqCWC7EZ43FDESdWx +Xb48U+1t5rW6ucA+GIGuaI3/wL8UTxm9O/ZCdk0zdFoUFeNHOEMPw8/Fysy7z6U gCg2TbPTfrgsnGbTCv9pHqT7/FE8cMNLbd5P61acd/Afa1qym01RxcUlMcGqOS4R 4gf49LshEB1ftRu4XjE9ka6S9svWWxPFK3Qq6qM8otWcsn91BJEsRx7qo0iY/cw6 JoALJr/kq/3QXIiP4a2A6WuP5l53xrNyLZ8E5B95JZnDw887seHibv0BMvKIAxEG GGvsIhd3qWMHSfu5IQckXkg+Vl6spdb82shQpkUOUy7+Nshnplw5Vn5KQ2Ll39j/ sNZpLsb1IMaagRQVp57cFgFCPyHgbTnuHMMhUZJ7n6W7Gqb3bkFDjdKtJnrcSB7i Dltz0RpNUNRmCzfzKNRWORRMQ1CD2cUD8CZK7yqdoSv5S6cGGsMIHuAT2pY4vA6N FE/usfcq76Eghl8xO6XLFLIJxrVSM8iBXQ4TTmA+oUf+ESZ0yb09OwwuEh60MWLM 8CiI7eUUWryGLXgJtjZZkcEFj9qxSblrje70pr9KGmDoWFQQ2R8= =eoDq -----END PGP SIGNATURE----- Tue Mar 25 10:14:39 UTC 2025 I: Checking whether the package is not for us Tue Mar 25 10:14:39 UTC 2025 I: Starting 1st build on remote node codethink04-arm64.debian.net. Tue Mar 25 10:14:39 UTC 2025 I: Preparing to do remote build '1' on codethink04-arm64.debian.net. Tue Mar 25 10:18:29 UTC 2025 I: Deleting $TMPDIR on codethink04-arm64.debian.net. W: cgroups are not available on the host, not using them. I: pbuilder: network access will be disabled during build I: Current time: Mon Mar 24 22:14:41 -12 2025 I: pbuilder-time-stamp: 1742897681 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/unstable-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: unsupported subcommand dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/568993/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build/reproducible-path' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='arm64' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=12 ' DISTRIBUTION='unstable' HOME='/root' HOST_ARCH='arm64' IFS=' ' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='568993' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.othEr4gc/pbuilderrc_RW28 --distribution unstable --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/unstable-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.othEr4gc/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='109' SUDO_UID='104' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/sbin/chroot' http_proxy='http://192.168.101.4:3128' I: uname -a Linux codethink04-arm64 6.1.0-32-cloud-arm64 #1 SMP Debian 6.1.129-1 (2025-03-06) aarch64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Mar 4 11:20 /bin -> usr/bin I: user script /srv/workspace/pbuilder/568993/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: arm64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19921 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dbus{a} dbus-bin{a} dbus-daemon{a} dbus-session-bus-common{a} dbus-system-bus-common{a} dbus-user-session{a} dconf-gsettings-backend{a} dconf-service{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gpg{a} gpg-agent{a} gpgconf{a} gpgsm{a} gpgv{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libapparmor1{a} libarchive-zip-perl{a} libasm-java{a} libasound2-data{a} libasound2t64{a} libassuan9{a} libatinject-jsr330-api-java{a} libatk-bridge2.0-0t64{a} libatk1.0-0t64{a} libatspi2.0-0t64{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo-gobject2{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcloudproviders0{a} libcolord2{a} libcom-err2{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2t64{a} libdatrie1{a} libdbus-1-3{a} libdconf1{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1t64{a} libencode-locale-perl{a} libepoxy0{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libffi8{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgbm1{a} libgcrypt20{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglib2.0-0t64{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgnutls30t64{a} libgoogle-gson-java{a} libgpg-error0{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgssapi-krb5-2{a} libgtk-3-0t64{a} libgtk-3-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu76{a} libidn2-0{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjunixsocket-java{a} libjunixsocket-jni{a} libjzlib-java{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap2{a} liblerc4{a} liblightcouch-java{a} libllvm19{a} liblog4j2-java{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1t64{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmongodb-java{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0t64{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libp11-kit0{a} libpam-systemd{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16t64{a} libpolyglot-maven-java{a} libproc2-0{a} libpython3-stdlib{a} libpython3.13-minimal{a} libpython3.13-stdlib{a} libqdox-java{a} libreadline8t64{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-quote-perl{a} libsystemd-shared{a} libtasn1-6{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} libunistring5{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwayland-client0{a} libwayland-cursor0{a} libwayland-egl1{a} libwayland-server0{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxkbcommon0{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} mesa-libgallium{a} netbase{a} openjdk-21-jdk{a} openjdk-21-jdk-headless{a} openjdk-21-jre{a} openjdk-21-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} procps{a} python3{a} python3-minimal{a} python3.13{a} python3.13-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} sopv-gpgv{a} systemd{a} systemd-sysv{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} xkb-data{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf at-spi2-core chrony curl debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra gnupg-utils gpg-wks-client javascript-common krb5-locales libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpg-error-l10n libgtk-3-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libkmod2 libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libnss-systemd libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian linux-sysctl-defaults lynx lzip mesa-vulkan-drivers ntpsec openntpd pristine-tar psmisc python3-apt python3-argcomplete python3-debian python3-magic python3-requests python3-unidiff python3-xdg sopv-doc strace systemd-cryptsetup systemd-timesyncd wget xdg-user-dirs 0 packages upgraded, 383 newly installed, 0 to remove and 0 not upgraded. Need to get 332 MB of archives. After unpacking 932 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian unstable/main arm64 libsystemd-shared arm64 257.4-3 [1908 kB] Get: 2 http://deb.debian.org/debian unstable/main arm64 libapparmor1 arm64 4.1.0~beta5-5 [42.7 kB] Get: 3 http://deb.debian.org/debian unstable/main arm64 systemd arm64 257.4-3 [2922 kB] Get: 4 http://deb.debian.org/debian unstable/main arm64 systemd-sysv arm64 257.4-3 [61.9 kB] Get: 5 http://deb.debian.org/debian unstable/main arm64 libdbus-1-3 arm64 1.16.2-2 [169 kB] Get: 6 http://deb.debian.org/debian unstable/main arm64 dbus-bin arm64 1.16.2-2 [78.8 kB] Get: 7 http://deb.debian.org/debian unstable/main arm64 dbus-session-bus-common all 1.16.2-2 [52.3 kB] Get: 8 http://deb.debian.org/debian unstable/main arm64 libexpat1 arm64 2.7.0-1 [92.8 kB] Get: 9 http://deb.debian.org/debian unstable/main arm64 dbus-daemon arm64 1.16.2-2 [152 kB] Get: 10 http://deb.debian.org/debian unstable/main arm64 dbus-system-bus-common all 1.16.2-2 [53.5 kB] Get: 11 http://deb.debian.org/debian unstable/main arm64 dbus arm64 1.16.2-2 [70.7 kB] Get: 12 http://deb.debian.org/debian unstable/main arm64 libpipeline1 arm64 1.5.8-1 [40.2 kB] Get: 13 http://deb.debian.org/debian unstable/main arm64 binfmt-support arm64 2.2.2-7+b1 [68.2 kB] Get: 14 http://deb.debian.org/debian unstable/main arm64 libpython3.13-minimal arm64 3.13.2-2 [853 kB] Get: 15 http://deb.debian.org/debian unstable/main arm64 python3.13-minimal arm64 3.13.2-2 [1995 kB] Get: 16 http://deb.debian.org/debian unstable/main arm64 python3-minimal arm64 3.13.2-2 [27.1 kB] Get: 17 http://deb.debian.org/debian unstable/main arm64 media-types all 13.0.0 [29.3 kB] Get: 18 http://deb.debian.org/debian unstable/main arm64 netbase all 6.5 [12.4 kB] Get: 19 http://deb.debian.org/debian unstable/main arm64 tzdata all 2025b-1 [259 kB] Get: 20 http://deb.debian.org/debian unstable/main arm64 libffi8 arm64 3.4.7-1 [21.2 kB] Get: 21 http://deb.debian.org/debian unstable/main arm64 readline-common all 8.2-6 [69.4 kB] Get: 22 http://deb.debian.org/debian unstable/main arm64 libreadline8t64 arm64 8.2-6 [159 kB] Get: 23 http://deb.debian.org/debian unstable/main arm64 libpython3.13-stdlib arm64 3.13.2-2 [1888 kB] Get: 24 http://deb.debian.org/debian unstable/main arm64 python3.13 arm64 3.13.2-2 [746 kB] Get: 25 http://deb.debian.org/debian unstable/main arm64 libpython3-stdlib arm64 3.13.2-2 [10.1 kB] Get: 26 http://deb.debian.org/debian unstable/main arm64 python3 arm64 3.13.2-2 [28.1 kB] Get: 27 http://deb.debian.org/debian unstable/main arm64 libproc2-0 arm64 2:4.0.4-7 [62.4 kB] Get: 28 http://deb.debian.org/debian unstable/main arm64 procps arm64 2:4.0.4-7 [868 kB] Get: 29 http://deb.debian.org/debian unstable/main arm64 sensible-utils all 0.0.24 [24.8 kB] Get: 30 http://deb.debian.org/debian unstable/main arm64 openssl arm64 3.4.1-1 [1390 kB] Get: 31 http://deb.debian.org/debian unstable/main arm64 ca-certificates all 20241223 [164 kB] Get: 32 http://deb.debian.org/debian unstable/main arm64 libmagic-mgc arm64 1:5.46-3 [337 kB] Get: 33 http://deb.debian.org/debian unstable/main arm64 libmagic1t64 arm64 1:5.46-3 [103 kB] Get: 34 http://deb.debian.org/debian unstable/main arm64 file arm64 1:5.46-3 [43.5 kB] Get: 35 http://deb.debian.org/debian unstable/main arm64 gettext-base arm64 0.23.1-1 [241 kB] Get: 36 http://deb.debian.org/debian unstable/main arm64 libuchardet0 arm64 0.0.8-1+b2 [69.2 kB] Get: 37 http://deb.debian.org/debian unstable/main arm64 groff-base arm64 1.23.0-7 [1129 kB] Get: 38 http://deb.debian.org/debian unstable/main arm64 libpam-systemd arm64 257.4-3 [272 kB] Get: 39 http://deb.debian.org/debian unstable/main arm64 bsdextrautils arm64 2.40.4-5 [92.0 kB] Get: 40 http://deb.debian.org/debian unstable/main arm64 man-db arm64 2.13.0-1 [1404 kB] Get: 41 http://deb.debian.org/debian unstable/main arm64 libgdk-pixbuf2.0-common all 2.42.12+dfsg-2 [311 kB] Get: 42 http://deb.debian.org/debian unstable/main arm64 libglib2.0-0t64 arm64 2.84.0-2 [1424 kB] Get: 43 http://deb.debian.org/debian unstable/main arm64 libicu76 arm64 76.1-3 [9526 kB] Get: 44 http://deb.debian.org/debian unstable/main arm64 libxml2 arm64 2.12.7+dfsg+really2.9.14-0.3+b1 [630 kB] Get: 45 http://deb.debian.org/debian unstable/main arm64 shared-mime-info arm64 2.4-5+b2 [756 kB] Get: 46 http://deb.debian.org/debian unstable/main arm64 libjpeg62-turbo arm64 1:2.1.5-3.1 [173 kB] Get: 47 http://deb.debian.org/debian unstable/main arm64 libpng16-16t64 arm64 1.6.47-1.1 [274 kB] Get: 48 http://deb.debian.org/debian unstable/main arm64 libdeflate0 arm64 1.23-1+b1 [42.5 kB] Get: 49 http://deb.debian.org/debian unstable/main arm64 libjbig0 arm64 2.1-6.1+b2 [30.4 kB] Get: 50 http://deb.debian.org/debian unstable/main arm64 liblerc4 arm64 4.0.0+ds-5 [146 kB] Get: 51 http://deb.debian.org/debian unstable/main arm64 libsharpyuv0 arm64 1.5.0-0.1 [114 kB] Get: 52 http://deb.debian.org/debian unstable/main arm64 libwebp7 arm64 1.5.0-0.1 [271 kB] Get: 53 http://deb.debian.org/debian unstable/main arm64 libtiff6 arm64 4.5.1+git230720-5 [309 kB] Get: 54 http://deb.debian.org/debian unstable/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.12+dfsg-2 [131 kB] Get: 55 http://deb.debian.org/debian unstable/main arm64 gtk-update-icon-cache arm64 4.18.2+ds-1 [51.1 kB] Get: 56 http://deb.debian.org/debian unstable/main arm64 hicolor-icon-theme all 0.18-2 [11.8 kB] Get: 57 http://deb.debian.org/debian unstable/main arm64 adwaita-icon-theme all 48.0-1 [504 kB] Get: 58 http://deb.debian.org/debian unstable/main arm64 ca-certificates-java all 20240118 [11.6 kB] Get: 59 http://deb.debian.org/debian unstable/main arm64 java-common all 0.76 [6776 B] Get: 60 http://deb.debian.org/debian unstable/main arm64 liblcms2-2 arm64 2.16-2 [151 kB] Get: 61 http://deb.debian.org/debian unstable/main arm64 libnspr4 arm64 2:4.36-1 [102 kB] Get: 62 http://deb.debian.org/debian unstable/main arm64 libnss3 arm64 2:3.109-1 [1291 kB] Get: 63 http://deb.debian.org/debian unstable/main arm64 libpcsclite1 arm64 2.3.1-1 [55.3 kB] Get: 64 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jre-headless arm64 21.0.7~7ea-1 [40.6 MB] Get: 65 http://deb.debian.org/debian unstable/main arm64 default-jre-headless arm64 2:1.21-76 [3192 B] Get: 66 http://deb.debian.org/debian unstable/main arm64 ant all 1.10.15-1 [2163 kB] Get: 67 http://deb.debian.org/debian unstable/main arm64 ant-optional all 1.10.15-1 [456 kB] Get: 68 http://deb.debian.org/debian unstable/main arm64 libantlr-java all 2.7.7+dfsg-14 [458 kB] Get: 69 http://deb.debian.org/debian unstable/main arm64 antlr all 2.7.7+dfsg-14 [8376 B] Get: 70 http://deb.debian.org/debian unstable/main arm64 at-spi2-common all 2.56.0-3 [171 kB] Get: 71 http://deb.debian.org/debian unstable/main arm64 m4 arm64 1.4.19-7 [285 kB] Get: 72 http://deb.debian.org/debian unstable/main arm64 autoconf all 2.72-3 [493 kB] Get: 73 http://deb.debian.org/debian unstable/main arm64 autotools-dev all 20240727.1 [60.2 kB] Get: 74 http://deb.debian.org/debian unstable/main arm64 automake all 1:1.17-4 [862 kB] Get: 75 http://deb.debian.org/debian unstable/main arm64 autopoint all 0.23.1-1 [770 kB] Get: 76 http://deb.debian.org/debian unstable/main arm64 unzip arm64 6.0-29 [163 kB] Get: 77 http://deb.debian.org/debian unstable/main arm64 java-wrappers all 0.5 [8848 B] Get: 78 http://deb.debian.org/debian unstable/main arm64 libhamcrest-java all 2.2-2 [121 kB] Get: 79 http://deb.debian.org/debian unstable/main arm64 junit4 all 4.13.2-5 [350 kB] Get: 80 http://deb.debian.org/debian unstable/main arm64 libfelix-framework-java all 4.6.1-3 [577 kB] Get: 81 http://deb.debian.org/debian unstable/main arm64 libfelix-gogo-runtime-java all 0.16.2-2 [117 kB] Get: 82 http://deb.debian.org/debian unstable/main arm64 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 83 http://deb.debian.org/debian unstable/main arm64 libosgi-core-java all 8.0.0-2 [182 kB] Get: 84 http://deb.debian.org/debian unstable/main arm64 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 85 http://deb.debian.org/debian unstable/main arm64 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 86 http://deb.debian.org/debian unstable/main arm64 libjansi-native-java all 1.8-2 [26.0 kB] Get: 87 http://deb.debian.org/debian unstable/main arm64 libjansi1-java all 1.18-3.1 [66.6 kB] Get: 88 http://deb.debian.org/debian unstable/main arm64 libjline2-java all 2.14.6-5 [151 kB] Get: 89 http://deb.debian.org/debian unstable/main arm64 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 90 http://deb.debian.org/debian unstable/main arm64 libslf4j-java all 1.7.32-1 [144 kB] Get: 91 http://deb.debian.org/debian unstable/main arm64 libxz-java all 1.9-1 [143 kB] Get: 92 http://deb.debian.org/debian unstable/main arm64 libyaml-snake-java all 1.33-2 [321 kB] Get: 93 http://deb.debian.org/debian unstable/main arm64 bnd all 5.0.1-5 [10.1 MB] Get: 94 http://deb.debian.org/debian unstable/main arm64 dbus-user-session arm64 1.16.2-2 [52.1 kB] Get: 95 http://deb.debian.org/debian unstable/main arm64 libdconf1 arm64 0.40.0-5 [40.4 kB] Get: 96 http://deb.debian.org/debian unstable/main arm64 dconf-service arm64 0.40.0-5 [30.9 kB] Get: 97 http://deb.debian.org/debian unstable/main arm64 dconf-gsettings-backend arm64 0.40.0-5 [27.3 kB] Get: 98 http://deb.debian.org/debian unstable/main arm64 dctrl-tools arm64 2.24-3+b1 [125 kB] Get: 99 http://deb.debian.org/debian unstable/main arm64 libdebhelper-perl all 13.24.1 [90.9 kB] Get: 100 http://deb.debian.org/debian unstable/main arm64 libtool all 2.5.4-4 [539 kB] Get: 101 http://deb.debian.org/debian unstable/main arm64 dh-autoreconf all 20 [17.1 kB] Get: 102 http://deb.debian.org/debian unstable/main arm64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 103 http://deb.debian.org/debian unstable/main arm64 libfile-stripnondeterminism-perl all 1.14.1-2 [19.7 kB] Get: 104 http://deb.debian.org/debian unstable/main arm64 dh-strip-nondeterminism all 1.14.1-2 [8620 B] Get: 105 http://deb.debian.org/debian unstable/main arm64 libelf1t64 arm64 0.192-4 [189 kB] Get: 106 http://deb.debian.org/debian unstable/main arm64 dwz arm64 0.15-1+b1 [102 kB] Get: 107 http://deb.debian.org/debian unstable/main arm64 libunistring5 arm64 1.3-2 [453 kB] Get: 108 http://deb.debian.org/debian unstable/main arm64 gettext arm64 0.23.1-1 [1610 kB] Get: 109 http://deb.debian.org/debian unstable/main arm64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 110 http://deb.debian.org/debian unstable/main arm64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 111 http://deb.debian.org/debian unstable/main arm64 debhelper all 13.24.1 [920 kB] Get: 112 http://deb.debian.org/debian unstable/main arm64 libatk1.0-0t64 arm64 2.56.0-3 [50.3 kB] Get: 113 http://deb.debian.org/debian unstable/main arm64 libxau6 arm64 1:1.0.11-1 [20.6 kB] Get: 114 http://deb.debian.org/debian unstable/main arm64 libxdmcp6 arm64 1:1.1.5-1 [27.8 kB] Get: 115 http://deb.debian.org/debian unstable/main arm64 libxcb1 arm64 1.17.0-2+b1 [143 kB] Get: 116 http://deb.debian.org/debian unstable/main arm64 libx11-data all 2:1.8.12-1 [343 kB] Get: 117 http://deb.debian.org/debian unstable/main arm64 libx11-6 arm64 2:1.8.12-1 [795 kB] Get: 118 http://deb.debian.org/debian unstable/main arm64 libxext6 arm64 2:1.3.4-1+b3 [49.2 kB] Get: 119 http://deb.debian.org/debian unstable/main arm64 libxi6 arm64 2:1.8.2-1 [77.8 kB] Get: 120 http://deb.debian.org/debian unstable/main arm64 libatspi2.0-0t64 arm64 2.56.0-3 [76.0 kB] Get: 121 http://deb.debian.org/debian unstable/main arm64 libatk-bridge2.0-0t64 arm64 2.56.0-3 [64.7 kB] Get: 122 http://deb.debian.org/debian unstable/main arm64 libbrotli1 arm64 1.1.0-2+b7 [308 kB] Get: 123 http://deb.debian.org/debian unstable/main arm64 libfreetype6 arm64 2.13.3+dfsg-1 [422 kB] Get: 124 http://deb.debian.org/debian unstable/main arm64 fonts-dejavu-mono all 2.37-8 [489 kB] Get: 125 http://deb.debian.org/debian unstable/main arm64 fonts-dejavu-core all 2.37-8 [840 kB] Get: 126 http://deb.debian.org/debian unstable/main arm64 fontconfig-config arm64 2.15.0-2.2 [318 kB] Get: 127 http://deb.debian.org/debian unstable/main arm64 libfontconfig1 arm64 2.15.0-2.2 [387 kB] Get: 128 http://deb.debian.org/debian unstable/main arm64 libpixman-1-0 arm64 0.44.0-3 [168 kB] Get: 129 http://deb.debian.org/debian unstable/main arm64 libxcb-render0 arm64 1.17.0-2+b1 [115 kB] Get: 130 http://deb.debian.org/debian unstable/main arm64 libxcb-shm0 arm64 1.17.0-2+b1 [105 kB] Get: 131 http://deb.debian.org/debian unstable/main arm64 libxrender1 arm64 1:0.9.10-1.1+b4 [27.2 kB] Get: 132 http://deb.debian.org/debian unstable/main arm64 libcairo2 arm64 1.18.4-1+b1 [483 kB] Get: 133 http://deb.debian.org/debian unstable/main arm64 libcairo-gobject2 arm64 1.18.4-1+b1 [130 kB] Get: 134 http://deb.debian.org/debian unstable/main arm64 libcloudproviders0 arm64 0.3.6-2 [27.4 kB] Get: 135 http://deb.debian.org/debian unstable/main arm64 libcolord2 arm64 1.4.7-3 [130 kB] Get: 136 http://deb.debian.org/debian unstable/main arm64 libavahi-common-data arm64 0.8-16 [112 kB] Get: 137 http://deb.debian.org/debian unstable/main arm64 libavahi-common3 arm64 0.8-16 [43.3 kB] Get: 138 http://deb.debian.org/debian unstable/main arm64 libavahi-client3 arm64 0.8-16 [46.7 kB] Get: 139 http://deb.debian.org/debian unstable/main arm64 libidn2-0 arm64 2.3.8-2 [107 kB] Get: 140 http://deb.debian.org/debian unstable/main arm64 libp11-kit0 arm64 0.25.5-3 [409 kB] Get: 141 http://deb.debian.org/debian unstable/main arm64 libtasn1-6 arm64 4.20.0-2 [47.3 kB] Get: 142 http://deb.debian.org/debian unstable/main arm64 libgnutls30t64 arm64 3.8.9-2 [1374 kB] Get: 143 http://deb.debian.org/debian unstable/main arm64 libkrb5support0 arm64 1.21.3-5 [32.4 kB] Get: 144 http://deb.debian.org/debian unstable/main arm64 libcom-err2 arm64 1.47.2-1+b1 [24.2 kB] Get: 145 http://deb.debian.org/debian unstable/main arm64 libk5crypto3 arm64 1.21.3-5 [81.2 kB] Get: 146 http://deb.debian.org/debian unstable/main arm64 libkeyutils1 arm64 1.6.3-4 [9352 B] Get: 147 http://deb.debian.org/debian unstable/main arm64 libkrb5-3 arm64 1.21.3-5 [308 kB] Get: 148 http://deb.debian.org/debian unstable/main arm64 libgssapi-krb5-2 arm64 1.21.3-5 [127 kB] Get: 149 http://deb.debian.org/debian unstable/main arm64 libcups2t64 arm64 2.4.10-2+b1 [236 kB] Get: 150 http://deb.debian.org/debian unstable/main arm64 libepoxy0 arm64 1.5.10-2 [200 kB] Get: 151 http://deb.debian.org/debian unstable/main arm64 libfribidi0 arm64 1.0.16-1 [26.5 kB] Get: 152 http://deb.debian.org/debian unstable/main arm64 libgraphite2-3 arm64 1.3.14-2+b1 [70.4 kB] Get: 153 http://deb.debian.org/debian unstable/main arm64 libharfbuzz0b arm64 10.2.0-1+b1 [442 kB] Get: 154 http://deb.debian.org/debian unstable/main arm64 fontconfig arm64 2.15.0-2.2 [463 kB] Get: 155 http://deb.debian.org/debian unstable/main arm64 libthai-data all 0.1.29-2 [168 kB] Get: 156 http://deb.debian.org/debian unstable/main arm64 libdatrie1 arm64 0.2.13-3+b1 [37.6 kB] Get: 157 http://deb.debian.org/debian unstable/main arm64 libthai0 arm64 0.1.29-2+b1 [48.4 kB] Get: 158 http://deb.debian.org/debian unstable/main arm64 libpango-1.0-0 arm64 1.56.3-1 [213 kB] Get: 159 http://deb.debian.org/debian unstable/main arm64 libpangoft2-1.0-0 arm64 1.56.3-1 [52.9 kB] Get: 160 http://deb.debian.org/debian unstable/main arm64 libpangocairo-1.0-0 arm64 1.56.3-1 [33.7 kB] Get: 161 http://deb.debian.org/debian unstable/main arm64 libwayland-client0 arm64 1.23.1-3 [26.1 kB] Get: 162 http://deb.debian.org/debian unstable/main arm64 libwayland-cursor0 arm64 1.23.1-3 [11.7 kB] Get: 163 http://deb.debian.org/debian unstable/main arm64 libwayland-egl1 arm64 1.23.1-3 [5952 B] Get: 164 http://deb.debian.org/debian unstable/main arm64 libxcomposite1 arm64 1:0.4.6-1 [16.4 kB] Get: 165 http://deb.debian.org/debian unstable/main arm64 libxfixes3 arm64 1:6.0.0-2+b4 [20.5 kB] Get: 166 http://deb.debian.org/debian unstable/main arm64 libxcursor1 arm64 1:1.2.3-1 [39.3 kB] Get: 167 http://deb.debian.org/debian unstable/main arm64 libxdamage1 arm64 1:1.1.6-1+b2 [15.6 kB] Get: 168 http://deb.debian.org/debian unstable/main arm64 libxinerama1 arm64 2:1.1.4-3+b3 [16.1 kB] Get: 169 http://deb.debian.org/debian unstable/main arm64 xkb-data all 2.42-1 [790 kB] Get: 170 http://deb.debian.org/debian unstable/main arm64 libxkbcommon0 arm64 1.7.0-2 [106 kB] Get: 171 http://deb.debian.org/debian unstable/main arm64 libxrandr2 arm64 2:1.5.4-1+b3 [35.9 kB] Get: 172 http://deb.debian.org/debian unstable/main arm64 libgtk-3-common all 3.24.49-2 [4905 kB] Get: 173 http://deb.debian.org/debian unstable/main arm64 libgtk-3-0t64 arm64 3.24.49-2 [2566 kB] Get: 174 http://deb.debian.org/debian unstable/main arm64 libglvnd0 arm64 1.7.0-1+b2 [41.6 kB] Get: 175 http://deb.debian.org/debian unstable/main arm64 libdrm-common all 2.4.124-1 [8180 B] Get: 176 http://deb.debian.org/debian unstable/main arm64 libdrm2 arm64 2.4.124-1 [38.2 kB] Get: 177 http://deb.debian.org/debian unstable/main arm64 libx11-xcb1 arm64 2:1.8.12-1 [247 kB] Get: 178 http://deb.debian.org/debian unstable/main arm64 libxcb-dri3-0 arm64 1.17.0-2+b1 [107 kB] Get: 179 http://deb.debian.org/debian unstable/main arm64 libxcb-glx0 arm64 1.17.0-2+b1 [123 kB] Get: 180 http://deb.debian.org/debian unstable/main arm64 libxcb-present0 arm64 1.17.0-2+b1 [106 kB] Get: 181 http://deb.debian.org/debian unstable/main arm64 libxcb-xfixes0 arm64 1.17.0-2+b1 [110 kB] Get: 182 http://deb.debian.org/debian unstable/main arm64 libxxf86vm1 arm64 1:1.1.4-1+b4 [19.2 kB] Get: 183 http://deb.debian.org/debian unstable/main arm64 libdrm-amdgpu1 arm64 2.4.124-1 [21.8 kB] Get: 184 http://deb.debian.org/debian unstable/main arm64 libedit2 arm64 3.1-20250104-1 [89.3 kB] Get: 185 http://deb.debian.org/debian unstable/main arm64 libz3-4 arm64 4.13.3-1 [7507 kB] Get: 186 http://deb.debian.org/debian unstable/main arm64 libllvm19 arm64 1:19.1.7-3 [23.3 MB] Get: 187 http://deb.debian.org/debian unstable/main arm64 libsensors-config all 1:3.6.0-10 [14.6 kB] Get: 188 http://deb.debian.org/debian unstable/main arm64 libsensors5 arm64 1:3.6.0-10+b1 [34.3 kB] Get: 189 http://deb.debian.org/debian unstable/main arm64 libxcb-randr0 arm64 1.17.0-2+b1 [117 kB] Get: 190 http://deb.debian.org/debian unstable/main arm64 libxcb-sync1 arm64 1.17.0-2+b1 [109 kB] Get: 191 http://deb.debian.org/debian unstable/main arm64 libxshmfence1 arm64 1.3-1+b3 [9104 B] Get: 192 http://deb.debian.org/debian unstable/main arm64 mesa-libgallium arm64 25.0.2-1 [8027 kB] Get: 193 http://deb.debian.org/debian unstable/main arm64 libwayland-server0 arm64 1.23.1-3 [33.7 kB] Get: 194 http://deb.debian.org/debian unstable/main arm64 libgbm1 arm64 25.0.2-1 [43.5 kB] Get: 195 http://deb.debian.org/debian unstable/main arm64 libvulkan1 arm64 1.4.309.0-1 [127 kB] Get: 196 http://deb.debian.org/debian unstable/main arm64 libgl1-mesa-dri arm64 25.0.2-1 [45.3 kB] Get: 197 http://deb.debian.org/debian unstable/main arm64 libglx-mesa0 arm64 25.0.2-1 [142 kB] Get: 198 http://deb.debian.org/debian unstable/main arm64 libglx0 arm64 1.7.0-1+b2 [31.1 kB] Get: 199 http://deb.debian.org/debian unstable/main arm64 libgl1 arm64 1.7.0-1+b2 [90.9 kB] Get: 200 http://deb.debian.org/debian unstable/main arm64 libasound2-data all 1.2.13-1 [21.1 kB] Get: 201 http://deb.debian.org/debian unstable/main arm64 libasound2t64 arm64 1.2.13-1+b1 [338 kB] Get: 202 http://deb.debian.org/debian unstable/main arm64 libgif7 arm64 5.2.2-1+b1 [44.2 kB] Get: 203 http://deb.debian.org/debian unstable/main arm64 x11-common all 1:7.7+24 [217 kB] Get: 204 http://deb.debian.org/debian unstable/main arm64 libxtst6 arm64 2:1.2.5-1 [25.7 kB] Get: 205 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jre arm64 21.0.7~7ea-1 [193 kB] Get: 206 http://deb.debian.org/debian unstable/main arm64 default-jre arm64 2:1.21-76 [1068 B] Get: 207 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jdk-headless arm64 21.0.7~7ea-1 [81.9 MB] Get: 208 http://deb.debian.org/debian unstable/main arm64 default-jdk-headless arm64 2:1.21-76 [1124 B] Get: 209 http://deb.debian.org/debian unstable/main arm64 openjdk-21-jdk arm64 21.0.7~7ea-1 [3561 kB] Get: 210 http://deb.debian.org/debian unstable/main arm64 default-jdk arm64 2:1.21-76 [1076 B] Get: 211 http://deb.debian.org/debian unstable/main arm64 libgpg-error0 arm64 1.51-4 [78.5 kB] Get: 212 http://deb.debian.org/debian unstable/main arm64 libassuan9 arm64 3.0.2-2 [59.1 kB] Get: 213 http://deb.debian.org/debian unstable/main arm64 libgcrypt20 arm64 1.11.0-7 [742 kB] Get: 214 http://deb.debian.org/debian unstable/main arm64 gpgconf arm64 2.2.46-6 [115 kB] Get: 215 http://deb.debian.org/debian unstable/main arm64 libksba8 arm64 1.6.7-2+b1 [125 kB] Get: 216 http://deb.debian.org/debian unstable/main arm64 libsasl2-modules-db arm64 2.1.28+dfsg1-9 [20.1 kB] Get: 217 http://deb.debian.org/debian unstable/main arm64 libsasl2-2 arm64 2.1.28+dfsg1-9 [55.6 kB] Get: 218 http://deb.debian.org/debian unstable/main arm64 libldap2 arm64 2.6.9+dfsg-2 [179 kB] Get: 219 http://deb.debian.org/debian unstable/main arm64 libnpth0t64 arm64 1.8-2 [22.8 kB] Get: 220 http://deb.debian.org/debian unstable/main arm64 dirmngr arm64 2.2.46-6 [345 kB] Get: 221 http://deb.debian.org/debian unstable/main arm64 gnupg-l10n all 2.2.46-6 [702 kB] Get: 222 http://deb.debian.org/debian unstable/main arm64 gpg arm64 2.2.46-6 [483 kB] Get: 223 http://deb.debian.org/debian unstable/main arm64 pinentry-curses arm64 1.3.1-2 [83.5 kB] Get: 224 http://deb.debian.org/debian unstable/main arm64 gpg-agent arm64 2.2.46-6 [231 kB] Get: 225 http://deb.debian.org/debian unstable/main arm64 gpgsm arm64 2.2.46-6 [232 kB] Get: 226 http://deb.debian.org/debian unstable/main arm64 gnupg all 2.2.46-6 [377 kB] Get: 227 http://deb.debian.org/debian unstable/main arm64 gpgv arm64 2.2.46-6 [202 kB] Get: 228 http://deb.debian.org/debian unstable/main arm64 sopv-gpgv all 0.1.4-1 [11.3 kB] Get: 229 http://deb.debian.org/debian unstable/main arm64 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 230 http://deb.debian.org/debian unstable/main arm64 libfile-which-perl all 1.27-2 [15.1 kB] Get: 231 http://deb.debian.org/debian unstable/main arm64 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 232 http://deb.debian.org/debian unstable/main arm64 libfile-touch-perl all 0.12-2 [8816 B] Get: 233 http://deb.debian.org/debian unstable/main arm64 libio-pty-perl arm64 1:1.20-1+b2 [34.0 kB] Get: 234 http://deb.debian.org/debian unstable/main arm64 libipc-run-perl all 20231003.0-2 [101 kB] Get: 235 http://deb.debian.org/debian unstable/main arm64 libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 236 http://deb.debian.org/debian unstable/main arm64 libclass-xsaccessor-perl arm64 1.19-4+b5 [34.9 kB] Get: 237 http://deb.debian.org/debian unstable/main arm64 libb-hooks-op-check-perl arm64 0.22-3+b2 [10.6 kB] Get: 238 http://deb.debian.org/debian unstable/main arm64 libdynaloader-functions-perl all 0.004-1 [12.1 kB] Get: 239 http://deb.debian.org/debian unstable/main arm64 libdevel-callchecker-perl arm64 0.009-1+b1 [16.3 kB] Get: 240 http://deb.debian.org/debian unstable/main arm64 libparams-classify-perl arm64 0.015-2+b4 [22.3 kB] Get: 241 http://deb.debian.org/debian unstable/main arm64 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 242 http://deb.debian.org/debian unstable/main arm64 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 243 http://deb.debian.org/debian unstable/main arm64 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 244 http://deb.debian.org/debian unstable/main arm64 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 245 http://deb.debian.org/debian unstable/main arm64 libmoo-perl all 2.005005-1 [58.0 kB] Get: 246 http://deb.debian.org/debian unstable/main arm64 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 247 http://deb.debian.org/debian unstable/main arm64 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 248 http://deb.debian.org/debian unstable/main arm64 libhttp-date-perl all 6.06-1 [10.7 kB] Get: 249 http://deb.debian.org/debian unstable/main arm64 libfile-listing-perl all 6.16-1 [12.4 kB] Get: 250 http://deb.debian.org/debian unstable/main arm64 libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 251 http://deb.debian.org/debian unstable/main arm64 liburi-perl all 5.30-1 [105 kB] Get: 252 http://deb.debian.org/debian unstable/main arm64 libhtml-parser-perl arm64 3.83-1+b2 [97.5 kB] Get: 253 http://deb.debian.org/debian unstable/main arm64 libhtml-tree-perl all 5.07-3 [211 kB] Get: 254 http://deb.debian.org/debian unstable/main arm64 libclone-perl arm64 0.47-1+b1 [13.7 kB] Get: 255 http://deb.debian.org/debian unstable/main arm64 libio-html-perl all 1.004-3 [16.2 kB] Get: 256 http://deb.debian.org/debian unstable/main arm64 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 257 http://deb.debian.org/debian unstable/main arm64 libhttp-message-perl all 7.00-2 [79.8 kB] Get: 258 http://deb.debian.org/debian unstable/main arm64 libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 259 http://deb.debian.org/debian unstable/main arm64 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 260 http://deb.debian.org/debian unstable/main arm64 perl-openssl-defaults arm64 7+b2 [6712 B] Get: 261 http://deb.debian.org/debian unstable/main arm64 libnet-ssleay-perl arm64 1.94-3 [323 kB] Get: 262 http://deb.debian.org/debian unstable/main arm64 libio-socket-ssl-perl all 2.089-1 [223 kB] Get: 263 http://deb.debian.org/debian unstable/main arm64 libnet-http-perl all 6.23-1 [23.9 kB] Get: 264 http://deb.debian.org/debian unstable/main arm64 liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 265 http://deb.debian.org/debian unstable/main arm64 libtry-tiny-perl all 0.32-1 [22.9 kB] Get: 266 http://deb.debian.org/debian unstable/main arm64 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 267 http://deb.debian.org/debian unstable/main arm64 libwww-perl all 6.78-1 [183 kB] Get: 268 http://deb.debian.org/debian unstable/main arm64 patchutils arm64 0.4.2-1+b1 [71.3 kB] Get: 269 http://deb.debian.org/debian unstable/main arm64 wdiff arm64 1.2.2-8 [122 kB] Get: 270 http://deb.debian.org/debian unstable/main arm64 devscripts all 2.25.5 [1058 kB] Get: 271 http://deb.debian.org/debian unstable/main arm64 fastjar arm64 2:0.98-7+b1 [74.9 kB] Get: 272 http://deb.debian.org/debian unstable/main arm64 ivy all 2.5.3-1 [1299 kB] Get: 273 http://deb.debian.org/debian unstable/main arm64 libasm-java all 9.7.1-1 [391 kB] Get: 274 http://deb.debian.org/debian unstable/main arm64 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 275 http://deb.debian.org/debian unstable/main arm64 libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 276 http://deb.debian.org/debian unstable/main arm64 libapache-pom-java all 33-2 [5852 B] Get: 277 http://deb.debian.org/debian unstable/main arm64 libcommons-parent-java all 56-1 [10.8 kB] Get: 278 http://deb.debian.org/debian unstable/main arm64 libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 279 http://deb.debian.org/debian unstable/main arm64 libjansi-java all 2.4.1-2 [100 kB] Get: 280 http://deb.debian.org/debian unstable/main arm64 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 281 http://deb.debian.org/debian unstable/main arm64 libqdox-java all 1.12.1-4 [173 kB] Get: 282 http://deb.debian.org/debian unstable/main arm64 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 283 http://deb.debian.org/debian unstable/main arm64 libxpp3-java all 1.1.4c-4 [294 kB] Get: 284 http://deb.debian.org/debian unstable/main arm64 libxstream-java all 1.4.21-1 [567 kB] Get: 285 http://deb.debian.org/debian unstable/main arm64 groovy all 2.4.21-10 [12.8 MB] Get: 286 http://deb.debian.org/debian unstable/main arm64 libatinject-jsr330-api-java all 1.0+ds1-6 [5112 B] Get: 287 http://deb.debian.org/debian unstable/main arm64 libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 288 http://deb.debian.org/debian unstable/main arm64 libcommons-codec-java all 1.18.0-1 [304 kB] Get: 289 http://deb.debian.org/debian unstable/main arm64 libcommons-io-java all 2.18.0-1 [509 kB] Get: 290 http://deb.debian.org/debian unstable/main arm64 libcommons-compress-java all 1.27.1-2 [641 kB] Get: 291 http://deb.debian.org/debian unstable/main arm64 libcommons-lang-java all 2.6-10 [273 kB] Get: 292 http://deb.debian.org/debian unstable/main arm64 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 293 http://deb.debian.org/debian unstable/main arm64 libjsr305-java all 0.1~+svn49-12 [26.6 kB] Get: 294 http://deb.debian.org/debian unstable/main arm64 libguava-java all 32.0.1-1 [2708 kB] Get: 295 http://deb.debian.org/debian unstable/main arm64 libhttpcore-java all 4.4.16-1 [636 kB] Get: 296 http://deb.debian.org/debian unstable/main arm64 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 297 http://deb.debian.org/debian unstable/main arm64 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 298 http://deb.debian.org/debian unstable/main arm64 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 299 http://deb.debian.org/debian unstable/main arm64 libjna-jni arm64 5.15.0-1 [62.4 kB] Get: 300 http://deb.debian.org/debian unstable/main arm64 libjna-java all 5.15.0-1 [238 kB] Get: 301 http://deb.debian.org/debian unstable/main arm64 libbcprov-java all 1.80-2 [5543 kB] Get: 302 http://deb.debian.org/debian unstable/main arm64 libjunixsocket-jni arm64 2.6.1-1+b1 [18.3 kB] Get: 303 http://deb.debian.org/debian unstable/main arm64 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.29-2 [25.5 kB] Get: 304 http://deb.debian.org/debian unstable/main arm64 libjunixsocket-java all 2.6.1-1 [264 kB] Get: 305 http://deb.debian.org/debian unstable/main arm64 libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 306 http://deb.debian.org/debian unstable/main arm64 liblightcouch-java all 0.2.0-1 [75.0 kB] Get: 307 http://deb.debian.org/debian unstable/main arm64 libmongodb-java all 3.6.3-2 [1901 kB] Get: 308 http://deb.debian.org/debian unstable/main arm64 liblog4j2-java all 2.19.0-2 [2310 kB] Get: 309 http://deb.debian.org/debian unstable/main arm64 libjzlib-java all 1.1.3-3 [79.4 kB] Get: 310 http://deb.debian.org/debian unstable/main arm64 libjsch-java all 0.2.19-1 [513 kB] Get: 311 http://deb.debian.org/debian unstable/main arm64 libminlog-java all 1.3.1-1 [7808 B] Get: 312 http://deb.debian.org/debian unstable/main arm64 libobjenesis-java all 3.4-2 [41.3 kB] Get: 313 http://deb.debian.org/debian unstable/main arm64 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 314 http://deb.debian.org/debian unstable/main arm64 libkryo-java all 2.20-8 [161 kB] Get: 315 http://deb.debian.org/debian unstable/main arm64 liblogback-java all 1:1.2.11-6 [701 kB] Get: 316 http://deb.debian.org/debian unstable/main arm64 libnative-platform-jni arm64 0.14-6+b1 [11.7 kB] Get: 317 http://deb.debian.org/debian unstable/main arm64 libnative-platform-java all 0.14-6 [69.8 kB] Get: 318 http://deb.debian.org/debian unstable/main arm64 libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 319 http://deb.debian.org/debian unstable/main arm64 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 320 http://deb.debian.org/debian unstable/main arm64 libxerces2-java all 2.12.2-1 [1440 kB] Get: 321 http://deb.debian.org/debian unstable/main arm64 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 322 http://deb.debian.org/debian unstable/main arm64 libxbean-reflect-java all 4.5-9 [132 kB] Get: 323 http://deb.debian.org/debian unstable/main arm64 libgradle-core-java all 4.4.1-22 [4318 kB] Get: 324 http://deb.debian.org/debian unstable/main arm64 libbcpg-java all 1.80-2 [516 kB] Get: 325 http://deb.debian.org/debian unstable/main arm64 libbsh-java all 2.0b4-20 [291 kB] Get: 326 http://deb.debian.org/debian unstable/main arm64 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 327 http://deb.debian.org/debian unstable/main arm64 libjaxen-java all 1.1.6-5 [214 kB] Get: 328 http://deb.debian.org/debian unstable/main arm64 libdom4j-java all 2.1.4-1 [312 kB] Get: 329 http://deb.debian.org/debian unstable/main arm64 libcommons-lang3-java all 3.17.0-1 [641 kB] Get: 330 http://deb.debian.org/debian unstable/main arm64 libbcel-java all 6.10.0-1 [674 kB] Get: 331 http://deb.debian.org/debian unstable/main arm64 libjformatstring-java all 0.10~20131207-3 [34.8 kB] Get: 332 http://deb.debian.org/debian unstable/main arm64 libfindbugs-java all 3.1.0~preview2-4 [3535 kB] Get: 333 http://deb.debian.org/debian unstable/main arm64 libaopalliance-java all 20070526-7 [8572 B] Get: 334 http://deb.debian.org/debian unstable/main arm64 libguice-java all 5.1.0-1 [932 kB] Get: 335 http://deb.debian.org/debian unstable/main arm64 libjatl-java all 0.2.3-2 [30.1 kB] Get: 336 http://deb.debian.org/debian unstable/main arm64 libjcifs-java all 1.3.19+dfsg-1 [414 kB] Get: 337 http://deb.debian.org/debian unstable/main arm64 libjavaewah-java all 1.2.3-1 [159 kB] Get: 338 http://deb.debian.org/debian unstable/main arm64 libel-api-java all 3.0.0-3 [64.9 kB] Get: 339 http://deb.debian.org/debian unstable/main arm64 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 340 http://deb.debian.org/debian unstable/main arm64 libjetty9-java all 9.4.57-1 [2965 kB] Get: 341 http://deb.debian.org/debian unstable/main arm64 libjgit-java all 6.7.0-2 [3152 kB] Get: 342 http://deb.debian.org/debian unstable/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 343 http://deb.debian.org/debian unstable/main arm64 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 344 http://deb.debian.org/debian unstable/main arm64 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 345 http://deb.debian.org/debian unstable/main arm64 libmaven-resolver-java all 1.9.22-1 [729 kB] Get: 346 http://deb.debian.org/debian unstable/main arm64 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 347 http://deb.debian.org/debian unstable/main arm64 libmaven-parent-java all 43-2 [6252 B] Get: 348 http://deb.debian.org/debian unstable/main arm64 libmaven-shared-utils-java all 3.4.2-1 [137 kB] Get: 349 http://deb.debian.org/debian unstable/main arm64 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 350 http://deb.debian.org/debian unstable/main arm64 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 351 http://deb.debian.org/debian unstable/main arm64 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 352 http://deb.debian.org/debian unstable/main arm64 libplexus-interpolation-java all 1.27-1 [76.8 kB] Get: 353 http://deb.debian.org/debian unstable/main arm64 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 354 http://deb.debian.org/debian unstable/main arm64 libgeronimo-interceptor-3.0-spec-java all 1.0.1-5 [8444 B] Get: 355 http://deb.debian.org/debian unstable/main arm64 libcdi-api-java all 1.2-4 [55.3 kB] Get: 356 http://deb.debian.org/debian unstable/main arm64 libsisu-inject-java all 0.3.5-1 [352 kB] Get: 357 http://deb.debian.org/debian unstable/main arm64 libsisu-plexus-java all 0.3.5-1 [183 kB] Get: 358 http://deb.debian.org/debian unstable/main arm64 libmaven3-core-java all 3.9.9-1 [1661 kB] Get: 359 http://deb.debian.org/debian unstable/main arm64 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 360 http://deb.debian.org/debian unstable/main arm64 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 361 http://deb.debian.org/debian unstable/main arm64 librhino-java all 1.7.15-1 [1382 kB] Get: 362 http://deb.debian.org/debian unstable/main arm64 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 363 http://deb.debian.org/debian unstable/main arm64 libwagon-file-java all 3.5.3-1 [8388 B] Get: 364 http://deb.debian.org/debian unstable/main arm64 libjsoup-java all 1.15.3-1 [431 kB] Get: 365 http://deb.debian.org/debian unstable/main arm64 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 366 http://deb.debian.org/debian unstable/main arm64 libjcommander-java all 1.71-4 [73.0 kB] Get: 367 http://deb.debian.org/debian unstable/main arm64 testng all 6.9.12-4 [795 kB] Get: 368 http://deb.debian.org/debian unstable/main arm64 libgradle-plugins-java all 4.4.1-22 [5245 kB] Get: 369 http://deb.debian.org/debian unstable/main arm64 gradle all 4.4.1-22 [400 kB] Get: 370 http://deb.debian.org/debian unstable/main arm64 maven-repo-helper all 1.11 [142 kB] Get: 371 http://deb.debian.org/debian unstable/main arm64 gradle-debian-helper all 2.4 [24.5 kB] Get: 372 http://deb.debian.org/debian unstable/main arm64 jarwrapper all 0.80 [9692 B] Get: 373 http://deb.debian.org/debian unstable/main arm64 javahelper all 0.80 [80.4 kB] Get: 374 http://deb.debian.org/debian unstable/main arm64 libbyte-buddy-java all 1.14.19-1 [4756 kB] Get: 375 http://deb.debian.org/debian unstable/main arm64 libcommons-math3-java all 3.6.1-4 [2040 kB] Get: 376 http://deb.debian.org/debian unstable/main arm64 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 377 http://deb.debian.org/debian unstable/main arm64 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 378 http://deb.debian.org/debian unstable/main arm64 libjackson2-databind-java all 2.14.0+ds-1 [1532 kB] Get: 379 http://deb.debian.org/debian unstable/main arm64 liblz4-jni arm64 1.8.0-4+b1 [10.4 kB] Get: 380 http://deb.debian.org/debian unstable/main arm64 liblz4-java all 1.8.0-4 [116 kB] Get: 381 http://deb.debian.org/debian unstable/main arm64 libmockito-java all 3.3.0-2 [510 kB] Get: 382 http://deb.debian.org/debian unstable/main arm64 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 383 http://deb.debian.org/debian unstable/main arm64 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 332 MB in 2s (133 MB/s) Preconfiguring packages ... Selecting previously unselected package libsystemd-shared:arm64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19921 files and directories currently installed.) Preparing to unpack .../libsystemd-shared_257.4-3_arm64.deb ... Unpacking libsystemd-shared:arm64 (257.4-3) ... Selecting previously unselected package libapparmor1:arm64. Preparing to unpack .../libapparmor1_4.1.0~beta5-5_arm64.deb ... Unpacking libapparmor1:arm64 (4.1.0~beta5-5) ... Setting up libsystemd-shared:arm64 (257.4-3) ... Selecting previously unselected package systemd. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19934 files and directories currently installed.) Preparing to unpack .../systemd_257.4-3_arm64.deb ... Unpacking systemd (257.4-3) ... Setting up libapparmor1:arm64 (4.1.0~beta5-5) ... Setting up systemd (257.4-3) ... Created symlink '/etc/systemd/system/getty.target.wants/getty@tty1.service' -> '/usr/lib/systemd/system/getty@.service'. Created symlink '/etc/systemd/system/multi-user.target.wants/remote-fs.target' -> '/usr/lib/systemd/system/remote-fs.target'. Created symlink '/etc/systemd/system/sysinit.target.wants/systemd-pstore.service' -> '/usr/lib/systemd/system/systemd-pstore.service'. Initializing machine ID from random generator. Creating group 'systemd-journal' with GID 999. Creating group 'systemd-network' with GID 998. Creating user 'systemd-network' (systemd Network Management) with UID 998 and GID 998. /usr/lib/tmpfiles.d/legacy.conf:14: Duplicate line for path "/run/lock", ignoring. Selecting previously unselected package systemd-sysv. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20877 files and directories currently installed.) Preparing to unpack .../00-systemd-sysv_257.4-3_arm64.deb ... Unpacking systemd-sysv (257.4-3) ... Selecting previously unselected package libdbus-1-3:arm64. Preparing to unpack .../01-libdbus-1-3_1.16.2-2_arm64.deb ... Unpacking libdbus-1-3:arm64 (1.16.2-2) ... Selecting previously unselected package dbus-bin. Preparing to unpack .../02-dbus-bin_1.16.2-2_arm64.deb ... Unpacking dbus-bin (1.16.2-2) ... Selecting previously unselected package dbus-session-bus-common. Preparing to unpack .../03-dbus-session-bus-common_1.16.2-2_all.deb ... Unpacking dbus-session-bus-common (1.16.2-2) ... Selecting previously unselected package libexpat1:arm64. Preparing to unpack .../04-libexpat1_2.7.0-1_arm64.deb ... Unpacking libexpat1:arm64 (2.7.0-1) ... Selecting previously unselected package dbus-daemon. Preparing to unpack .../05-dbus-daemon_1.16.2-2_arm64.deb ... Unpacking dbus-daemon (1.16.2-2) ... Selecting previously unselected package dbus-system-bus-common. Preparing to unpack .../06-dbus-system-bus-common_1.16.2-2_all.deb ... Unpacking dbus-system-bus-common (1.16.2-2) ... Selecting previously unselected package dbus. Preparing to unpack .../07-dbus_1.16.2-2_arm64.deb ... Unpacking dbus (1.16.2-2) ... Selecting previously unselected package libpipeline1:arm64. Preparing to unpack .../08-libpipeline1_1.5.8-1_arm64.deb ... Unpacking libpipeline1:arm64 (1.5.8-1) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../09-binfmt-support_2.2.2-7+b1_arm64.deb ... Unpacking binfmt-support (2.2.2-7+b1) ... Selecting previously unselected package libpython3.13-minimal:arm64. Preparing to unpack .../10-libpython3.13-minimal_3.13.2-2_arm64.deb ... Unpacking libpython3.13-minimal:arm64 (3.13.2-2) ... Selecting previously unselected package python3.13-minimal. Preparing to unpack .../11-python3.13-minimal_3.13.2-2_arm64.deb ... Unpacking python3.13-minimal (3.13.2-2) ... Setting up libpython3.13-minimal:arm64 (3.13.2-2) ... Setting up libexpat1:arm64 (2.7.0-1) ... Setting up python3.13-minimal (3.13.2-2) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 21326 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.13.2-2_arm64.deb ... Unpacking python3-minimal (3.13.2-2) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_13.0.0_all.deb ... Unpacking media-types (13.0.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.5_all.deb ... Unpacking netbase (6.5) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2025b-1_all.deb ... Unpacking tzdata (2025b-1) ... Selecting previously unselected package libffi8:arm64. Preparing to unpack .../4-libffi8_3.4.7-1_arm64.deb ... Unpacking libffi8:arm64 (3.4.7-1) ... Selecting previously unselected package readline-common. Preparing to unpack .../5-readline-common_8.2-6_all.deb ... Unpacking readline-common (8.2-6) ... Selecting previously unselected package libreadline8t64:arm64. Preparing to unpack .../6-libreadline8t64_8.2-6_arm64.deb ... Adding 'diversion of /lib/aarch64-linux-gnu/libhistory.so.8 to /lib/aarch64-linux-gnu/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libhistory.so.8.2 to /lib/aarch64-linux-gnu/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libreadline.so.8 to /lib/aarch64-linux-gnu/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libreadline.so.8.2 to /lib/aarch64-linux-gnu/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:arm64 (8.2-6) ... Selecting previously unselected package libpython3.13-stdlib:arm64. Preparing to unpack .../7-libpython3.13-stdlib_3.13.2-2_arm64.deb ... Unpacking libpython3.13-stdlib:arm64 (3.13.2-2) ... Selecting previously unselected package python3.13. Preparing to unpack .../8-python3.13_3.13.2-2_arm64.deb ... Unpacking python3.13 (3.13.2-2) ... Selecting previously unselected package libpython3-stdlib:arm64. Preparing to unpack .../9-libpython3-stdlib_3.13.2-2_arm64.deb ... Unpacking libpython3-stdlib:arm64 (3.13.2-2) ... Setting up python3-minimal (3.13.2-2) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 22337 files and directories currently installed.) Preparing to unpack .../000-python3_3.13.2-2_arm64.deb ... Unpacking python3 (3.13.2-2) ... Selecting previously unselected package libproc2-0:arm64. Preparing to unpack .../001-libproc2-0_2%3a4.0.4-7_arm64.deb ... Unpacking libproc2-0:arm64 (2:4.0.4-7) ... Selecting previously unselected package procps. Preparing to unpack .../002-procps_2%3a4.0.4-7_arm64.deb ... Unpacking procps (2:4.0.4-7) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../003-sensible-utils_0.0.24_all.deb ... Unpacking sensible-utils (0.0.24) ... Selecting previously unselected package openssl. Preparing to unpack .../004-openssl_3.4.1-1_arm64.deb ... Unpacking openssl (3.4.1-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../005-ca-certificates_20241223_all.deb ... Unpacking ca-certificates (20241223) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../006-libmagic-mgc_1%3a5.46-3_arm64.deb ... Unpacking libmagic-mgc (1:5.46-3) ... Selecting previously unselected package libmagic1t64:arm64. Preparing to unpack .../007-libmagic1t64_1%3a5.46-3_arm64.deb ... Unpacking libmagic1t64:arm64 (1:5.46-3) ... Selecting previously unselected package file. Preparing to unpack .../008-file_1%3a5.46-3_arm64.deb ... Unpacking file (1:5.46-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../009-gettext-base_0.23.1-1_arm64.deb ... Unpacking gettext-base (0.23.1-1) ... Selecting previously unselected package libuchardet0:arm64. Preparing to unpack .../010-libuchardet0_0.0.8-1+b2_arm64.deb ... Unpacking libuchardet0:arm64 (0.0.8-1+b2) ... Selecting previously unselected package groff-base. Preparing to unpack .../011-groff-base_1.23.0-7_arm64.deb ... Unpacking groff-base (1.23.0-7) ... Selecting previously unselected package libpam-systemd:arm64. Preparing to unpack .../012-libpam-systemd_257.4-3_arm64.deb ... Unpacking libpam-systemd:arm64 (257.4-3) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../013-bsdextrautils_2.40.4-5_arm64.deb ... Unpacking bsdextrautils (2.40.4-5) ... Selecting previously unselected package man-db. Preparing to unpack .../014-man-db_2.13.0-1_arm64.deb ... Unpacking man-db (2.13.0-1) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.12+dfsg-2_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-2) ... Selecting previously unselected package libglib2.0-0t64:arm64. Preparing to unpack .../016-libglib2.0-0t64_2.84.0-2_arm64.deb ... Unpacking libglib2.0-0t64:arm64 (2.84.0-2) ... Selecting previously unselected package libicu76:arm64. Preparing to unpack .../017-libicu76_76.1-3_arm64.deb ... Unpacking libicu76:arm64 (76.1-3) ... Selecting previously unselected package libxml2:arm64. Preparing to unpack .../018-libxml2_2.12.7+dfsg+really2.9.14-0.3+b1_arm64.deb ... Unpacking libxml2:arm64 (2.12.7+dfsg+really2.9.14-0.3+b1) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.4-5+b2_arm64.deb ... Unpacking shared-mime-info (2.4-5+b2) ... Selecting previously unselected package libjpeg62-turbo:arm64. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-3.1_arm64.deb ... Unpacking libjpeg62-turbo:arm64 (1:2.1.5-3.1) ... Selecting previously unselected package libpng16-16t64:arm64. Preparing to unpack .../021-libpng16-16t64_1.6.47-1.1_arm64.deb ... Unpacking libpng16-16t64:arm64 (1.6.47-1.1) ... Selecting previously unselected package libdeflate0:arm64. Preparing to unpack .../022-libdeflate0_1.23-1+b1_arm64.deb ... Unpacking libdeflate0:arm64 (1.23-1+b1) ... Selecting previously unselected package libjbig0:arm64. Preparing to unpack .../023-libjbig0_2.1-6.1+b2_arm64.deb ... Unpacking libjbig0:arm64 (2.1-6.1+b2) ... Selecting previously unselected package liblerc4:arm64. Preparing to unpack .../024-liblerc4_4.0.0+ds-5_arm64.deb ... Unpacking liblerc4:arm64 (4.0.0+ds-5) ... Selecting previously unselected package libsharpyuv0:arm64. Preparing to unpack .../025-libsharpyuv0_1.5.0-0.1_arm64.deb ... Unpacking libsharpyuv0:arm64 (1.5.0-0.1) ... Selecting previously unselected package libwebp7:arm64. Preparing to unpack .../026-libwebp7_1.5.0-0.1_arm64.deb ... Unpacking libwebp7:arm64 (1.5.0-0.1) ... Selecting previously unselected package libtiff6:arm64. Preparing to unpack .../027-libtiff6_4.5.1+git230720-5_arm64.deb ... Unpacking libtiff6:arm64 (4.5.1+git230720-5) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64. Preparing to unpack .../028-libgdk-pixbuf-2.0-0_2.42.12+dfsg-2_arm64.deb ... Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.12+dfsg-2) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../029-gtk-update-icon-cache_4.18.2+ds-1_arm64.deb ... No diversion 'diversion of /usr/sbin/update-icon-caches to /usr/sbin/update-icon-caches.gtk2 by libgtk-3-bin', none removed. No diversion 'diversion of /usr/share/man/man8/update-icon-caches.8.gz to /usr/share/man/man8/update-icon-caches.gtk2.8.gz by libgtk-3-bin', none removed. Unpacking gtk-update-icon-cache (4.18.2+ds-1) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../030-hicolor-icon-theme_0.18-2_all.deb ... Unpacking hicolor-icon-theme (0.18-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../031-adwaita-icon-theme_48.0-1_all.deb ... Unpacking adwaita-icon-theme (48.0-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../032-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../033-java-common_0.76_all.deb ... Unpacking java-common (0.76) ... Selecting previously unselected package liblcms2-2:arm64. Preparing to unpack .../034-liblcms2-2_2.16-2_arm64.deb ... Unpacking liblcms2-2:arm64 (2.16-2) ... Selecting previously unselected package libnspr4:arm64. Preparing to unpack .../035-libnspr4_2%3a4.36-1_arm64.deb ... Unpacking libnspr4:arm64 (2:4.36-1) ... Selecting previously unselected package libnss3:arm64. Preparing to unpack .../036-libnss3_2%3a3.109-1_arm64.deb ... Unpacking libnss3:arm64 (2:3.109-1) ... Selecting previously unselected package libpcsclite1:arm64. Preparing to unpack .../037-libpcsclite1_2.3.1-1_arm64.deb ... Unpacking libpcsclite1:arm64 (2.3.1-1) ... Selecting previously unselected package openjdk-21-jre-headless:arm64. Preparing to unpack .../038-openjdk-21-jre-headless_21.0.7~7ea-1_arm64.deb ... Unpacking openjdk-21-jre-headless:arm64 (21.0.7~7ea-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../039-default-jre-headless_2%3a1.21-76_arm64.deb ... Unpacking default-jre-headless (2:1.21-76) ... Selecting previously unselected package ant. Preparing to unpack .../040-ant_1.10.15-1_all.deb ... Unpacking ant (1.10.15-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../041-ant-optional_1.10.15-1_all.deb ... Unpacking ant-optional (1.10.15-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../042-libantlr-java_2.7.7+dfsg-14_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-14) ... Selecting previously unselected package antlr. Preparing to unpack .../043-antlr_2.7.7+dfsg-14_all.deb ... Unpacking antlr (2.7.7+dfsg-14) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../044-at-spi2-common_2.56.0-3_all.deb ... Unpacking at-spi2-common (2.56.0-3) ... Selecting previously unselected package m4. Preparing to unpack .../045-m4_1.4.19-7_arm64.deb ... Unpacking m4 (1.4.19-7) ... Selecting previously unselected package autoconf. Preparing to unpack .../046-autoconf_2.72-3_all.deb ... Unpacking autoconf (2.72-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../047-autotools-dev_20240727.1_all.deb ... Unpacking autotools-dev (20240727.1) ... Selecting previously unselected package automake. Preparing to unpack .../048-automake_1%3a1.17-4_all.deb ... Unpacking automake (1:1.17-4) ... Selecting previously unselected package autopoint. Preparing to unpack .../049-autopoint_0.23.1-1_all.deb ... Unpacking autopoint (0.23.1-1) ... Selecting previously unselected package unzip. Preparing to unpack .../050-unzip_6.0-29_arm64.deb ... Unpacking unzip (6.0-29) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../051-java-wrappers_0.5_all.deb ... Unpacking java-wrappers (0.5) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../052-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../053-junit4_4.13.2-5_all.deb ... Unpacking junit4 (4.13.2-5) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../054-libfelix-framework-java_4.6.1-3_all.deb ... Unpacking libfelix-framework-java (4.6.1-3) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../055-libfelix-gogo-runtime-java_0.16.2-2_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-2) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../056-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../057-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../058-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../059-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../060-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../061-libjansi1-java_1.18-3.1_all.deb ... Unpacking libjansi1-java (1.18-3.1) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../062-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../063-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../064-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../065-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../066-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../067-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dbus-user-session. Preparing to unpack .../068-dbus-user-session_1.16.2-2_arm64.deb ... Unpacking dbus-user-session (1.16.2-2) ... Selecting previously unselected package libdconf1:arm64. Preparing to unpack .../069-libdconf1_0.40.0-5_arm64.deb ... Unpacking libdconf1:arm64 (0.40.0-5) ... Selecting previously unselected package dconf-service. Preparing to unpack .../070-dconf-service_0.40.0-5_arm64.deb ... Unpacking dconf-service (0.40.0-5) ... Selecting previously unselected package dconf-gsettings-backend:arm64. Preparing to unpack .../071-dconf-gsettings-backend_0.40.0-5_arm64.deb ... Unpacking dconf-gsettings-backend:arm64 (0.40.0-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../072-dctrl-tools_2.24-3+b1_arm64.deb ... Unpacking dctrl-tools (2.24-3+b1) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../073-libdebhelper-perl_13.24.1_all.deb ... Unpacking libdebhelper-perl (13.24.1) ... Selecting previously unselected package libtool. Preparing to unpack .../074-libtool_2.5.4-4_all.deb ... Unpacking libtool (2.5.4-4) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../075-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../076-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../077-libfile-stripnondeterminism-perl_1.14.1-2_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.14.1-2) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../078-dh-strip-nondeterminism_1.14.1-2_all.deb ... Unpacking dh-strip-nondeterminism (1.14.1-2) ... Selecting previously unselected package libelf1t64:arm64. Preparing to unpack .../079-libelf1t64_0.192-4_arm64.deb ... Unpacking libelf1t64:arm64 (0.192-4) ... Selecting previously unselected package dwz. Preparing to unpack .../080-dwz_0.15-1+b1_arm64.deb ... Unpacking dwz (0.15-1+b1) ... Selecting previously unselected package libunistring5:arm64. Preparing to unpack .../081-libunistring5_1.3-2_arm64.deb ... Unpacking libunistring5:arm64 (1.3-2) ... Selecting previously unselected package gettext. Preparing to unpack .../082-gettext_0.23.1-1_arm64.deb ... Unpacking gettext (0.23.1-1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../083-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../084-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../085-debhelper_13.24.1_all.deb ... Unpacking debhelper (13.24.1) ... Selecting previously unselected package libatk1.0-0t64:arm64. Preparing to unpack .../086-libatk1.0-0t64_2.56.0-3_arm64.deb ... Unpacking libatk1.0-0t64:arm64 (2.56.0-3) ... Selecting previously unselected package libxau6:arm64. Preparing to unpack .../087-libxau6_1%3a1.0.11-1_arm64.deb ... Unpacking libxau6:arm64 (1:1.0.11-1) ... Selecting previously unselected package libxdmcp6:arm64. Preparing to unpack .../088-libxdmcp6_1%3a1.1.5-1_arm64.deb ... Unpacking libxdmcp6:arm64 (1:1.1.5-1) ... Selecting previously unselected package libxcb1:arm64. Preparing to unpack .../089-libxcb1_1.17.0-2+b1_arm64.deb ... Unpacking libxcb1:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../090-libx11-data_2%3a1.8.12-1_all.deb ... Unpacking libx11-data (2:1.8.12-1) ... Selecting previously unselected package libx11-6:arm64. Preparing to unpack .../091-libx11-6_2%3a1.8.12-1_arm64.deb ... Unpacking libx11-6:arm64 (2:1.8.12-1) ... Selecting previously unselected package libxext6:arm64. Preparing to unpack .../092-libxext6_2%3a1.3.4-1+b3_arm64.deb ... Unpacking libxext6:arm64 (2:1.3.4-1+b3) ... Selecting previously unselected package libxi6:arm64. Preparing to unpack .../093-libxi6_2%3a1.8.2-1_arm64.deb ... Unpacking libxi6:arm64 (2:1.8.2-1) ... Selecting previously unselected package libatspi2.0-0t64:arm64. Preparing to unpack .../094-libatspi2.0-0t64_2.56.0-3_arm64.deb ... Unpacking libatspi2.0-0t64:arm64 (2.56.0-3) ... Selecting previously unselected package libatk-bridge2.0-0t64:arm64. Preparing to unpack .../095-libatk-bridge2.0-0t64_2.56.0-3_arm64.deb ... Unpacking libatk-bridge2.0-0t64:arm64 (2.56.0-3) ... Selecting previously unselected package libbrotli1:arm64. Preparing to unpack .../096-libbrotli1_1.1.0-2+b7_arm64.deb ... Unpacking libbrotli1:arm64 (1.1.0-2+b7) ... Selecting previously unselected package libfreetype6:arm64. Preparing to unpack .../097-libfreetype6_2.13.3+dfsg-1_arm64.deb ... Unpacking libfreetype6:arm64 (2.13.3+dfsg-1) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../098-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../099-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../100-fontconfig-config_2.15.0-2.2_arm64.deb ... Unpacking fontconfig-config (2.15.0-2.2) ... Selecting previously unselected package libfontconfig1:arm64. Preparing to unpack .../101-libfontconfig1_2.15.0-2.2_arm64.deb ... Unpacking libfontconfig1:arm64 (2.15.0-2.2) ... Selecting previously unselected package libpixman-1-0:arm64. Preparing to unpack .../102-libpixman-1-0_0.44.0-3_arm64.deb ... Unpacking libpixman-1-0:arm64 (0.44.0-3) ... Selecting previously unselected package libxcb-render0:arm64. Preparing to unpack .../103-libxcb-render0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-render0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-shm0:arm64. Preparing to unpack .../104-libxcb-shm0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-shm0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxrender1:arm64. Preparing to unpack .../105-libxrender1_1%3a0.9.10-1.1+b4_arm64.deb ... Unpacking libxrender1:arm64 (1:0.9.10-1.1+b4) ... Selecting previously unselected package libcairo2:arm64. Preparing to unpack .../106-libcairo2_1.18.4-1+b1_arm64.deb ... Unpacking libcairo2:arm64 (1.18.4-1+b1) ... Selecting previously unselected package libcairo-gobject2:arm64. Preparing to unpack .../107-libcairo-gobject2_1.18.4-1+b1_arm64.deb ... Unpacking libcairo-gobject2:arm64 (1.18.4-1+b1) ... Selecting previously unselected package libcloudproviders0:arm64. Preparing to unpack .../108-libcloudproviders0_0.3.6-2_arm64.deb ... Unpacking libcloudproviders0:arm64 (0.3.6-2) ... Selecting previously unselected package libcolord2:arm64. Preparing to unpack .../109-libcolord2_1.4.7-3_arm64.deb ... Unpacking libcolord2:arm64 (1.4.7-3) ... Selecting previously unselected package libavahi-common-data:arm64. Preparing to unpack .../110-libavahi-common-data_0.8-16_arm64.deb ... Unpacking libavahi-common-data:arm64 (0.8-16) ... Selecting previously unselected package libavahi-common3:arm64. Preparing to unpack .../111-libavahi-common3_0.8-16_arm64.deb ... Unpacking libavahi-common3:arm64 (0.8-16) ... Selecting previously unselected package libavahi-client3:arm64. Preparing to unpack .../112-libavahi-client3_0.8-16_arm64.deb ... Unpacking libavahi-client3:arm64 (0.8-16) ... Selecting previously unselected package libidn2-0:arm64. Preparing to unpack .../113-libidn2-0_2.3.8-2_arm64.deb ... Unpacking libidn2-0:arm64 (2.3.8-2) ... Selecting previously unselected package libp11-kit0:arm64. Preparing to unpack .../114-libp11-kit0_0.25.5-3_arm64.deb ... Unpacking libp11-kit0:arm64 (0.25.5-3) ... Selecting previously unselected package libtasn1-6:arm64. Preparing to unpack .../115-libtasn1-6_4.20.0-2_arm64.deb ... Unpacking libtasn1-6:arm64 (4.20.0-2) ... Selecting previously unselected package libgnutls30t64:arm64. Preparing to unpack .../116-libgnutls30t64_3.8.9-2_arm64.deb ... Unpacking libgnutls30t64:arm64 (3.8.9-2) ... Selecting previously unselected package libkrb5support0:arm64. Preparing to unpack .../117-libkrb5support0_1.21.3-5_arm64.deb ... Unpacking libkrb5support0:arm64 (1.21.3-5) ... Selecting previously unselected package libcom-err2:arm64. Preparing to unpack .../118-libcom-err2_1.47.2-1+b1_arm64.deb ... Unpacking libcom-err2:arm64 (1.47.2-1+b1) ... Selecting previously unselected package libk5crypto3:arm64. Preparing to unpack .../119-libk5crypto3_1.21.3-5_arm64.deb ... Unpacking libk5crypto3:arm64 (1.21.3-5) ... Selecting previously unselected package libkeyutils1:arm64. Preparing to unpack .../120-libkeyutils1_1.6.3-4_arm64.deb ... Unpacking libkeyutils1:arm64 (1.6.3-4) ... Selecting previously unselected package libkrb5-3:arm64. Preparing to unpack .../121-libkrb5-3_1.21.3-5_arm64.deb ... Unpacking libkrb5-3:arm64 (1.21.3-5) ... Selecting previously unselected package libgssapi-krb5-2:arm64. Preparing to unpack .../122-libgssapi-krb5-2_1.21.3-5_arm64.deb ... Unpacking libgssapi-krb5-2:arm64 (1.21.3-5) ... Selecting previously unselected package libcups2t64:arm64. Preparing to unpack .../123-libcups2t64_2.4.10-2+b1_arm64.deb ... Unpacking libcups2t64:arm64 (2.4.10-2+b1) ... Selecting previously unselected package libepoxy0:arm64. Preparing to unpack .../124-libepoxy0_1.5.10-2_arm64.deb ... Unpacking libepoxy0:arm64 (1.5.10-2) ... Selecting previously unselected package libfribidi0:arm64. Preparing to unpack .../125-libfribidi0_1.0.16-1_arm64.deb ... Unpacking libfribidi0:arm64 (1.0.16-1) ... Selecting previously unselected package libgraphite2-3:arm64. Preparing to unpack .../126-libgraphite2-3_1.3.14-2+b1_arm64.deb ... Unpacking libgraphite2-3:arm64 (1.3.14-2+b1) ... Selecting previously unselected package libharfbuzz0b:arm64. Preparing to unpack .../127-libharfbuzz0b_10.2.0-1+b1_arm64.deb ... Unpacking libharfbuzz0b:arm64 (10.2.0-1+b1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../128-fontconfig_2.15.0-2.2_arm64.deb ... Unpacking fontconfig (2.15.0-2.2) ... Selecting previously unselected package libthai-data. Preparing to unpack .../129-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:arm64. Preparing to unpack .../130-libdatrie1_0.2.13-3+b1_arm64.deb ... Unpacking libdatrie1:arm64 (0.2.13-3+b1) ... Selecting previously unselected package libthai0:arm64. Preparing to unpack .../131-libthai0_0.1.29-2+b1_arm64.deb ... Unpacking libthai0:arm64 (0.1.29-2+b1) ... Selecting previously unselected package libpango-1.0-0:arm64. Preparing to unpack .../132-libpango-1.0-0_1.56.3-1_arm64.deb ... Unpacking libpango-1.0-0:arm64 (1.56.3-1) ... Selecting previously unselected package libpangoft2-1.0-0:arm64. Preparing to unpack .../133-libpangoft2-1.0-0_1.56.3-1_arm64.deb ... Unpacking libpangoft2-1.0-0:arm64 (1.56.3-1) ... Selecting previously unselected package libpangocairo-1.0-0:arm64. Preparing to unpack .../134-libpangocairo-1.0-0_1.56.3-1_arm64.deb ... Unpacking libpangocairo-1.0-0:arm64 (1.56.3-1) ... Selecting previously unselected package libwayland-client0:arm64. Preparing to unpack .../135-libwayland-client0_1.23.1-3_arm64.deb ... Unpacking libwayland-client0:arm64 (1.23.1-3) ... Selecting previously unselected package libwayland-cursor0:arm64. Preparing to unpack .../136-libwayland-cursor0_1.23.1-3_arm64.deb ... Unpacking libwayland-cursor0:arm64 (1.23.1-3) ... Selecting previously unselected package libwayland-egl1:arm64. Preparing to unpack .../137-libwayland-egl1_1.23.1-3_arm64.deb ... Unpacking libwayland-egl1:arm64 (1.23.1-3) ... Selecting previously unselected package libxcomposite1:arm64. Preparing to unpack .../138-libxcomposite1_1%3a0.4.6-1_arm64.deb ... Unpacking libxcomposite1:arm64 (1:0.4.6-1) ... Selecting previously unselected package libxfixes3:arm64. Preparing to unpack .../139-libxfixes3_1%3a6.0.0-2+b4_arm64.deb ... Unpacking libxfixes3:arm64 (1:6.0.0-2+b4) ... Selecting previously unselected package libxcursor1:arm64. Preparing to unpack .../140-libxcursor1_1%3a1.2.3-1_arm64.deb ... Unpacking libxcursor1:arm64 (1:1.2.3-1) ... Selecting previously unselected package libxdamage1:arm64. Preparing to unpack .../141-libxdamage1_1%3a1.1.6-1+b2_arm64.deb ... Unpacking libxdamage1:arm64 (1:1.1.6-1+b2) ... Selecting previously unselected package libxinerama1:arm64. Preparing to unpack .../142-libxinerama1_2%3a1.1.4-3+b3_arm64.deb ... Unpacking libxinerama1:arm64 (2:1.1.4-3+b3) ... Selecting previously unselected package xkb-data. Preparing to unpack .../143-xkb-data_2.42-1_all.deb ... Unpacking xkb-data (2.42-1) ... Selecting previously unselected package libxkbcommon0:arm64. Preparing to unpack .../144-libxkbcommon0_1.7.0-2_arm64.deb ... Unpacking libxkbcommon0:arm64 (1.7.0-2) ... Selecting previously unselected package libxrandr2:arm64. Preparing to unpack .../145-libxrandr2_2%3a1.5.4-1+b3_arm64.deb ... Unpacking libxrandr2:arm64 (2:1.5.4-1+b3) ... Selecting previously unselected package libgtk-3-common. Preparing to unpack .../146-libgtk-3-common_3.24.49-2_all.deb ... Unpacking libgtk-3-common (3.24.49-2) ... Selecting previously unselected package libgtk-3-0t64:arm64. Preparing to unpack .../147-libgtk-3-0t64_3.24.49-2_arm64.deb ... Unpacking libgtk-3-0t64:arm64 (3.24.49-2) ... Selecting previously unselected package libglvnd0:arm64. Preparing to unpack .../148-libglvnd0_1.7.0-1+b2_arm64.deb ... Unpacking libglvnd0:arm64 (1.7.0-1+b2) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../149-libdrm-common_2.4.124-1_all.deb ... Unpacking libdrm-common (2.4.124-1) ... Selecting previously unselected package libdrm2:arm64. Preparing to unpack .../150-libdrm2_2.4.124-1_arm64.deb ... Unpacking libdrm2:arm64 (2.4.124-1) ... Selecting previously unselected package libx11-xcb1:arm64. Preparing to unpack .../151-libx11-xcb1_2%3a1.8.12-1_arm64.deb ... Unpacking libx11-xcb1:arm64 (2:1.8.12-1) ... Selecting previously unselected package libxcb-dri3-0:arm64. Preparing to unpack .../152-libxcb-dri3-0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-dri3-0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-glx0:arm64. Preparing to unpack .../153-libxcb-glx0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-glx0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-present0:arm64. Preparing to unpack .../154-libxcb-present0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-present0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-xfixes0:arm64. Preparing to unpack .../155-libxcb-xfixes0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-xfixes0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxxf86vm1:arm64. Preparing to unpack .../156-libxxf86vm1_1%3a1.1.4-1+b4_arm64.deb ... Unpacking libxxf86vm1:arm64 (1:1.1.4-1+b4) ... Selecting previously unselected package libdrm-amdgpu1:arm64. Preparing to unpack .../157-libdrm-amdgpu1_2.4.124-1_arm64.deb ... Unpacking libdrm-amdgpu1:arm64 (2.4.124-1) ... Selecting previously unselected package libedit2:arm64. Preparing to unpack .../158-libedit2_3.1-20250104-1_arm64.deb ... Unpacking libedit2:arm64 (3.1-20250104-1) ... Selecting previously unselected package libz3-4:arm64. Preparing to unpack .../159-libz3-4_4.13.3-1_arm64.deb ... Unpacking libz3-4:arm64 (4.13.3-1) ... Selecting previously unselected package libllvm19:arm64. Preparing to unpack .../160-libllvm19_1%3a19.1.7-3_arm64.deb ... Unpacking libllvm19:arm64 (1:19.1.7-3) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../161-libsensors-config_1%3a3.6.0-10_all.deb ... Unpacking libsensors-config (1:3.6.0-10) ... Selecting previously unselected package libsensors5:arm64. Preparing to unpack .../162-libsensors5_1%3a3.6.0-10+b1_arm64.deb ... Unpacking libsensors5:arm64 (1:3.6.0-10+b1) ... Selecting previously unselected package libxcb-randr0:arm64. Preparing to unpack .../163-libxcb-randr0_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-randr0:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxcb-sync1:arm64. Preparing to unpack .../164-libxcb-sync1_1.17.0-2+b1_arm64.deb ... Unpacking libxcb-sync1:arm64 (1.17.0-2+b1) ... Selecting previously unselected package libxshmfence1:arm64. Preparing to unpack .../165-libxshmfence1_1.3-1+b3_arm64.deb ... Unpacking libxshmfence1:arm64 (1.3-1+b3) ... Selecting previously unselected package mesa-libgallium:arm64. Preparing to unpack .../166-mesa-libgallium_25.0.2-1_arm64.deb ... Unpacking mesa-libgallium:arm64 (25.0.2-1) ... Selecting previously unselected package libwayland-server0:arm64. Preparing to unpack .../167-libwayland-server0_1.23.1-3_arm64.deb ... Unpacking libwayland-server0:arm64 (1.23.1-3) ... Selecting previously unselected package libgbm1:arm64. Preparing to unpack .../168-libgbm1_25.0.2-1_arm64.deb ... Unpacking libgbm1:arm64 (25.0.2-1) ... Selecting previously unselected package libvulkan1:arm64. Preparing to unpack .../169-libvulkan1_1.4.309.0-1_arm64.deb ... Unpacking libvulkan1:arm64 (1.4.309.0-1) ... Selecting previously unselected package libgl1-mesa-dri:arm64. Preparing to unpack .../170-libgl1-mesa-dri_25.0.2-1_arm64.deb ... Unpacking libgl1-mesa-dri:arm64 (25.0.2-1) ... Selecting previously unselected package libglx-mesa0:arm64. Preparing to unpack .../171-libglx-mesa0_25.0.2-1_arm64.deb ... Unpacking libglx-mesa0:arm64 (25.0.2-1) ... Selecting previously unselected package libglx0:arm64. Preparing to unpack .../172-libglx0_1.7.0-1+b2_arm64.deb ... Unpacking libglx0:arm64 (1.7.0-1+b2) ... Selecting previously unselected package libgl1:arm64. Preparing to unpack .../173-libgl1_1.7.0-1+b2_arm64.deb ... Unpacking libgl1:arm64 (1.7.0-1+b2) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../174-libasound2-data_1.2.13-1_all.deb ... Unpacking libasound2-data (1.2.13-1) ... Selecting previously unselected package libasound2t64:arm64. Preparing to unpack .../175-libasound2t64_1.2.13-1+b1_arm64.deb ... Unpacking libasound2t64:arm64 (1.2.13-1+b1) ... Selecting previously unselected package libgif7:arm64. Preparing to unpack .../176-libgif7_5.2.2-1+b1_arm64.deb ... Unpacking libgif7:arm64 (5.2.2-1+b1) ... Selecting previously unselected package x11-common. Preparing to unpack .../177-x11-common_1%3a7.7+24_all.deb ... Unpacking x11-common (1:7.7+24) ... Selecting previously unselected package libxtst6:arm64. Preparing to unpack .../178-libxtst6_2%3a1.2.5-1_arm64.deb ... Unpacking libxtst6:arm64 (2:1.2.5-1) ... Selecting previously unselected package openjdk-21-jre:arm64. Preparing to unpack .../179-openjdk-21-jre_21.0.7~7ea-1_arm64.deb ... Unpacking openjdk-21-jre:arm64 (21.0.7~7ea-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../180-default-jre_2%3a1.21-76_arm64.deb ... Unpacking default-jre (2:1.21-76) ... Selecting previously unselected package openjdk-21-jdk-headless:arm64. Preparing to unpack .../181-openjdk-21-jdk-headless_21.0.7~7ea-1_arm64.deb ... Unpacking openjdk-21-jdk-headless:arm64 (21.0.7~7ea-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../182-default-jdk-headless_2%3a1.21-76_arm64.deb ... Unpacking default-jdk-headless (2:1.21-76) ... Selecting previously unselected package openjdk-21-jdk:arm64. Preparing to unpack .../183-openjdk-21-jdk_21.0.7~7ea-1_arm64.deb ... Unpacking openjdk-21-jdk:arm64 (21.0.7~7ea-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../184-default-jdk_2%3a1.21-76_arm64.deb ... Unpacking default-jdk (2:1.21-76) ... Selecting previously unselected package libgpg-error0:arm64. Preparing to unpack .../185-libgpg-error0_1.51-4_arm64.deb ... Unpacking libgpg-error0:arm64 (1.51-4) ... Selecting previously unselected package libassuan9:arm64. Preparing to unpack .../186-libassuan9_3.0.2-2_arm64.deb ... Unpacking libassuan9:arm64 (3.0.2-2) ... Selecting previously unselected package libgcrypt20:arm64. Preparing to unpack .../187-libgcrypt20_1.11.0-7_arm64.deb ... Unpacking libgcrypt20:arm64 (1.11.0-7) ... Selecting previously unselected package gpgconf. Preparing to unpack .../188-gpgconf_2.2.46-6_arm64.deb ... Unpacking gpgconf (2.2.46-6) ... Selecting previously unselected package libksba8:arm64. Preparing to unpack .../189-libksba8_1.6.7-2+b1_arm64.deb ... Unpacking libksba8:arm64 (1.6.7-2+b1) ... Selecting previously unselected package libsasl2-modules-db:arm64. Preparing to unpack .../190-libsasl2-modules-db_2.1.28+dfsg1-9_arm64.deb ... Unpacking libsasl2-modules-db:arm64 (2.1.28+dfsg1-9) ... Selecting previously unselected package libsasl2-2:arm64. Preparing to unpack .../191-libsasl2-2_2.1.28+dfsg1-9_arm64.deb ... Unpacking libsasl2-2:arm64 (2.1.28+dfsg1-9) ... Selecting previously unselected package libldap2:arm64. Preparing to unpack .../192-libldap2_2.6.9+dfsg-2_arm64.deb ... Unpacking libldap2:arm64 (2.6.9+dfsg-2) ... Selecting previously unselected package libnpth0t64:arm64. Preparing to unpack .../193-libnpth0t64_1.8-2_arm64.deb ... Unpacking libnpth0t64:arm64 (1.8-2) ... Selecting previously unselected package dirmngr. Preparing to unpack .../194-dirmngr_2.2.46-6_arm64.deb ... Unpacking dirmngr (2.2.46-6) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../195-gnupg-l10n_2.2.46-6_all.deb ... Unpacking gnupg-l10n (2.2.46-6) ... Selecting previously unselected package gpg. Preparing to unpack .../196-gpg_2.2.46-6_arm64.deb ... Unpacking gpg (2.2.46-6) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../197-pinentry-curses_1.3.1-2_arm64.deb ... Unpacking pinentry-curses (1.3.1-2) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../198-gpg-agent_2.2.46-6_arm64.deb ... Unpacking gpg-agent (2.2.46-6) ... Selecting previously unselected package gpgsm. Preparing to unpack .../199-gpgsm_2.2.46-6_arm64.deb ... Unpacking gpgsm (2.2.46-6) ... Selecting previously unselected package gnupg. Preparing to unpack .../200-gnupg_2.2.46-6_all.deb ... Unpacking gnupg (2.2.46-6) ... Selecting previously unselected package gpgv. Preparing to unpack .../201-gpgv_2.2.46-6_arm64.deb ... Unpacking gpgv (2.2.46-6) ... Selecting previously unselected package sopv-gpgv. Preparing to unpack .../202-sopv-gpgv_0.1.4-1_all.deb ... Unpacking sopv-gpgv (0.1.4-1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../203-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../204-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../205-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../206-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../207-libio-pty-perl_1%3a1.20-1+b2_arm64.deb ... Unpacking libio-pty-perl (1:1.20-1+b2) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../208-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../209-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../210-libclass-xsaccessor-perl_1.19-4+b5_arm64.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b5) ... Selecting previously unselected package libb-hooks-op-check-perl:arm64. Preparing to unpack .../211-libb-hooks-op-check-perl_0.22-3+b2_arm64.deb ... Unpacking libb-hooks-op-check-perl:arm64 (0.22-3+b2) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../212-libdynaloader-functions-perl_0.004-1_all.deb ... Unpacking libdynaloader-functions-perl (0.004-1) ... Selecting previously unselected package libdevel-callchecker-perl:arm64. Preparing to unpack .../213-libdevel-callchecker-perl_0.009-1+b1_arm64.deb ... Unpacking libdevel-callchecker-perl:arm64 (0.009-1+b1) ... Selecting previously unselected package libparams-classify-perl:arm64. Preparing to unpack .../214-libparams-classify-perl_0.015-2+b4_arm64.deb ... Unpacking libparams-classify-perl:arm64 (0.015-2+b4) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../215-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../216-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../217-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../218-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../219-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../220-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../221-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../222-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../223-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../224-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../225-liburi-perl_5.30-1_all.deb ... Unpacking liburi-perl (5.30-1) ... Selecting previously unselected package libhtml-parser-perl:arm64. Preparing to unpack .../226-libhtml-parser-perl_3.83-1+b2_arm64.deb ... Unpacking libhtml-parser-perl:arm64 (3.83-1+b2) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../227-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:arm64. Preparing to unpack .../228-libclone-perl_0.47-1+b1_arm64.deb ... Unpacking libclone-perl:arm64 (0.47-1+b1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../229-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../230-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../231-libhttp-message-perl_7.00-2_all.deb ... Unpacking libhttp-message-perl (7.00-2) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../232-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../233-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:arm64. Preparing to unpack .../234-perl-openssl-defaults_7+b2_arm64.deb ... Unpacking perl-openssl-defaults:arm64 (7+b2) ... Selecting previously unselected package libnet-ssleay-perl:arm64. Preparing to unpack .../235-libnet-ssleay-perl_1.94-3_arm64.deb ... Unpacking libnet-ssleay-perl:arm64 (1.94-3) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../236-libio-socket-ssl-perl_2.089-1_all.deb ... Unpacking libio-socket-ssl-perl (2.089-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../237-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../238-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../239-libtry-tiny-perl_0.32-1_all.deb ... Unpacking libtry-tiny-perl (0.32-1) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../240-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../241-libwww-perl_6.78-1_all.deb ... Unpacking libwww-perl (6.78-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../242-patchutils_0.4.2-1+b1_arm64.deb ... Unpacking patchutils (0.4.2-1+b1) ... Selecting previously unselected package wdiff. Preparing to unpack .../243-wdiff_1.2.2-8_arm64.deb ... Unpacking wdiff (1.2.2-8) ... Selecting previously unselected package devscripts. Preparing to unpack .../244-devscripts_2.25.5_all.deb ... Unpacking devscripts (2.25.5) ... Selecting previously unselected package fastjar. Preparing to unpack .../245-fastjar_2%3a0.98-7+b1_arm64.deb ... Unpacking fastjar (2:0.98-7+b1) ... Selecting previously unselected package ivy. Preparing to unpack .../246-ivy_2.5.3-1_all.deb ... Unpacking ivy (2.5.3-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../247-libasm-java_9.7.1-1_all.deb ... Unpacking libasm-java (9.7.1-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../248-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../249-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../250-libapache-pom-java_33-2_all.deb ... Unpacking libapache-pom-java (33-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../251-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../252-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../253-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../254-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../255-libqdox-java_1.12.1-4_all.deb ... Unpacking libqdox-java (1.12.1-4) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../256-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../257-libxpp3-java_1.1.4c-4_all.deb ... Unpacking libxpp3-java (1.1.4c-4) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../258-libxstream-java_1.4.21-1_all.deb ... Unpacking libxstream-java (1.4.21-1) ... Selecting previously unselected package groovy. Preparing to unpack .../259-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../260-libatinject-jsr330-api-java_1.0+ds1-6_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-6) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../261-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../262-libcommons-codec-java_1.18.0-1_all.deb ... Unpacking libcommons-codec-java (1.18.0-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../263-libcommons-io-java_2.18.0-1_all.deb ... Unpacking libcommons-io-java (2.18.0-1) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../264-libcommons-compress-java_1.27.1-2_all.deb ... Unpacking libcommons-compress-java (1.27.1-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../265-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../266-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../267-libjsr305-java_0.1~+svn49-12_all.deb ... Unpacking libjsr305-java (0.1~+svn49-12) ... Selecting previously unselected package libguava-java. Preparing to unpack .../268-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../269-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../270-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../271-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../272-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../273-libjna-jni_5.15.0-1_arm64.deb ... Unpacking libjna-jni (5.15.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../274-libjna-java_5.15.0-1_all.deb ... Unpacking libjna-java (5.15.0-1) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../275-libbcprov-java_1.80-2_all.deb ... Unpacking libbcprov-java (1.80-2) ... Selecting previously unselected package libjunixsocket-jni. Preparing to unpack .../276-libjunixsocket-jni_2.6.1-1+b1_arm64.deb ... Unpacking libjunixsocket-jni (2.6.1-1+b1) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../277-libeclipse-jdt-annotation-java_2.2.700+eclipse4.29-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ... Selecting previously unselected package libjunixsocket-java. Preparing to unpack .../278-libjunixsocket-java_2.6.1-1_all.deb ... Unpacking libjunixsocket-java (2.6.1-1) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../279-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package liblightcouch-java. Preparing to unpack .../280-liblightcouch-java_0.2.0-1_all.deb ... Unpacking liblightcouch-java (0.2.0-1) ... Selecting previously unselected package libmongodb-java. Preparing to unpack .../281-libmongodb-java_3.6.3-2_all.deb ... Unpacking libmongodb-java (3.6.3-2) ... Selecting previously unselected package liblog4j2-java. Preparing to unpack .../282-liblog4j2-java_2.19.0-2_all.deb ... Unpacking liblog4j2-java (2.19.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../283-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../284-libjsch-java_0.2.19-1_all.deb ... Unpacking libjsch-java (0.2.19-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../285-libminlog-java_1.3.1-1_all.deb ... Unpacking libminlog-java (1.3.1-1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../286-libobjenesis-java_3.4-2_all.deb ... Unpacking libobjenesis-java (3.4-2) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../287-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../288-libkryo-java_2.20-8_all.deb ... Unpacking libkryo-java (2.20-8) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../289-liblogback-java_1%3a1.2.11-6_all.deb ... Unpacking liblogback-java (1:1.2.11-6) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../290-libnative-platform-jni_0.14-6+b1_arm64.deb ... Unpacking libnative-platform-jni (0.14-6+b1) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../291-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../292-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../293-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../294-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../295-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../296-libxbean-reflect-java_4.5-9_all.deb ... Unpacking libxbean-reflect-java (4.5-9) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../297-libgradle-core-java_4.4.1-22_all.deb ... Unpacking libgradle-core-java (4.4.1-22) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../298-libbcpg-java_1.80-2_all.deb ... Unpacking libbcpg-java (1.80-2) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../299-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../300-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../301-libjaxen-java_1.1.6-5_all.deb ... Unpacking libjaxen-java (1.1.6-5) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../302-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../303-libcommons-lang3-java_3.17.0-1_all.deb ... Unpacking libcommons-lang3-java (3.17.0-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../304-libbcel-java_6.10.0-1_all.deb ... Unpacking libbcel-java (6.10.0-1) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../305-libjformatstring-java_0.10~20131207-3_all.deb ... Unpacking libjformatstring-java (0.10~20131207-3) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../306-libfindbugs-java_3.1.0~preview2-4_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-4) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../307-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../308-libguice-java_5.1.0-1_all.deb ... Unpacking libguice-java (5.1.0-1) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../309-libjatl-java_0.2.3-2_all.deb ... Unpacking libjatl-java (0.2.3-2) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../310-libjcifs-java_1.3.19+dfsg-1_all.deb ... Unpacking libjcifs-java (1.3.19+dfsg-1) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../311-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../312-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../313-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../314-libjetty9-java_9.4.57-1_all.deb ... Unpacking libjetty9-java (9.4.57-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../315-libjgit-java_6.7.0-2_all.deb ... Unpacking libjgit-java (6.7.0-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../316-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../317-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../318-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../319-libmaven-resolver-java_1.9.22-1_all.deb ... Unpacking libmaven-resolver-java (1.9.22-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../320-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../321-libmaven-parent-java_43-2_all.deb ... Unpacking libmaven-parent-java (43-2) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../322-libmaven-shared-utils-java_3.4.2-1_all.deb ... Unpacking libmaven-shared-utils-java (3.4.2-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../323-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../324-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../325-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../326-libplexus-interpolation-java_1.27-1_all.deb ... Unpacking libplexus-interpolation-java (1.27-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../327-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../328-libgeronimo-interceptor-3.0-spec-java_1.0.1-5_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-5) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../329-libcdi-api-java_1.2-4_all.deb ... Unpacking libcdi-api-java (1.2-4) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../330-libsisu-inject-java_0.3.5-1_all.deb ... Unpacking libsisu-inject-java (0.3.5-1) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../331-libsisu-plexus-java_0.3.5-1_all.deb ... Unpacking libsisu-plexus-java (0.3.5-1) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../332-libmaven3-core-java_3.9.9-1_all.deb ... Unpacking libmaven3-core-java (3.9.9-1) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../333-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../334-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../335-librhino-java_1.7.15-1_all.deb ... Unpacking librhino-java (1.7.15-1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../336-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../337-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../338-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../339-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../340-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../341-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../342-libgradle-plugins-java_4.4.1-22_all.deb ... Unpacking libgradle-plugins-java (4.4.1-22) ... Selecting previously unselected package gradle. Preparing to unpack .../343-gradle_4.4.1-22_all.deb ... Unpacking gradle (4.4.1-22) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../344-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../345-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../346-jarwrapper_0.80_all.deb ... Unpacking jarwrapper (0.80) ... Selecting previously unselected package javahelper. Preparing to unpack .../347-javahelper_0.80_all.deb ... Unpacking javahelper (0.80) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../348-libbyte-buddy-java_1.14.19-1_all.deb ... Unpacking libbyte-buddy-java (1.14.19-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../349-libcommons-math3-java_3.6.1-4_all.deb ... Unpacking libcommons-math3-java (3.6.1-4) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../350-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../351-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../352-libjackson2-databind-java_2.14.0+ds-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0+ds-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../353-liblz4-jni_1.8.0-4+b1_arm64.deb ... Unpacking liblz4-jni (1.8.0-4+b1) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../354-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../355-libmockito-java_3.3.0-2_all.deb ... Unpacking libmockito-java (3.3.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../356-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../357-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19+dfsg-1) ... Setting up libbcprov-java (1.80-2) ... Setting up media-types (13.0.0) ... Setting up libpipeline1:arm64 (1.5.8-1) ... Setting up fastjar (2:0.98-7+b1) ... Setting up libgraphite2-3:arm64 (1.3.14-2+b1) ... Setting up liblcms2-2:arm64 (2.16-2) ... Setting up libpixman-1-0:arm64 (0.44.0-3) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-8) ... Setting up libsharpyuv0:arm64 (1.5.0-0.1) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up systemd-sysv (257.4-3) ... Setting up libxau6:arm64 (1:1.0.11-1) ... Setting up libxdmcp6:arm64 (1:1.1.5-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libnpth0t64:arm64 (1.8-2) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libkeyutils1:arm64 (1.6.3-4) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libxcb1:arm64 (1.17.0-2+b1) ... Setting up libqdox-java (1.12.1-4) ... Setting up libxcb-xfixes0:arm64 (1.17.0-2+b1) ... Setting up liblerc4:arm64 (4.0.0+ds-5) ... Setting up libjsr305-java (0.1~+svn49-12) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.40.4-5) ... Setting up hicolor-icon-theme (0.18-2) ... Setting up libgpg-error0:arm64 (1.51-4) ... Setting up java-common (0.76) ... Setting up libdynaloader-functions-perl (0.004-1) ... Setting up libdatrie1:arm64 (0.2.13-3+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.4-2) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1+b2) ... Setting up libmagic-mgc (1:5.46-3) ... Setting up libxcb-render0:arm64 (1.17.0-2+b1) ... Setting up liblogback-java (1:1.2.11-6) ... Setting up libclone-perl:arm64 (0.47-1+b1) ... Setting up libminlog-java (1.3.1-1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglvnd0:arm64 (1.7.0-1+b2) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up libxcb-glx0:arm64 (1.17.0-2+b1) ... Setting up unzip (6.0-29) ... Setting up libdebhelper-perl (13.24.1) ... Setting up libbrotli1:arm64 (1.1.0-2+b7) ... Setting up libedit2:arm64 (3.1-20250104-1) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-2) ... Setting up libmagic1t64:arm64 (1:5.46-3) ... Setting up libasm-java (9.7.1-1) ... Setting up x11-common (1:7.7+24) ... Running in chroot, ignoring request. Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.32-1) ... Setting up libsensors-config (1:3.6.0-10) ... Setting up libdeflate0:arm64 (1.23-1+b1) ... Setting up perl-openssl-defaults:arm64 (7+b2) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.23.1-1) ... Setting up m4 (1.4.19-7) ... Setting up libel-api-java (3.0.0-3) ... Setting up libgcrypt20:arm64 (1.11.0-7) ... Setting up xkb-data (2.42-1) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libxcb-shm0:arm64 (1.17.0-2+b1) ... Setting up libcom-err2:arm64 (1.47.2-1+b1) ... Setting up file (1:5.46-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-2) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:arm64 (2.1-6.1+b2) ... Setting up libelf1t64:arm64 (0.192-4) ... Setting up libkrb5support0:arm64 (1.21.3-5) ... Setting up libsasl2-modules-db:arm64 (2.1.28+dfsg1-9) ... Setting up tzdata (2025b-1) ... Current default time zone: 'Etc/UTC' Local time is now: Tue Mar 25 10:15:24 UTC 2025. Universal Time is now: Tue Mar 25 10:15:24 UTC 2025. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libxcb-present0:arm64 (1.17.0-2+b1) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-5) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.13-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.15-1) ... Setting up autotools-dev (20240727.1) ... Setting up libz3-4:arm64 (4.13.3-1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-3) ... Setting up libasound2t64:arm64 (1.2.13-1+b1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:arm64 (1:2.1.5-3.1) ... Setting up libjaxen-java (1.1.6-5) ... Setting up libx11-data (2:1.8.12-1) ... Setting up libepoxy0:arm64 (1.5.10-2) ... Setting up libnspr4:arm64 (2:4.36-1) ... Setting up gnupg-l10n (2.2.46-6) ... Setting up libxcb-sync1:arm64 (1.17.0-2+b1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.29-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (33-2) ... Setting up libavahi-common-data:arm64 (0.8-16) ... Setting up libxpp3-java (1.1.4c-4) ... Setting up libatinject-jsr330-api-java (1.0+ds1-6) ... Setting up libdbus-1-3:arm64 (1.16.2-2) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:arm64 (1.0.16-1) ... Setting up libproc2-0:arm64 (2:4.0.4-7) ... Setting up libplexus-interpolation-java (1.27-1) ... Setting up libunistring5:arm64 (1.3-2) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16t64:arm64 (1.6.47-1.1) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-8) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up autopoint (0.23.1-1) ... Setting up binfmt-support (2.2.2-7+b1) ... Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Created symlink '/etc/systemd/system/multi-user.target.wants/binfmt-support.service' -> '/usr/lib/systemd/system/binfmt-support.service'. Setting up libb-hooks-op-check-perl:arm64 (0.22-3+b2) ... Setting up libjunixsocket-jni (2.6.1-1+b1) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-3) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up libpcsclite1:arm64 (2.3.1-1) ... Setting up libsensors5:arm64 (1:3.6.0-10+b1) ... Setting up libmongodb-java (3.6.3-2) ... Setting up libk5crypto3:arm64 (1.21.3-5) ... Setting up libhamcrest-java (2.2-2) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:arm64 (2.1.28+dfsg1-9) ... Setting up libvulkan1:arm64 (1.4.309.0-1) ... Setting up autoconf (2.72-3) ... Setting up libwebp7:arm64 (1.5.0-0.1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libgif7:arm64 (5.2.2-1+b1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libffi8:arm64 (3.4.7-1) ... Setting up libtrove3-java (3.0.3-5) ... Setting up dwz (0.15-1+b1) ... Setting up sensible-utils (0.0.24) ... Setting up libxshmfence1:arm64 (1.3-1+b3) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.56.0-3) ... Setting up gpgv (2.2.46-6) ... Setting up libtiff6:arm64 (4.5.1+git230720-5) ... Setting up libxcb-randr0:arm64 (1.17.0-2+b1) ... Setting up dbus-session-bus-common (1.16.2-2) ... Setting up libuchardet0:arm64 (0.0.8-1+b2) ... Setting up libassuan9:arm64 (3.0.2-2) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up procps (2:4.0.4-7) ... Setting up libxbean-reflect-java (4.5-9) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libtasn1-6:arm64 (4.20.0-2) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libx11-6:arm64 (2:1.8.12-1) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.5) ... Setting up libcommons-math3-java (3.6.1-4) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6+b1) ... Setting up libclass-xsaccessor-perl (1.19-4+b5) ... Setting up libkrb5-3:arm64 (1.21.3-5) ... Setting up liblz4-jni (1.8.0-4+b1) ... Setting up libwayland-egl1:arm64 (1.23.1-3) ... Setting up libicu76:arm64 (76.1-3) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.80-2) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up dbus-system-bus-common (1.16.2-2) ... Creating group 'messagebus' with GID 997. Creating user 'messagebus' (System Message Bus) with UID 997 and GID 997. Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-14) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.4.1-1) ... Setting up libdrm-common (2.4.124-1) ... Setting up libcdi-api-java (1.2-4) ... Setting up libxcomposite1:arm64 (1:0.4.6-1) ... Setting up readline-common (8.2-6) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:arm64 (2.12.7+dfsg+really2.9.14-0.3+b1) ... Setting up libldap2:arm64 (2.6.9+dfsg-2) ... Setting up liburi-perl (5.30-1) ... Setting up dbus-bin (1.16.2-2) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3+b1) ... Setting up libjatl-java (0.2.3-2) ... Setting up libxkbcommon0:arm64 (1.7.0-2) ... Setting up libwayland-client0:arm64 (1.23.1-3) ... Setting up libnet-ssleay-perl:arm64 (1.94-3) ... Setting up automake (1:1.17-4) ... update-alternatives: using /usr/bin/automake-1.17 to provide /usr/bin/automake (automake) in auto mode Setting up libksba8:arm64 (1.6.7-2+b1) ... Setting up pinentry-curses (1.3.1-2) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libfile-stripnondeterminism-perl (1.14.1-2) ... Setting up libxcb-dri3-0:arm64 (1.17.0-2+b1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libllvm19:arm64 (1:19.1.7-3) ... Setting up libwayland-server0:arm64 (1.23.1-3) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libx11-xcb1:arm64 (2:1.8.12-1) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.21-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up liblz4-java (1.8.0-4) ... Setting up gettext (0.23.1-1) ... Setting up libjetty9-java (9.4.57-1) ... Setting up libxdamage1:arm64 (1:1.1.6-1+b2) ... Setting up java-wrappers (0.5) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libxrender1:arm64 (1:0.9.10-1.1+b4) ... Setting up jarwrapper (0.80) ... Setting up libtool (2.5.4-4) ... Setting up fontconfig-config (2.15.0-2.2) ... Setting up libmaven-parent-java (43-2) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:arm64 (0.8-16) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libxext6:arm64 (2:1.3.4-1+b3) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.5-1) ... Setting up libidn2-0:arm64 (2.3.8-2) ... Setting up libnss3:arm64 (2:3.109-1) ... Setting up dbus-daemon (1.16.2-2) ... Setting up libdevel-callchecker-perl:arm64 (0.009-1+b1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libjunixsocket-java (2.6.1-1) ... Setting up libjackson2-databind-java (2.14.0+ds-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up libxxf86vm1:arm64 (1:1.1.4-1+b4) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1+b1) ... Setting up libthai0:arm64 (0.1.29-2+b1) ... Setting up ca-certificates (20241223) ... Updating certificates in /etc/ssl/certs... 152 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.5-1) ... Setting up libglib2.0-0t64:arm64 (2.84.0-2) ... Setting up libfreetype6:arm64 (2.13.3+dfsg-1) ... Setting up libxfixes3:arm64 (1:6.0.0-2+b4) ... Setting up testng (6.9.12-4) ... Setting up dbus (1.16.2-2) ... Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Setting up shared-mime-info (2.4-5+b2) ... Setting up libp11-kit0:arm64 (0.25.5-3) ... Setting up libxinerama1:arm64 (2:1.1.4-3+b3) ... Setting up libgssapi-krb5-2:arm64 (1.21.3-5) ... Setting up libxrandr2:arm64 (2:1.5.4-1+b3) ... Setting up libjna-jni (5.15.0-1) ... Setting up libcommons-lang3-java (3.17.0-1) ... Setting up libreadline8t64:arm64 (8.2-6) ... Setting up dh-strip-nondeterminism (1.14.1-2) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:arm64 (2.4.124-1) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-7) ... Setting up libwayland-cursor0:arm64 (1.23.1-3) ... Setting up libhtml-parser-perl:arm64 (3.83-1+b2) ... Setting up libjna-java (5.15.0-1) ... Setting up gpgconf (2.2.46-6) ... Setting up libpam-systemd:arm64 (257.4-3) ... Setting up libjansi1-java (1.18-3.1) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libharfbuzz0b:arm64 (10.2.0-1+b1) ... Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.12+dfsg-2) ... Setting up libfontconfig1:arm64 (2.15.0-2.2) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.18.0-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libpython3.13-stdlib:arm64 (3.13.2-2) ... Setting up libavahi-client3:arm64 (0.8-16) ... Setting up libio-socket-ssl-perl (2.089-1) ... Setting up gpg (2.2.46-6) ... Setting up libpython3-stdlib:arm64 (3.13.2-2) ... Setting up libhttp-message-perl (7.00-2) ... Setting up libdrm-amdgpu1:arm64 (2.4.124-1) ... Setting up libgnutls30t64:arm64 (3.8.9-2) ... Setting up gtk-update-icon-cache (4.18.2+ds-1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up mesa-libgallium:arm64 (25.0.2-1) ... Setting up fontconfig (2.15.0-2.2) ... Regenerating fonts cache... done. Setting up gpg-agent (2.2.46-6) ... Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-browser.socket' -> '/usr/lib/systemd/user/gpg-agent-browser.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-extra.socket' -> '/usr/lib/systemd/user/gpg-agent-extra.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent-ssh.socket' -> '/usr/lib/systemd/user/gpg-agent-ssh.socket'. Created symlink '/etc/systemd/user/sockets.target.wants/gpg-agent.socket' -> '/usr/lib/systemd/user/gpg-agent.socket'. Setting up libatk1.0-0t64:arm64 (2.56.0-3) ... Setting up openjdk-21-jre-headless:arm64 (21.0.7~7ea-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up libxi6:arm64 (2:1.8.2-1) ... Setting up libgbm1:arm64 (25.0.2-1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up python3.13 (3.13.2-2) ... Setting up libcommons-io-java (2.18.0-1) ... Setting up libxtst6:arm64 (2:1.2.5-1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libxcursor1:arm64 (1:1.2.3-1) ... Setting up libparams-classify-perl:arm64 (0.015-2+b4) ... Setting up gpgsm (2.2.46-6) ... Setting up libpango-1.0-0:arm64 (1.56.3-1) ... Setting up libgl1-mesa-dri:arm64 (25.0.2-1) ... Setting up libcloudproviders0:arm64 (0.3.6-2) ... Setting up python3 (3.13.2-2) ... Setting up sopv-gpgv (0.1.4-1) ... update-alternatives: using /usr/bin/sopv-gpgv to provide /usr/bin/sopv (sopv) in auto mode Setting up man-db (2.13.0-1) ... Not building database; man-db/auto-update is not 'true'. Created symlink '/etc/systemd/system/timers.target.wants/man-db.timer' -> '/usr/lib/systemd/system/man-db.timer'. Setting up libcairo2:arm64 (1.18.4-1+b1) ... Setting up libcolord2:arm64 (1.4.7-3) ... Setting up libdconf1:arm64 (0.40.0-5) ... Setting up dirmngr (2.2.46-6) ... Created symlink '/etc/systemd/user/sockets.target.wants/dirmngr.socket' -> '/usr/lib/systemd/user/dirmngr.socket'. Setting up dbus-user-session (1.16.2-2) ... Setting up libmaven-resolver-java (1.9.22-1) ... Setting up libbcel-java (6.10.0-1) ... Setting up adwaita-icon-theme (48.0-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libatspi2.0-0t64:arm64 (2.56.0-3) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up gnupg (2.2.46-6) ... Setting up liblightcouch-java (0.2.0-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libcairo-gobject2:arm64 (1.18.4-1+b1) ... Setting up libmaven-shared-utils-java (3.4.2-1) ... Setting up libpangoft2-1.0-0:arm64 (1.56.3-1) ... Setting up libcups2t64:arm64 (2.4.10-2+b1) ... Setting up libpangocairo-1.0-0:arm64 (1.56.3-1) ... Setting up libatk-bridge2.0-0t64:arm64 (2.56.0-3) ... Setting up libfindbugs-java (3.1.0~preview2-4) ... Setting up libglx-mesa0:arm64 (25.0.2-1) ... Setting up libglx0:arm64 (1.7.0-1+b2) ... Setting up libcommons-compress-java (1.27.1-2) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libmoo-perl (2.005005-1) ... Setting up liblog4j2-java (2.19.0-2) ... Setting up debhelper (13.24.1) ... Setting up dconf-service (0.40.0-5) ... Setting up libjsch-java (0.2.19-1) ... Setting up libgl1:arm64 (1.7.0-1+b2) ... Setting up libjgit-java (6.7.0-2) ... Setting up dconf-gsettings-backend:arm64 (0.40.0-5) ... Setting up libgtk-3-common (3.24.49-2) ... Setting up libgtk-3-0t64:arm64 (3.24.49-2) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.78-1) ... Setting up devscripts (2.25.5) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.80) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up libguice-java (5.1.0-1) ... Setting up libmaven3-core-java (3.9.9-1) ... Setting up libbyte-buddy-java (1.14.19-1) ... Setting up libmockito-java (3.3.0-2) ... Processing triggers for libc-bin (2.41-6) ... Processing triggers for systemd (257.4-3) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:FIRMAPROFESIONAL_CA_ROOT-A_WEB.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureSign_Root_CA12.pem Adding debian:SecureSign_Root_CA14.pem Adding debian:SecureSign_Root_CA15.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_CYBER_Root_CA.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:Telekom_Security_TLS_ECC_Root_2020.pem Adding debian:Telekom_Security_TLS_RSA_Root_2023.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up antlr (2.7.7+dfsg-14) ... Setting up openjdk-21-jre:arm64 (21.0.7~7ea-1) ... Setting up ivy (2.5.3-1) ... Setting up ant (1.10.15-1) ... Setting up junit4 (4.13.2-5) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up openjdk-21-jdk-headless:arm64 (21.0.7~7ea-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up default-jre-headless (2:1.21-76) ... Setting up maven-repo-helper (1.11) ... Setting up default-jre (2:1.21-76) ... Setting up ant-optional (1.10.15-1) ... Setting up openjdk-21-jdk:arm64 (21.0.7~7ea-1) ... update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.21-76) ... Setting up libgradle-core-java (4.4.1-22) ... Setting up libgradle-plugins-java (4.4.1-22) ... Setting up gradle (4.4.1-22) ... Setting up default-jdk (2:1.21-76) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20241223) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture arm64 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean Duplicate specification "unlink|u" for option "u" dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 jar openjdk version "21.0.7-ea" 2025-04-15 OpenJDK Runtime Environment (build 21.0.7-ea+7-Debian-1) OpenJDK 64-Bit Server VM (build 21.0.7-ea+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 1.396 secs. The client will now receive all logging from the daemon (pid: 609015). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-609015.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@2080723f Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@2080723f Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@21bf97e7 Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@4f99d8f6 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@5d25b056 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@21bf97e7 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@10596372 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@282851ed :compileJava (Thread[#50,Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.006 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@49f88f28 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through commons-codec:commons-codec:jar:debian Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Up-to-date check for task ':compileJava' took 2.867 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. warning: [options] source value 8 is obsolete and will be removed in a future release warning: [options] target value 8 is obsolete and will be removed in a future release warning: [options] To suppress warnings about obsolete options, use -Xlint:-options. /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1279: warning: [removal] finalize() in Object has been deprecated and marked for removal protected void finalize() throws Throwable { ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/kaligner2/KMapper2.java:1280: warning: [removal] finalize() in Object has been deprecated and marked for removal super.finalize(); ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:108: warning: [removal] finalize() in Object has been deprecated and marked for removal protected void finalize() throws Throwable { ^ /build/reproducible-path/milib-2.2.0+dfsg/src/main/java/com/milaboratory/core/alignment/blast/BlastDB.java:116: warning: [removal] finalize() in Object has been deprecated and marked for removal super.finalize(); ^ Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. 7 warnings :compileJava (Thread[#50,Task worker for ':',5,main]) completed. Took 9.995 secs. :processResources (Thread[#50,Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.008 secs. It is not up-to-date because: No history is available. :processResources (Thread[#50,Task worker for ':',5,main]) completed. Took 0.047 secs. :classes (Thread[#50,Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[#50,Task worker for ':',5,main]) completed. Took 0.0 secs. :debianMavenPom (Thread[#50,Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.0 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[#50,Task worker for ':',5,main]) completed. Took 0.091 secs. :jar (Thread[#50,Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.058 secs. It is not up-to-date because: No history is available. :jar (Thread[#50,Task worker for ':',5,main]) completed. Took 0.314 secs. BUILD SUCCESSFUL in 17s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 test openjdk version "21.0.7-ea" 2025-04-15 OpenJDK Runtime Environment (build 21.0.7-ea+7-Debian-1) OpenJDK 64-Bit Server VM (build 21.0.7-ea+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-21-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 1.42 secs. The client will now receive all logging from the daemon (pid: 614535). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-614535.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1eef82e6 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1eef82e6 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@28f1d9fa Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@35fef15d Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@1275a7f4 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@28f1d9fa Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@7d044320 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@73c43097 :compileJava (Thread[#50,Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.005 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@2423790d Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through commons-codec:commons-codec:jar:debian Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 1.017 secs). :compileJava UP-TO-DATE :compileJava (Thread[#50,Task worker for ':',5,main]) completed. Took 1.057 secs. :processResources (Thread[#50,Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.014 secs). :processResources UP-TO-DATE :processResources (Thread[#50,Task worker for ':',5,main]) completed. Took 0.019 secs. :classes (Thread[#50,Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[#50,Task worker for ':',5,main]) completed. Took 0.0 secs. :compileTestJava (Thread[#50,Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 1.797 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. warning: [options] source value 8 is obsolete and will be removed in a future release warning: [options] target value 8 is obsolete and will be removed in a future release warning: [options] To suppress warnings about obsolete options, use -Xlint:-options. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. 3 warnings :compileTestJava (Thread[#50,Task worker for ':',5,main]) completed. Took 5.438 secs. :processTestResources (Thread[#50,Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.009 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[#50,Task worker for ':',5,main]) completed. Took 0.043 secs. :testClasses (Thread[#50,Task worker for ':',5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[#50,Task worker for ':',5,main]) completed. Took 0.0 secs. :test (Thread[#50,Task worker for ':',5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 0.634 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-21-openjdk-arm64/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath7713906546412373930txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 5608636 Write time: 460.81ms O. Stats: Wall clock time: 463.8ms Total CPU time: 425.97ms User wait time: 344.6ms Serialization time: 153.36ms (36%) Checksum calculation time: 189.62ms (44.52%) Compression time: 31.82ms (7.47%) Total IO delay: 210.11ms Concurrency overhead: 141.65ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 25.47MiB/s Concurrency adjusted uncompressed speed: 61.46MiB/s Actual uncompressed speed: 39.82MiB/s Actual speed: 11.55MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 146.08ms Total CPU time: 102.27ms Serialization time: 61.11ms (59.75%) Checksum calculation time: 5.08ms (4.97%) Compression time: 32.85ms (32.12%) Total IO delay: 124.49ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 43.14MiB/s Concurrency adjusted uncompressed speed: 329.23MiB/s Actual uncompressed speed: 126.28MiB/s Actual speed: 36.64MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 293.12ms Total CPU time: 181.59ms Serialization time: 78.13ms (43.02%) Checksum calculation time: 10.06ms (5.54%) Compression time: 87.51ms (48.19%) Total IO delay: 225.55ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 47.54MiB/s Concurrency adjusted uncompressed speed: 365.09MiB/s Actual uncompressed speed: 125.85MiB/s Actual speed: 36.51MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 5588298 Write time: 70.89ms O. Stats: Wall clock time: 71.36ms Total CPU time: 71.48ms User wait time: 62.93ms Serialization time: 20.97ms (29.34%) Checksum calculation time: 4.97ms (6.95%) Compression time: 40.83ms (57.11%) Total IO delay: 34.14ms Concurrency overhead: 16.78ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 156.75MiB/s Concurrency adjusted uncompressed speed: 428.77MiB/s Actual uncompressed speed: 259.67MiB/s Actual speed: 75.06MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 74.8ms Total CPU time: 54.71ms Serialization time: 16.54ms (30.24%) Checksum calculation time: 4.9ms (8.95%) Compression time: 32.4ms (59.23%) Total IO delay: 57.4ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 93.5MiB/s Concurrency adjusted uncompressed speed: 658.46MiB/s Actual uncompressed speed: 249.15MiB/s Actual speed: 72.02MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 173.64ms Total CPU time: 106.36ms Serialization time: 32.16ms (30.24%) Checksum calculation time: 9.98ms (9.39%) Compression time: 62.68ms (58.93%) Total IO delay: 104.45ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 102.49MiB/s Concurrency adjusted uncompressed speed: 709.11MiB/s Actual uncompressed speed: 213.14MiB/s Actual speed: 61.61MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5608636 Write time: 215.38ms O. Stats: Wall clock time: 216.39ms Total CPU time: 74.12ms User wait time: 204.2ms Serialization time: 31.76ms (42.85%) Checksum calculation time: 5.09ms (6.87%) Compression time: 31.15ms (42.03%) Total IO delay: 59.27ms Concurrency overhead: 40.39ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 90.66MiB/s Concurrency adjusted uncompressed speed: 106.57MiB/s Actual uncompressed speed: 85.36MiB/s Actual speed: 24.76MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 116.5ms Total CPU time: 73.45ms Serialization time: 28.52ms (38.84%) Checksum calculation time: 4.91ms (6.69%) Compression time: 36.69ms (49.96%) Total IO delay: 85.15ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 62.93MiB/s Concurrency adjusted uncompressed speed: 116.69MiB/s Actual uncompressed speed: 158.94MiB/s Actual speed: 46.11MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 223.98ms Total CPU time: 151.93ms Serialization time: 61.84ms (40.71%) Checksum calculation time: 9.89ms (6.51%) Compression time: 73.21ms (48.19%) Total IO delay: 168.1ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 63.68MiB/s Concurrency adjusted uncompressed speed: 115.23MiB/s Actual uncompressed speed: 165.35MiB/s Actual speed: 47.97MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5588298 Write time: 81.27ms O. Stats: Wall clock time: 82.41ms Total CPU time: 53.79ms User wait time: 71.7ms Serialization time: 21.96ms (40.83%) Checksum calculation time: 4.96ms (9.23%) Compression time: 25.03ms (46.53%) Total IO delay: 14.04ms Concurrency overhead: 956.13us Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 380.67MiB/s Concurrency adjusted uncompressed speed: 271.13MiB/s Actual uncompressed speed: 224.84MiB/s Actual speed: 64.99MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 67.75ms Total CPU time: 57.55ms Serialization time: 19.03ms (33.07%) Checksum calculation time: 7.28ms (12.65%) Compression time: 30.6ms (53.17%) Total IO delay: 54.84ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 98.69MiB/s Concurrency adjusted uncompressed speed: 164.62MiB/s Actual uncompressed speed: 275.18MiB/s Actual speed: 79.54MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 149.54ms Total CPU time: 121.68ms Serialization time: 40.59ms (33.36%) Checksum calculation time: 12.22ms (10.04%) Compression time: 65.34ms (53.7%) Total IO delay: 95.32ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 112.2MiB/s Concurrency adjusted uncompressed speed: 170.71MiB/s Actual uncompressed speed: 247.48MiB/s Actual speed: 71.54MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 995.48ms O. Stats: Wall clock time: 996.06ms Total CPU time: 2.42s User wait time: 922.19ms Serialization time: 25.31ms (1.04%) Checksum calculation time: 4.97ms (0.21%) Compression time: 2.39s (98.59%) Total IO delay: 69.94ms Concurrency overhead: 86.14ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 57.45MiB/s Concurrency adjusted uncompressed speed: 26MiB/s Actual uncompressed speed: 18.51MiB/s Actual speed: 3.98MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 75.16ms Total CPU time: 46.6ms Serialization time: 13.38ms (28.71%) Checksum calculation time: 4.94ms (10.61%) Compression time: 26.7ms (57.3%) Total IO delay: 62.99ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 63.93MiB/s Concurrency adjusted uncompressed speed: 682.85MiB/s Actual uncompressed speed: 245.83MiB/s Actual speed: 52.85MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 145.89ms Total CPU time: 91.95ms Serialization time: 26.05ms (28.33%) Checksum calculation time: 9.85ms (10.71%) Compression time: 53.23ms (57.89%) Total IO delay: 120.56ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 66.06MiB/s Concurrency adjusted uncompressed speed: 695.73MiB/s Actual uncompressed speed: 254.3MiB/s Actual speed: 54.67MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 1.26s O. Stats: Wall clock time: 1.26s Total CPU time: 2.01s User wait time: 1.15s Serialization time: 17.75ms (0.88%) Checksum calculation time: 5.25ms (0.26%) Compression time: 1.99s (98.8%) Total IO delay: 47.07ms Concurrency overhead: 20.69ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 83.17MiB/s Concurrency adjusted uncompressed speed: 34.53MiB/s Actual uncompressed speed: 14.61MiB/s Actual speed: 3.1MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 46.74ms Total CPU time: 43.38ms Serialization time: 10.51ms (24.24%) Checksum calculation time: 5.01ms (11.56%) Compression time: 27.64ms (63.72%) Total IO delay: 25.36ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 156.35MiB/s Concurrency adjusted uncompressed speed: 1.06GiB/s Actual uncompressed speed: 400.8MiB/s Actual speed: 84.97MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 106.73ms Total CPU time: 95.16ms Serialization time: 22.47ms (23.61%) Checksum calculation time: 11.36ms (11.94%) Compression time: 60.83ms (63.92%) Total IO delay: 32.49ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 244.3MiB/s Concurrency adjusted uncompressed speed: 1.16GiB/s Actual uncompressed speed: 347.87MiB/s Actual speed: 73.75MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 1.92s O. Stats: Wall clock time: 1.92s Total CPU time: 1.89s User wait time: 1.91s Serialization time: 18.93ms (1%) Checksum calculation time: 5.06ms (0.27%) Compression time: 1.86s (98.63%) Total IO delay: 11.35ms Concurrency overhead: 3.49ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 360.34MiB/s Concurrency adjusted uncompressed speed: 9.7MiB/s Actual uncompressed speed: 9.62MiB/s Actual speed: 2.07MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 55.46ms Total CPU time: 44.45ms Serialization time: 11.27ms (25.36%) Checksum calculation time: 5.55ms (12.48%) Compression time: 26.53ms (59.69%) Total IO delay: 46.97ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 86.17MiB/s Concurrency adjusted uncompressed speed: 202.6MiB/s Actual uncompressed speed: 335.22MiB/s Actual speed: 72.07MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 1 / 0 I. Stats 2: Wall clock time: 123.95ms Total CPU time: 90.99ms Serialization time: 22.49ms (24.72%) Checksum calculation time: 12.29ms (13.51%) Compression time: 53.96ms (59.3%) Total IO delay: 100.49ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 79.28MiB/s Concurrency adjusted uncompressed speed: 193.06MiB/s Actual uncompressed speed: 299.79MiB/s Actual speed: 64.45MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 1.99s O. Stats: Wall clock time: 1.99s Total CPU time: 1.94s User wait time: 1.98s Serialization time: 17.35ms (0.89%) Checksum calculation time: 5.04ms (0.26%) Compression time: 1.92s (98.8%) Total IO delay: 27.94ms Concurrency overhead: 2.61ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 144.77MiB/s Concurrency adjusted uncompressed speed: 9.35MiB/s Actual uncompressed speed: 9.25MiB/s Actual speed: 1.96MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 69.63ms Total CPU time: 45.9ms Serialization time: 14.12ms (30.76%) Checksum calculation time: 4.91ms (10.7%) Compression time: 26.4ms (57.51%) Total IO delay: 54.6ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 72.39MiB/s Concurrency adjusted uncompressed speed: 184.37MiB/s Actual uncompressed speed: 267.2MiB/s Actual speed: 56.65MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 191.99ms Total CPU time: 115.95ms Serialization time: 52.46ms (45.24%) Checksum calculation time: 9.85ms (8.49%) Compression time: 52.9ms (45.62%) Total IO delay: 96.12ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 81.43MiB/s Concurrency adjusted uncompressed speed: 173.93MiB/s Actual uncompressed speed: 193.06MiB/s Actual speed: 40.93MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 1 / 1 / 17000 O. Stats: Wall clock time: 2.24s Total CPU time: 2.44s User wait time: 56.88us Serialization time: 781.73ms (32.09%) Checksum calculation time: 591.44ms (24.27%) Compression time: 534.48ms (21.94%) Total IO delay: 1.34s Concurrency overhead: 64.56ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 1.39GiB/s Concurrency adjusted uncompressed speed: 3.48GiB/s Actual uncompressed speed: 850.02MiB/s Actual speed: 850.02MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 978.00ns 1.16us 976.00ns com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1766 rTrimmed = 1649 lTrimmed = 2859 rTrimmed = 2751 com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 149.39us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 74.29us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 60.79us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 65.19us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 134.75us C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 101.50us C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 82.98us C=2994;I=0;M=3;ScE=0;R=0.0 AlignmentTime = 60.31us com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1856 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Q 117 -> T 85 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Q 168 -> T 111 - -57 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1212 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 72 -> T 64 - -8 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 183 -> T 147 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 281 noHits2: 0 noHits3: 0 wrongTopHit: 45 wrongTopHitS: 30 noCorrectHitInList: 21 Timings: DescriptiveStatistics: n: 100000 min: 6600.0 max: 1.78884215E8 mean: 74738.24934000206 std dev: 1282166.3710247257 median: 57720.0 skewness: 105.03697818657058 kurtosis: 11419.902983285816 Clusters basicSize DescriptiveStatistics: n: 99674 min: 1.0 max: 7.0 mean: 2.8609065553705095 std dev: 1.0986277435883456 median: 3.0 skewness: 0.29507202074971917 kurtosis: -0.6692534652494913 Top Delta DescriptiveStatistics: n: 99698 min: -32.0 max: 0.0 mean: -0.0012236955605935006 std dev: 0.14725559496467125 median: 0.0 skewness: -152.70570566762015 kurtosis: 27448.10243244401 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4968 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 303.57us Processed queries: 145 Bad percent: 0.0 False positive percent: 0.589210090222795 Scoring error percent: 0.6896551724137931 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT GGGCGAGGGTAGTAGTCTCTACTTCCGCCTGGGGTCCTGAGCTGATGCTTATTACGAAGTTCACCTAGTGGCACGGAAGGGGTACAACCAGTAGCATCCTGGGATCACTGAAATATGCGGTGTACCTTATGAGGCAACGAAAGGCACGGTGGCAATGGAGGGATCGATCACAAATTTTTAGTATTGTTGTTAGGAAATTGCCCCCTATATTATTATGCTGTGTCAGTGCATCACGTTCGGAAAGGTTGCAAACTCTTATCCCTAAGGGCGTACGATAACACGAGTGGTGAATAAGAACTCCGACCTACTGACCAGAGGGTCAGCTCCCCGCTTGTTGGGGAAACCTGGGTTCGGGGCACGAACGTCCTTAAAGATCGCGAGCCTAATAAAGGAAATGGACGATGGAGACAGTCTTGTTCAAGGTATACTCACGCTGTACCACATAGGTGTCGTTATTCGATGCTAAGTATTGACAGTCACCCAATGGCTAGTCCACCTGAGTCCATTCTGTAATACTGCAGCGGATTGGACCGATATATGTATAGCTAGCACTTAATAGACCATCTCTGATGGTATGTACCTTACACACTACTTTACGTGAGCAGCTGTGAAGACCCCCCCCCACGAGGACGTTCTGTTAAGCCAAGGAACAACCACCATTCACACCTGCGGAAG GGGCGAGGAGTAGTCTCTACTTCGCCTGGGGTTCCTGAGCTGATGCTTATTACGAAGTTTACCTAGTGGCACGGAAGGGGTACAACTAGTAGCATCCTGAAGATCACTAAATATGCGGGTCCTTATAGGCAACAAAGGCACGGTTCAAGGAGGGATCGATACACAAATTTTTTTTATTGTCGTTAGAATTGCCCCCTATATTTATTATGCTGTGTCAGTGTATCGCGTTCGGAAAGGTTGCAGACTCTTATCCCTAAGGCGTACATAACCGAGTGGGTGAATAAGAACTCCGACCTACTGACACAGAGGTCAGCTCCCCGCTTGTTGGGGAGACCTGGGTTCGGGGCGTAACGTCTTAAAGACGCGACCTATAAAGGAGATGGACGATGGAGACAGCTTGTTACAAGGTATACCACGCTGTACCACATAGGGTCGTTATTCGATGCTAAGTATTGACAGTCACCATATGGCTAGCCACTGAGTCCATTCTGTAATACTGCAGCGGATTGGACCGATATATGTATAGCTAGTCACTTAATAGACCATCTCTGATGGTATGTACCTTACACACTACTTTACGTGAGCAAGCTGTGAAGACCCCCCCCCACGAGGACGTTCTGTTAAGCCATGAACAACCGCCATTCACACCTGCGGAAGA GGGCGGGGAATAGTCTCTACTTCGCCTGGGGTTCCTGAGCTGATGCTTATTACGAAGTTACCTAGCGGCACGGAAGGGGTACAACTAGTAGCTTCGAAGATCACTAAATATGCGTGTCCTTTAGTCAACAGGCGCGGTTCAAGGAAGAATCGATACACTAAATTTTTTTTATTGTCGTTAGGTTGCCCCCATATTTGTTATGCTGTGTAGTGTACTCGCCGTTCGGAAAGGTTGCAGACTCTTATCCCTATGGCTACAAACCAGTGGGTGAATTAAGACTCCGACCTACTGTCACAGAGTCACTCCCCCTTGTTGGGGGACCTGGGTTCGGGGCGTAACGTCTTAGACGGACCTATAAAGAACGGACGTGGAGACGCTTGTTGCAAGGTATACACGCTGTGCCACATAGGTCGTTATTCGATGCTAAGATTGATATGCACCATATGGCTAGCACTGAGTCCATCTGTAATCTGCAGCATTGGACCGATATATGTATACTAGCCTTAATAGACCAATCTCTGATGGTATGTACCTTACACACTACTTACGTGAGCAGGCTGTGAAGACCTCCCCCCAACGAGGCGTTCTTAAGCATTAACAACCGCCATTCACCACTAGCGGAAGA 0 GGGCG-GGG-AATAGTCTCTACTT-CGCCTGGGGTTCCTGAGCTGATGCTTATTACGAAGTT-ACCTAGCGGCACGGAAGGGGTACAACTAGTAGC-TTC-GAAGATCACT-AAATATGC-GTGT-CCTT-T-AGTCAAC---AGGCGCGGT-TCAA-GGAAGAATCGATACACTAAATTTTTTTTATTGTCGTTAGG---TTGCCCCC-ATATTTGTTATGCTGTGT-AGTGTACTCGCCGTTCGGAAAGGTTGCAGACTCTTATCCCT-ATGGC-TAC-A-AAC-C-AGTGGGTGAATTAAG-ACTCCGACCTACTGTCACAGA--GTCA-CTCCCC-CTTGTTGGGG-GACCTGGGTTCGGGG--CGTAACGT-CTT--AGA-CG-GA-CCT-ATAAA-G-AACGGACG-TGGAGAC-G-CTTGTTGCAAGGTATA--CACGCTGTGCCACATA-G-GTCGTTATTCGATGCTAAG-ATTGATA-TGCA-CCATATGGCTAG--CA-CTGAGTCCA-TCTGTAAT-CTGCAGC--ATTGGACCGATATATGTATA-CTAGC-CTTAATAGACCAATCTCTGATGGTATGTACCTTACACACTAC-TTACGTGAGCAGGCTGTGAAGACCTCCCCCCAACGAGG-CGTTC--TTAAG-C-ATTAACAACCGCCATTCAC-CACTAGCGGAAGA 624 ||||| ||| | |||||||||||| ||||||||| ||||||||||||||||||||||||||| |||||| ||||||||||||||||||| |||||| | | | ||||||| |||||||| |||| |||| | || |||| |||| |||| ||| ||| | |||||| ||| |||||||| |||||| |||||| |||||||| ||| || ||||||||||| |||| | || ||||||||||||||||| |||||||||||| | ||| ||| | ||| | ||| |||||| |||| |||||||||||||| | |||| |||| |||||| |||||||||| |||||||||||||| || ||||| ||| ||| || || ||| ||||| | || ||||| ||||||| | |||||| ||||||||| |||||||| ||||||| | ||||||||||||||||||| ||||| | | || ||| |||||||| || ||||||||| |||||||| ||||||| |||||||||||||||||||| ||||| ||||||||||| |||||||||||||||||||||||||||||| ||||||||||| |||||||||||| |||||| |||||| ||||| ||||| | | ||||||| |||||||| | || ||||||| 0 GGGCGAGGGTAGTAGTCTCTACTTCCGCCTGGGG-TCCTGAGCTGATGCTTATTACGAAGTTCACCTAGTGGCACGGAAGGGGTACAACCAGTAGCATCCTG-GGATCACTGAAATATGCGGTGTACCTTATGAGGCAACGAAAGGCACGGTGGCAATGGAGGGATCGAT-CAC-AAATTTTTAGTATTGTTGTTAGGAAATTGCCCCCTATA-TTATTATGCTGTGTCAGTGCA-TC-ACGTTCGGAAAGGTTGCAAACTCTTATCCCTAAGGGCGTACGATAACACGAGT-GGTGAA-TAAGAACTCCGACCTACTGAC-CAGAGGGTCAGCTCCCCGCTTGTTGGGGAAACCTGGGTTCGGGGCACG-AACGTCCTTAAAGATCGCGAGCCTAATAAAGGAAATGGACGATGGAGACAGTCTTGTT-CAAGGTATACTCACGCTGTACCACATAGGTGTCGTTATTCGATGCTAAGTATTGACAGT-CACCCA-ATGGCTAGTCCACCTGAGTCCATTCTGTAATACTGCAGCGGATTGGACCGATATATGTATAGCTAGCACTTAATAGACC-ATCTCTGATGGTATGTACCTTACACACTACTTTACGTGAGCA-GCTGTGAAGACC-CCCCCCCACGAGGACGTTCTGTTAAGCCAAGGAACAACCACCATTCACAC-CT-GCGGAAG- 674 [I5:A,S5:A->G,D7:G,I118:G,S119:G->T,D120:T,I138:G,I138:A,S138:G->A,D140:A,D141:A,D193:G,D194:A,S195:A->G,I196:A,I196:A,D209:T,I211:T,I263:A,S264:A->G,D266:G,I281:G,S281:G->A,D282:A,D285:G,I287:G,I316:G,D318:G,I356:C,I356:A,S357:A->G,D358:C,D359:G,I365:C,D366:C,I369:A,D370:A,I390:G,S391:G->A,D393:A,D400:G,S401:A->G,I402:A,I427:C,I427:T,D428:T,D429:C,I445:G,I446:T,D447:T,D448:G,I475:G,S475:G->T,D476:T,I479:C,D481:C,I491:T,S491:T->C,D493:C,I505:T,D506:T,I522:G,D523:G,D616:C,I623:C,I635:T,S635:T->G,D636:G,I644:A,D645:A,I663:C,I663:A,D664:A,D665:C] 0 GGGCG-AGGGTAGTAGTCTCTACTTCCGCCTGGGGTCCTGAGCTGATGCTTATTACGAAGTTCACCTAGTGGCACGGAAGGGGTACAACCAGTAGCATCCTGGGATCACTGAAATATGC-GGTGTACCTTATGAGGCAAC--GAAAGGCACGGTGGCAATGGAGGGATCGATCACAAATTTTTAGTATTGTTGTTAGGAA--ATTGCCCCCTATATT-ATTATGCTGTGTCAGTGCATCACGTTCGGAAAGGTTGCAAACTCTTATCCCT-AAGGGCGTACGATAACAC-GAGTGG-TGAATAAGAACTCCGACCTACTGACCAGA-GGGTCAGCTCCCCGCTTGTTGGGGAAACCTGGGTTCGGGG--CACGAACGT-CCTT-AAAGATCGCGAGCCTAATAAA-GGAAATGGACGA-TGGAGACAGTCTTGTTCAAGGTATA--CTCACGCTGTACCACATA-G-GTGTCGTTATTCGATGCTAAGTATTGACA-GTCA-CCCAATGGCTAG-TCCACCTGAGTCCA-TTCTGTAATACTGCAGC-GGATTGGACCGATATATGTATAGCTAGCACTTAATAGACCATCTCTGATGGTATGTACCTTACACACTACTTTACGTGAGCAGCTGTGAAGACCCCCCCCC-ACGAGGACGTTC-TGTTAAGCC-AAGGAACAACCACCATTCA--CACCTGCGGAAG 674 ||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||| | | |||||||||||||| || | ||||||||||||||||||||||||||||| || ||||||||||||||||||||||||||||||||||||| | ||||| | || | ||||||||||||||||||| | | |||||| ||||||||||||||||||||||||| | ||||||||||||||| | | |||||||||||||||||||||||||| || || ||||||||| | ||||||||||| | ||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| |||||||||||| ||||||| | ||||||||||||||||| | ||||||||| 0 GGGCGAGG-GTAGTAGTCTCTACTTCCGCCTGGGGTCCTGAGCTGATGCTTATTACGAAGTTCACCTAGTGGCACGGAAGGGGTACAACCAGTAGCATCCTGGGATCACTGAAATATGCGGT-GTACCTTATGAGGCAACGAAA--GGCACGGTGGCAATGGAGGGATCGATCACAAATTTTTAGTATTGTTGTTAG--GAAATTGCCCCCTATA-TTATTATGCTGTGTCAGTGCATCACGTTCGGAAAGGTTGCAAACTCTTATCCCTAAGG-GCGTACGATAACACGA-GT-GGTGAATAAGAACTCCGACCTACTGACCAGAGGG-TCAGCTCCCCGCTTGTTGGGGAAACCTGGGTTCGGGGCACG--AACGTCC-TTAA-AGATCGCGAGCCTAATAAAGGAA-ATGGAC-GATGGAGACAGTCTTGTTCAAGGTATACTC--ACGCTGTACCACATAGGTG--TCGTTATTCGATGCTAAGTATTGACAGT-CACCC-AATGGCTAGTCC-ACCTGAGTCCATT-CTGTAATACTGCAGCGG-ATTGGACCGATATATGTATAGCTAGCACTTAATAGACCATCTCTGATGGTATGTACCTTACACACTACTTTACGTGAGCAGCTGTGAAGACC-CCCCCCCACGAGGACGTTCTG-TTAAGCCAA-GGAACAACCACCATTCACAC--CTGCGGAAG 674 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99958 elements with 366.16KiB in raw nucleotide entropy serialized into 272.94KiB com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 32 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 575 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2476 com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_db7eb3ef70195104bcf4c472266f17615312b30c1880983494132957880.fasta: 0% Indexing milib_db7eb3ef70195104bcf4c472266f17615312b30c1880983494132957880.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_db7eb3ef70195104bcf4c472266f17615312b30c1880983494132957880.fasta: 0% Indexing milib_db7eb3ef70195104bcf4c472266f17615312b30c1880983494132957880.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_753ffa3f9154aa06dd2b95230a327f9736c584c11984968259876651976.tmp: 0% Indexing milib_753ffa3f9154aa06dd2b95230a327f9736c584c11984968259876651976.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 82ns Addition to hash set (per operation): 394ns Hash set removal (per operation): 201ns a com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_f94256e23d1e60cff3ec015d1cb175fab536c5cc4417853787450963747 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_e2f7a1f1dd39e71f07b5dbb164781c08650a77d113682251418203900393.tmp com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_41742895a4776436f52f8790ca257c77586033415038504983518162925 timeInCollate: 3.04s timeInCollatorInit: 2.25s timeAwaitingO: 1.53ms timeAwaitingI: 473.16ms timeInFinalSorting1: 0ns timeInFinalSorting2: 28.38ms timeInFinalSorting3: 56.69ms /8S (5|27|32): objs=50000 size=3.47MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_7038c35e303763fbb355e3eb53e35c3587fecbe83387324185134579846 timeInCollate: 7.81s timeInCollatorInit: 518.44ms timeAwaitingO: 605.07ms timeAwaitingI: 3.17s timeInFinalSorting1: 1.28s timeInFinalSorting2: 1.09s timeInFinalSorting3: 722.19ms /0N (5|27|32): objs=152382 size=7.45MiB /1N (5|27|32): objs=159771 size=7.74MiB /2N (5|27|32): objs=155185 size=7.44MiB /3N (5|27|32): objs=153492 size=7.4MiB /4N (5|27|32): objs=161038 size=7.68MiB /5N (5|27|32): objs=147964 size=7.23MiB /6N (5|27|32): objs=156829 size=7.47MiB /7N (5|27|32): objs=160794 size=7.71MiB /8N (5|27|32): objs=155421 size=7.68MiB /9N (5|27|32): objs=160445 size=7.83MiB /10N (5|27|32): objs=160943 size=8.03MiB /11N (5|27|32): objs=161197 size=7.86MiB /12N (5|27|32): objs=160879 size=8MiB /13N (5|27|32): objs=150008 size=7.18MiB /14N (5|27|32): objs=159339 size=7.67MiB /15N (5|27|32): objs=157857 size=7.57MiB /16N (5|27|32): objs=160179 size=7.84MiB /17N (5|27|32): objs=148044 size=7.11MiB /18N (5|27|32): objs=155209 size=7.53MiB /19N (5|27|32): objs=151185 size=7.35MiB /20N (5|27|32): objs=156272 size=7.68MiB /21N (5|27|32): objs=159590 size=7.46MiB /22N (5|27|32): objs=152371 size=7.37MiB /23N (5|27|32): objs=153890 size=7.4MiB /24N (5|27|32): objs=159534 size=7.68MiB /25N (5|27|32): objs=155300 size=7.47MiB /26N (5|27|32): objs=159080 size=7.68MiB /27N (5|27|32): objs=160320 size=7.61MiB /28N (5|27|32): objs=151517 size=7.35MiB /29N (5|27|32): objs=161306 size=7.74MiB /30N (5|27|32): objs=152867 size=7.46MiB /31N (5|27|32): objs=149792 size=7.25MiB /0/0N (2|25|36): objs=33426 size=602.34KiB /0/1N (2|25|36): objs=37605 size=776.07KiB /0/2N (2|25|36): objs=36970 size=659.38KiB /0/3S (2|25|36): objs=178 size=138B /0/4N (2|25|36): objs=1006 size=3.96KiB /0/5S (2|25|36): objs=141 size=268B /0/6N (2|25|36): objs=307 size=1020B /0/7S (2|25|36): objs=159 size=291B /0/8N (2|25|36): objs=2743 size=11.75KiB /0/9N (2|25|36): objs=442 size=1.43KiB /0/10S (2|25|36): objs=147 size=230B /0/11N (2|25|36): objs=4846 size=22.53KiB /0/12S (2|25|36): objs=172 size=238B /0/13N (2|25|36): objs=2294 size=9.97KiB /0/14S (2|25|36): objs=188 size=298B /0/15N (2|25|36): objs=2823 size=11.86KiB /0/16S (2|25|36): objs=152 size=263B /0/17N (2|25|36): objs=7773 size=39.74KiB /0/18S (2|25|36): objs=150 size=343B /0/19N (2|25|36): objs=3366 size=14.3KiB /0/20S (2|25|36): objs=166 size=344B /0/21N (2|25|36): objs=1943 size=8.12KiB /0/22S (2|25|36): objs=155 size=160B /0/24S (2|25|36): objs=159 size=212B /0/25N (2|25|36): objs=1513 size=6.29KiB /0/26S (2|25|36): objs=134 size=253B /0/27N (2|25|36): objs=3216 size=13.61KiB /0/28S (2|25|36): objs=139 size=273B /0/29N (2|25|36): objs=4833 size=22.56KiB /0/30S (2|25|36): objs=148 size=272B /0/31N (2|25|36): objs=758 size=2.95KiB /0/32S (2|25|36): objs=148 size=296B /0/33N (2|25|36): objs=3125 size=13.24KiB /0/34S (2|25|36): objs=158 size=329B /0/35N (2|25|36): objs=899 size=3.43KiB /1/0N (2|25|36): objs=39317 size=775.13KiB /1/1N (2|25|36): objs=25668 size=322.71KiB /1/2S (2|25|36): objs=145 size=302B /1/3N (2|25|36): objs=10316 size=62.24KiB /1/4N (2|25|36): objs=41850 size=901.82KiB /1/5N (2|25|36): objs=8295 size=38.96KiB /1/6S (2|25|36): objs=159 size=331B /1/7N (2|25|36): objs=2506 size=10.49KiB /1/8S (2|25|36): objs=145 size=192B /1/9N (2|25|36): objs=1503 size=6.19KiB /1/10S (2|25|36): objs=150 size=184B /1/11N (2|25|36): objs=2956 size=12.52KiB /1/12S (2|25|36): objs=160 size=308B /1/13N (2|25|36): objs=777 size=3.14KiB /1/14S (2|25|36): objs=153 size=183B /1/15N (2|25|36): objs=3657 size=16.97KiB /1/16S (2|25|36): objs=153 size=236B /1/18S (2|25|36): objs=169 size=178B /1/19N (2|25|36): objs=5429 size=26.34KiB /1/20S (2|25|36): objs=142 size=111B /1/21N (2|25|36): objs=4291 size=19.69KiB /1/22S (2|25|36): objs=152 size=91B /1/23N (2|25|36): objs=1691 size=6.94KiB /1/24S (2|25|36): objs=193 size=154B /1/25S (2|25|36): objs=139 size=256B /1/26S (2|25|36): objs=164 size=141B /1/27N (2|25|36): objs=4330 size=20.03KiB /1/28S (2|25|36): objs=143 size=193B /1/29N (2|25|36): objs=1362 size=5.75KiB /1/30S (2|25|36): objs=154 size=179B /1/31N (2|25|36): objs=2477 size=10.33KiB /1/32S (2|25|36): objs=157 size=177B /1/33N (2|25|36): objs=436 size=1.51KiB /1/34S (2|25|36): objs=146 size=129B /1/35N (2|25|36): objs=286 size=1011B /2/0N (2|25|36): objs=37572 size=712.75KiB /2/1N (2|25|36): objs=36583 size=698.95KiB /2/2N (2|25|36): objs=39858 size=779.94KiB /2/3N (2|25|36): objs=2891 size=12.12KiB /2/4S (2|25|36): objs=152 size=280B /2/5N (2|25|36): objs=336 size=817B /2/6S (2|25|36): objs=143 size=139B /2/7N (2|25|36): objs=2241 size=9.31KiB /2/8S (2|25|36): objs=172 size=201B /2/9N (2|25|36): objs=1063 size=4.35KiB /2/10S (2|25|36): objs=155 size=149B /2/11N (2|25|36): objs=4164 size=18.12KiB /2/12S (2|25|36): objs=161 size=181B /2/13N (2|25|36): objs=1906 size=8KiB /2/14S (2|25|36): objs=160 size=335B /2/15N (2|25|36): objs=796 size=2.77KiB /2/16S (2|25|36): objs=139 size=185B /2/17S (2|25|36): objs=139 size=265B /2/18S (2|25|36): objs=145 size=185B /2/19N (2|25|36): objs=930 size=3.84KiB /2/20S (2|25|36): objs=161 size=145B /2/21N (2|25|36): objs=1836 size=7.69KiB /2/22S (2|25|36): objs=128 size=133B /2/23N (2|25|36): objs=3114 size=14.2KiB /2/24S (2|25|36): objs=149 size=296B /2/25N (2|25|36): objs=3500 size=14.6KiB /2/26S (2|25|36): objs=150 size=340B /2/27N (2|25|36): objs=284 size=929B /2/28S (2|25|36): objs=144 size=198B /2/29N (2|25|36): objs=2118 size=8.84KiB /2/30S (2|25|36): objs=146 size=221B /2/31N (2|25|36): objs=896 size=3.65KiB /2/32S (2|25|36): objs=170 size=271B /2/33N (2|25|36): objs=9954 size=57.73KiB /2/34S (2|25|36): objs=150 size=163B /2/35N (2|25|36): objs=2579 size=10.61KiB /3/0N (2|25|36): objs=37477 size=730.28KiB /3/1N (2|25|36): objs=40638 size=825.61KiB /3/2N (2|25|36): objs=34718 size=588.46KiB /3/3S (2|25|36): objs=145 size=324B /3/4N (2|25|36): objs=630 size=2.4KiB /3/5N (2|25|36): objs=607 size=2.39KiB /3/6S (2|25|36): objs=167 size=351B /3/7N (2|25|36): objs=1007 size=3.85KiB /3/8S (2|25|36): objs=146 size=285B /3/9N (2|25|36): objs=3231 size=13.35KiB /3/10S (2|25|36): objs=162 size=349B /3/11N (2|25|36): objs=9882 size=55.08KiB /3/12S (2|25|36): objs=154 size=251B /3/13N (2|25|36): objs=3064 size=13.29KiB /3/14S (2|25|36): objs=117 size=213B /3/15N (2|25|36): objs=3981 size=19.12KiB /3/16S (2|25|36): objs=133 size=222B /3/17N (2|25|36): objs=1028 size=4.24KiB /3/18S (2|25|36): objs=153 size=137B /3/19N (2|25|36): objs=5123 size=24.69KiB /3/20S (2|25|36): objs=151 size=324B /3/21N (2|25|36): objs=1253 size=5.08KiB /3/22S (2|25|36): objs=151 size=138B /3/24S (2|25|36): objs=147 size=276B /3/25N (2|25|36): objs=469 size=1.53KiB /3/26S (2|25|36): objs=162 size=196B /3/27N (2|25|36): objs=445 size=1.56KiB /3/28S (2|25|36): objs=143 size=154B /3/29N (2|25|36): objs=326 size=1.04KiB /3/30S (2|25|36): objs=177 size=352B /3/31N (2|25|36): objs=2863 size=12.11KiB /3/32S (2|25|36): objs=163 size=85B /3/33N (2|25|36): objs=1977 size=8.15KiB /3/34S (2|25|36): objs=162 size=297B /3/35N (2|25|36): objs=2340 size=9.81KiB /4/0N (2|25|36): objs=40160 size=858.49KiB /4/1N (2|25|36): objs=37518 size=731.15KiB /4/2N (2|25|36): objs=40328 size=792.43KiB /4/3S (2|25|36): objs=154 size=285B /4/4N (2|25|36): objs=607 size=2.26KiB /4/5N (2|25|36): objs=6062 size=27.83KiB /4/6S (2|25|36): objs=169 size=119B /4/7N (2|25|36): objs=2433 size=9.8KiB /4/8S (2|25|36): objs=156 size=192B /4/9N (2|25|36): objs=1201 size=4.87KiB /4/10S (2|25|36): objs=136 size=317B /4/11N (2|25|36): objs=4348 size=19.55KiB /4/12S (2|25|36): objs=145 size=102B /4/14S (2|25|36): objs=139 size=222B /4/15N (2|25|36): objs=1989 size=8.32KiB /4/16S (2|25|36): objs=155 size=124B /4/17N (2|25|36): objs=3560 size=16.58KiB /4/18S (2|25|36): objs=171 size=150B /4/19N (2|25|36): objs=8273 size=41.72KiB /4/20S (2|25|36): objs=154 size=94B /4/22S (2|25|36): objs=167 size=175B /4/23N (2|25|36): objs=764 size=2.86KiB /4/24S (2|25|36): objs=149 size=254B /4/25N (2|25|36): objs=2994 size=13.16KiB /4/26S (2|25|36): objs=154 size=254B /4/27N (2|25|36): objs=3423 size=15.23KiB /4/28S (2|25|36): objs=149 size=267B /4/29N (2|25|36): objs=2361 size=9.74KiB /4/30S (2|25|36): objs=169 size=284B /4/31N (2|25|36): objs=1880 size=7.83KiB /4/32S (2|25|36): objs=161 size=330B /4/33N (2|25|36): objs=484 size=1.53KiB /4/34S (2|25|36): objs=175 size=206B /4/35S (2|25|36): objs=150 size=274B /5/0N (2|25|36): objs=32217 size=508.57KiB /5/1N (2|25|36): objs=36572 size=768.92KiB /5/2N (2|25|36): objs=40748 size=959.3KiB /5/3N (2|25|36): objs=2718 size=11.71KiB /5/4S (2|25|36): objs=142 size=213B /5/5N (2|25|36): objs=1080 size=4.34KiB /5/6S (2|25|36): objs=152 size=310B /5/7N (2|25|36): objs=456 size=1.52KiB /5/8S (2|25|36): objs=164 size=310B /5/9N (2|25|36): objs=3568 size=17.73KiB /5/10S (2|25|36): objs=153 size=138B /5/11N (2|25|36): objs=3157 size=14.16KiB /5/12S (2|25|36): objs=135 size=90B /5/13N (2|25|36): objs=1478 size=5.88KiB /5/14S (2|25|36): objs=159 size=208B /5/15N (2|25|36): objs=4590 size=21.38KiB /5/16S (2|25|36): objs=136 size=302B /5/17N (2|25|36): objs=576 size=2.1KiB /5/18S (2|25|36): objs=153 size=271B /5/19N (2|25|36): objs=896 size=3.46KiB /5/20S (2|25|36): objs=136 size=141B /5/21N (2|25|36): objs=4112 size=19.14KiB /5/22S (2|25|36): objs=130 size=97B /5/24S (2|25|36): objs=155 size=173B /5/25N (2|25|36): objs=1991 size=8.2KiB /5/26S (2|25|36): objs=124 size=95B /5/27N (2|25|36): objs=438 size=1.63KiB /5/28S (2|25|36): objs=147 size=108B /5/30S (2|25|36): objs=172 size=121B /5/31N (2|25|36): objs=5406 size=24KiB /5/32S (2|25|36): objs=139 size=220B /5/33N (2|25|36): objs=2565 size=10.94KiB /5/34S (2|25|36): objs=146 size=217B /5/35N (2|25|36): objs=3053 size=12.96KiB /6/0N (2|25|36): objs=37663 size=732.08KiB /6/1N (2|25|36): objs=40605 size=830.78KiB /6/2N (2|25|36): objs=33261 size=503.82KiB /6/3S (2|25|36): objs=144 size=152B /6/4N (2|25|36): objs=4296 size=17.97KiB /6/5N (2|25|36): objs=9770 size=65.72KiB /6/6S (2|25|36): objs=149 size=163B /6/7N (2|25|36): objs=1375 size=5.61KiB /6/8S (2|25|36): objs=144 size=245B /6/9N (2|25|36): objs=468 size=1.63KiB /6/10S (2|25|36): objs=140 size=208B /6/11N (2|25|36): objs=3336 size=14.2KiB /6/12S (2|25|36): objs=139 size=290B /6/13N (2|25|36): objs=882 size=3.41KiB /6/14S (2|25|36): objs=167 size=106B /6/15N (2|25|36): objs=1602 size=6.49KiB /6/16S (2|25|36): objs=144 size=271B /6/17N (2|25|36): objs=582 size=2.18KiB /6/18S (2|25|36): objs=142 size=314B /6/19N (2|25|36): objs=3678 size=16.22KiB /6/20S (2|25|36): objs=151 size=264B /6/22S (2|25|36): objs=166 size=162B /6/23N (2|25|36): objs=3090 size=12.98KiB /6/24S (2|25|36): objs=154 size=184B /6/25N (2|25|36): objs=7268 size=34.74KiB /6/26S (2|25|36): objs=175 size=118B /6/27N (2|25|36): objs=2088 size=8.83KiB /6/28S (2|25|36): objs=150 size=231B /6/29N (2|25|36): objs=1708 size=7.08KiB /6/30S (2|25|36): objs=157 size=115B /6/31N (2|25|36): objs=1757 size=7.37KiB /6/32S (2|25|36): objs=176 size=232B /6/33N (2|25|36): objs=942 size=3.52KiB /6/34S (2|25|36): objs=160 size=190B /7/0N (2|25|36): objs=40629 size=755.46KiB /7/1N (2|25|36): objs=40642 size=893.79KiB /7/2N (2|25|36): objs=37187 size=733.39KiB /7/3N (2|25|36): objs=10033 size=61.87KiB /7/4S (2|25|36): objs=168 size=242B /7/5N (2|25|36): objs=1206 size=5.07KiB /7/6S (2|25|36): objs=155 size=291B /7/7N (2|25|36): objs=290 size=853B /7/8S (2|25|36): objs=172 size=198B /7/9N (2|25|36): objs=434 size=1.49KiB /7/10S (2|25|36): objs=158 size=221B /7/11N (2|25|36): objs=455 size=1.55KiB /7/12S (2|25|36): objs=158 size=169B /7/13N (2|25|36): objs=903 size=3.51KiB /7/14S (2|25|36): objs=150 size=135B /7/16S (2|25|36): objs=137 size=246B /7/17N (2|25|36): objs=1219 size=4.99KiB /7/18S (2|25|36): objs=173 size=350B /7/19N (2|25|36): objs=1282 size=5.08KiB /7/20S (2|25|36): objs=163 size=199B /7/21N (2|25|36): objs=9181 size=42.01KiB /7/22S (2|25|36): objs=144 size=124B /7/23N (2|25|36): objs=575 size=2.2KiB /7/24S (2|25|36): objs=161 size=329B /7/25N (2|25|36): objs=2430 size=10.17KiB /7/26S (2|25|36): objs=161 size=264B /7/27N (2|25|36): objs=317 size=1.01KiB /7/28S (2|25|36): objs=141 size=189B /7/29N (2|25|36): objs=8172 size=40.38KiB /7/30S (2|25|36): objs=158 size=201B /7/31N (2|25|36): objs=935 size=3.31KiB /7/32S (2|25|36): objs=154 size=190B /7/33N (2|25|36): objs=1481 size=6.14KiB /7/34S (2|25|36): objs=167 size=194B /7/35N (2|25|36): objs=903 size=3.54KiB /8/0N (2|25|36): objs=39047 size=918.58KiB /8/1N (2|25|36): objs=17712 size=127.09KiB /8/2S (2|25|36): objs=141 size=96B /8/3N (2|25|36): objs=22052 size=224.77KiB /8/4N (2|25|36): objs=37412 size=744.62KiB /8/5N (2|25|36): objs=8268 size=48.75KiB /8/6S (2|25|36): objs=154 size=243B /8/7N (2|25|36): objs=886 size=3.56KiB /8/8S (2|25|36): objs=146 size=267B /8/9N (2|25|36): objs=1197 size=4.65KiB /8/10S (2|25|36): objs=162 size=270B /8/11N (2|25|36): objs=1272 size=5.12KiB /8/12S (2|25|36): objs=176 size=218B /8/13N (2|25|36): objs=1433 size=5.95KiB /8/14S (2|25|36): objs=168 size=225B /8/16S (2|25|36): objs=168 size=255B /8/17N (2|25|36): objs=591 size=2.15KiB /8/18S (2|25|36): objs=167 size=197B /8/19N (2|25|36): objs=1984 size=8.07KiB /8/20S (2|25|36): objs=129 size=157B /8/21N (2|25|36): objs=1645 size=6.67KiB /8/22S (2|25|36): objs=183 size=156B /8/23N (2|25|36): objs=1265 size=5.15KiB /8/24S (2|25|36): objs=175 size=295B /8/25N (2|25|36): objs=5932 size=27.04KiB /8/26S (2|25|36): objs=163 size=112B /8/27N (2|25|36): objs=3595 size=16.13KiB /8/28S (2|25|36): objs=163 size=96B /8/29N (2|25|36): objs=2431 size=9.96KiB /8/30S (2|25|36): objs=160 size=340B /8/31N (2|25|36): objs=1329 size=5.29KiB /8/32S (2|25|36): objs=167 size=323B /8/33N (2|25|36): objs=655 size=2.17KiB /8/34S (2|25|36): objs=166 size=108B /8/35N (2|25|36): objs=4127 size=19.75KiB /9/0N (2|25|36): objs=39952 size=854.37KiB /9/1N (2|25|36): objs=43488 size=957.31KiB /9/2N (2|25|36): objs=33868 size=591.96KiB /9/3S (2|25|36): objs=153 size=267B /9/4N (2|25|36): objs=3022 size=12.83KiB /9/6S (2|25|36): objs=141 size=103B /9/8S (2|25|36): objs=166 size=324B /9/9N (2|25|36): objs=3276 size=14.59KiB /9/10S (2|25|36): objs=150 size=155B /9/11N (2|25|36): objs=1757 size=7.35KiB /9/12S (2|25|36): objs=158 size=304B /9/13N (2|25|36): objs=635 size=2.48KiB /9/14S (2|25|36): objs=145 size=237B /9/15N (2|25|36): objs=8734 size=55.9KiB /9/16S (2|25|36): objs=158 size=288B /9/17N (2|25|36): objs=1405 size=5.56KiB /9/18S (2|25|36): objs=150 size=312B /9/19N (2|25|36): objs=913 size=3.52KiB /9/20S (2|25|36): objs=174 size=114B /9/21N (2|25|36): objs=287 size=950B /9/22S (2|25|36): objs=155 size=225B /9/23N (2|25|36): objs=7509 size=38.43KiB /9/24S (2|25|36): objs=173 size=109B /9/25N (2|25|36): objs=3544 size=15.31KiB /9/26S (2|25|36): objs=137 size=297B /9/27N (2|25|36): objs=4250 size=18.85KiB /9/28S (2|25|36): objs=150 size=276B /9/29N (2|25|36): objs=938 size=3.52KiB /9/30S (2|25|36): objs=147 size=206B /9/31N (2|25|36): objs=1079 size=4.2KiB /9/32S (2|25|36): objs=141 size=213B /9/33N (2|25|36): objs=1771 size=7.22KiB /9/34S (2|25|36): objs=139 size=289B /9/35N (2|25|36): objs=1580 size=6.46KiB /10/0N (2|25|36): objs=43686 size=949.59KiB /10/1N (2|25|36): objs=39687 size=904.88KiB /10/2N (2|25|36): objs=41808 size=827.48KiB /10/3N (2|25|36): objs=3858 size=17.58KiB /10/4S (2|25|36): objs=170 size=129B /10/5N (2|25|36): objs=871 size=3.33KiB /10/6S (2|25|36): objs=150 size=153B /10/7N (2|25|36): objs=1183 size=4.8KiB /10/8S (2|25|36): objs=139 size=146B /10/9N (2|25|36): objs=2098 size=8.77KiB /10/10S (2|25|36): objs=155 size=307B /10/11N (2|25|36): objs=728 size=2.51KiB /10/12S (2|25|36): objs=188 size=233B /10/13N (2|25|36): objs=4485 size=20.94KiB /10/14S (2|25|36): objs=155 size=342B /10/15N (2|25|36): objs=579 size=2.06KiB /10/16S (2|25|36): objs=150 size=181B /10/17N (2|25|36): objs=1321 size=5.2KiB /10/18S (2|25|36): objs=139 size=300B /10/19N (2|25|36): objs=2634 size=11.07KiB /10/20S (2|25|36): objs=156 size=242B /10/21N (2|25|36): objs=2241 size=9.26KiB /10/22S (2|25|36): objs=159 size=202B /10/23N (2|25|36): objs=803 size=3.04KiB /10/24S (2|25|36): objs=160 size=277B /10/25S (2|25|36): objs=161 size=216B /10/26S (2|25|36): objs=148 size=86B /10/27N (2|25|36): objs=1584 size=6.61KiB /10/28S (2|25|36): objs=168 size=304B /10/29N (2|25|36): objs=1096 size=4.6KiB /10/30S (2|25|36): objs=144 size=288B /10/31N (2|25|36): objs=7827 size=44.21KiB /10/32S (2|25|36): objs=155 size=200B /10/33N (2|25|36): objs=757 size=2.66KiB /10/34S (2|25|36): objs=179 size=248B /10/35N (2|25|36): objs=1021 size=4.45KiB /11/0N (2|25|36): objs=42781 size=949.39KiB /11/1N (2|25|36): objs=40190 size=875.99KiB /11/2N (2|25|36): objs=39109 size=804.73KiB /11/3N (2|25|36): objs=2024 size=8.24KiB /11/4S (2|25|36): objs=158 size=184B /11/5N (2|25|36): objs=317 size=941B /11/6S (2|25|36): objs=154 size=290B /11/7N (2|25|36): objs=610 size=2.27KiB /11/8S (2|25|36): objs=138 size=322B /11/9S (2|25|36): objs=127 size=317B /11/10S (2|25|36): objs=150 size=225B /11/11N (2|25|36): objs=1917 size=8KiB /11/12S (2|25|36): objs=150 size=162B /11/13N (2|25|36): objs=4940 size=23.56KiB /11/14S (2|25|36): objs=184 size=173B /11/15N (2|25|36): objs=1818 size=7.4KiB /11/16S (2|25|36): objs=145 size=171B /11/17N (2|25|36): objs=7243 size=34.59KiB /11/18S (2|25|36): objs=154 size=227B /11/19N (2|25|36): objs=2455 size=10.23KiB /11/20S (2|25|36): objs=161 size=322B /11/21N (2|25|36): objs=1358 size=5.66KiB /11/22S (2|25|36): objs=151 size=334B /11/23N (2|25|36): objs=2480 size=10.49KiB /11/24S (2|25|36): objs=148 size=92B /11/25N (2|25|36): objs=1251 size=5.11KiB /11/26S (2|25|36): objs=140 size=103B /11/27N (2|25|36): objs=901 size=3.72KiB /11/28S (2|25|36): objs=143 size=219B /11/29N (2|25|36): objs=636 size=2.24KiB /11/30S (2|25|36): objs=165 size=188B /11/31N (2|25|36): objs=2905 size=12.19KiB /11/32S (2|25|36): objs=161 size=209B /11/33N (2|25|36): objs=2615 size=10.93KiB /11/34S (2|25|36): objs=144 size=240B /11/35N (2|25|36): objs=3074 size=12.81KiB /12/0N (2|25|36): objs=36800 size=732.02KiB /12/1N (2|25|36): objs=40460 size=965.69KiB /12/2N (2|25|36): objs=39929 size=934.41KiB /12/3S (2|25|36): objs=164 size=315B /12/4N (2|25|36): objs=315 size=783B /12/5S (2|25|36): objs=137 size=93B /12/6N (2|25|36): objs=759 size=2.82KiB /12/7S (2|25|36): objs=158 size=119B /12/8S (2|25|36): objs=139 size=105B /12/9S (2|25|36): objs=154 size=271B /12/10N (2|25|36): objs=1916 size=7.81KiB /12/11N (2|25|36): objs=2627 size=10.96KiB /12/12S (2|25|36): objs=140 size=292B /12/13N (2|25|36): objs=948 size=3.67KiB /12/14S (2|25|36): objs=146 size=216B /12/15N (2|25|36): objs=2747 size=11.86KiB /12/16S (2|25|36): objs=147 size=122B /12/17N (2|25|36): objs=3679 size=18.08KiB /12/18S (2|25|36): objs=147 size=90B /12/19N (2|25|36): objs=8747 size=56.79KiB /12/20S (2|25|36): objs=161 size=324B /12/21N (2|25|36): objs=1705 size=6.97KiB /12/22S (2|25|36): objs=148 size=337B /12/23N (2|25|36): objs=3058 size=12.69KiB /12/24S (2|25|36): objs=174 size=275B /12/25N (2|25|36): objs=3133 size=13.94KiB /12/26S (2|25|36): objs=169 size=191B /12/27N (2|25|36): objs=2413 size=10.51KiB /12/28S (2|25|36): objs=160 size=326B /12/29N (2|25|36): objs=2645 size=10.95KiB /12/30S (2|25|36): objs=168 size=342B /12/31S (2|25|36): objs=173 size=95B /12/32S (2|25|36): objs=142 size=93B /12/33N (2|25|36): objs=4064 size=18.15KiB /12/34S (2|25|36): objs=143 size=233B /12/35N (2|25|36): objs=2164 size=9.09KiB /13/0N (2|25|36): objs=40788 size=928.87KiB /13/1N (2|25|36): objs=33758 size=516.71KiB /13/2N (2|25|36): objs=35954 size=680.13KiB /13/3N (2|25|36): objs=12309 size=74.22KiB /13/4S (2|25|36): objs=147 size=194B /13/6S (2|25|36): objs=139 size=98B /13/7N (2|25|36): objs=3669 size=18.02KiB /13/8S (2|25|36): objs=177 size=331B /13/10S (2|25|36): objs=148 size=150B /13/12S (2|25|36): objs=164 size=117B /13/13N (2|25|36): objs=300 size=1021B /13/14S (2|25|36): objs=150 size=338B /13/15N (2|25|36): objs=2328 size=10.04KiB /13/16S (2|25|36): objs=147 size=159B /13/17N (2|25|36): objs=1406 size=5.69KiB /13/18S (2|25|36): objs=168 size=183B /13/19N (2|25|36): objs=877 size=3.29KiB /13/20S (2|25|36): objs=162 size=253B /13/21N (2|25|36): objs=2464 size=10.34KiB /13/22S (2|25|36): objs=159 size=90B /13/23N (2|25|36): objs=730 size=2.83KiB /13/24S (2|25|36): objs=153 size=245B /13/25S (2|25|36): objs=196 size=119B /13/26S (2|25|36): objs=145 size=134B /13/27N (2|25|36): objs=1490 size=5.96KiB /13/28S (2|25|36): objs=158 size=306B /13/29N (2|25|36): objs=2422 size=10.47KiB /13/30S (2|25|36): objs=173 size=226B /13/31N (2|25|36): objs=629 size=2.49KiB /13/32S (2|25|36): objs=170 size=256B /13/33N (2|25|36): objs=6942 size=31.83KiB /13/34S (2|25|36): objs=161 size=237B /13/35N (2|25|36): objs=1225 size=4.91KiB /14/0N (2|25|36): objs=37979 size=743.26KiB /14/1N (2|25|36): objs=45263 size=1.08MiB /14/2N (2|25|36): objs=40176 size=813.63KiB /14/3N (2|25|36): objs=11088 size=56.29KiB /14/4S (2|25|36): objs=175 size=334B /14/5N (2|25|36): objs=863 size=3.38KiB /14/6S (2|25|36): objs=134 size=136B /14/8S (2|25|36): objs=163 size=150B /14/9N (2|25|36): objs=906 size=3.45KiB /14/10S (2|25|36): objs=159 size=209B /14/11N (2|25|36): objs=1485 size=6.21KiB /14/12S (2|25|36): objs=161 size=325B /14/14S (2|25|36): objs=136 size=289B /14/15N (2|25|36): objs=3643 size=16.01KiB /14/16S (2|25|36): objs=166 size=134B /14/17N (2|25|36): objs=1877 size=7.74KiB /14/18S (2|25|36): objs=141 size=92B /14/19N (2|25|36): objs=479 size=1.66KiB /14/20S (2|25|36): objs=152 size=173B /14/21N (2|25|36): objs=1199 size=4.9KiB /14/22S (2|25|36): objs=169 size=252B /14/23N (2|25|36): objs=1796 size=7.42KiB /14/24S (2|25|36): objs=151 size=279B /14/25N (2|25|36): objs=2383 size=10.1KiB /14/26S (2|25|36): objs=135 size=237B /14/27N (2|25|36): objs=1745 size=7.19KiB /14/28S (2|25|36): objs=158 size=111B /14/29N (2|25|36): objs=1059 size=4.1KiB /14/30S (2|25|36): objs=158 size=214B /14/31N (2|25|36): objs=4198 size=19.71KiB /14/32S (2|25|36): objs=179 size=203B /14/34S (2|25|36): objs=142 size=211B /14/35N (2|25|36): objs=721 size=2.79KiB /15/0N (2|25|36): objs=38496 size=710.95KiB /15/1N (2|25|36): objs=33794 size=549.54KiB /15/2N (2|25|36): objs=43540 size=1.13MiB /15/3S (2|25|36): objs=148 size=124B /15/4N (2|25|36): objs=652 size=2.54KiB /15/5N (2|25|36): objs=7517 size=39.15KiB /15/6S (2|25|36): objs=168 size=106B /15/7N (2|25|36): objs=761 size=3.06KiB /15/8S (2|25|36): objs=155 size=267B /15/9N (2|25|36): objs=5674 size=24.5KiB /15/10S (2|25|36): objs=158 size=229B /15/11N (2|25|36): objs=600 size=2.02KiB /15/12S (2|25|36): objs=153 size=145B /15/13N (2|25|36): objs=300 size=834B /15/14S (2|25|36): objs=146 size=131B /15/15N (2|25|36): objs=313 size=870B /15/16S (2|25|36): objs=160 size=249B /15/17N (2|25|36): objs=283 size=1KiB /15/18S (2|25|36): objs=153 size=257B /15/19N (2|25|36): objs=1381 size=5.79KiB /15/20S (2|25|36): objs=157 size=181B /15/22S (2|25|36): objs=156 size=145B /15/23S (2|25|36): objs=157 size=263B /15/24S (2|25|36): objs=145 size=325B /15/25N (2|25|36): objs=288 size=857B /15/26S (2|25|36): objs=154 size=302B /15/27N (2|25|36): objs=505 size=1.57KiB /15/28S (2|25|36): objs=152 size=192B /15/29N (2|25|36): objs=16693 size=103.28KiB /15/30S (2|25|36): objs=144 size=225B /15/31N (2|25|36): objs=2284 size=9.51KiB /15/32S (2|25|36): objs=145 size=187B /15/33N (2|25|36): objs=1553 size=6.45KiB /15/34S (2|25|36): objs=131 size=187B /15/35N (2|25|36): objs=641 size=2.67KiB /16/0N (2|25|36): objs=37599 size=729.18KiB /16/1N (2|25|36): objs=38245 size=742.04KiB /16/2N (2|25|36): objs=42423 size=1009.65KiB /16/3N (2|25|36): objs=14496 size=103.34KiB /16/4S (2|25|36): objs=157 size=223B /16/5N (2|25|36): objs=1072 size=4.13KiB /16/6S (2|25|36): objs=148 size=116B /16/7N (2|25|36): objs=468 size=1.45KiB /16/8S (2|25|36): objs=167 size=125B /16/9N (2|25|36): objs=4805 size=21.73KiB /16/10S (2|25|36): objs=165 size=206B /16/11N (2|25|36): objs=3645 size=15.2KiB /16/12S (2|25|36): objs=167 size=186B /16/13N (2|25|36): objs=1114 size=4.51KiB /16/14S (2|25|36): objs=159 size=107B /16/15S (2|25|36): objs=153 size=341B /16/16S (2|25|36): objs=146 size=203B /16/17N (2|25|36): objs=2327 size=9.55KiB /16/18S (2|25|36): objs=155 size=198B /16/19N (2|25|36): objs=611 size=2.19KiB /16/20S (2|25|36): objs=166 size=348B /16/21N (2|25|36): objs=950 size=3.76KiB /16/22S (2|25|36): objs=149 size=107B /16/23N (2|25|36): objs=328 size=876B /16/24S (2|25|36): objs=159 size=209B /16/25N (2|25|36): objs=1491 size=6.3KiB /16/26S (2|25|36): objs=144 size=133B /16/27N (2|25|36): objs=2915 size=12.33KiB /16/28S (2|25|36): objs=159 size=141B /16/29S (2|25|36): objs=136 size=181B /16/30S (2|25|36): objs=149 size=128B /16/31N (2|25|36): objs=4294 size=20.26KiB /16/32S (2|25|36): objs=152 size=138B /16/34S (2|25|36): objs=154 size=193B /16/35N (2|25|36): objs=611 size=2.14KiB /17/0N (2|25|36): objs=34681 size=777.89KiB /17/1N (2|25|36): objs=37355 size=768.32KiB /17/2N (2|25|36): objs=38162 size=843.7KiB /17/3N (2|25|36): objs=10380 size=54.87KiB /17/4S (2|25|36): objs=148 size=239B /17/5S (2|25|36): objs=141 size=247B /17/6S (2|25|36): objs=126 size=143B /17/7N (2|25|36): objs=2126 size=8.7KiB /17/8S (2|25|36): objs=149 size=307B /17/9N (2|25|36): objs=445 size=1.43KiB /17/10S (2|25|36): objs=169 size=263B /17/11N (2|25|36): objs=4620 size=20.11KiB /17/12S (2|25|36): objs=143 size=243B /17/13S (2|25|36): objs=162 size=88B /17/14S (2|25|36): objs=148 size=99B /17/15N (2|25|36): objs=866 size=3.31KiB /17/16S (2|25|36): objs=161 size=299B /17/17N (2|25|36): objs=1242 size=4.98KiB /17/18S (2|25|36): objs=172 size=200B /17/19N (2|25|36): objs=457 size=1.67KiB /17/20S (2|25|36): objs=139 size=242B /17/21N (2|25|36): objs=2918 size=12.47KiB /17/22S (2|25|36): objs=157 size=180B /17/23S (2|25|36): objs=155 size=240B /17/24S (2|25|36): objs=146 size=239B /17/25N (2|25|36): objs=1264 size=4.85KiB /17/26S (2|25|36): objs=144 size=179B /17/27S (2|25|36): objs=166 size=334B /17/28S (2|25|36): objs=173 size=246B /17/29N (2|25|36): objs=894 size=3.6KiB /17/30S (2|25|36): objs=151 size=220B /17/31N (2|25|36): objs=2755 size=11.54KiB /17/32S (2|25|36): objs=150 size=238B /17/33N (2|25|36): objs=2614 size=11.25KiB /17/34S (2|25|36): objs=173 size=120B /17/35N (2|25|36): objs=4192 size=18.12KiB /18/0N (2|25|36): objs=38212 size=776.07KiB /18/1N (2|25|36): objs=38362 size=871.39KiB /18/2N (2|25|36): objs=3570 size=15.14KiB /18/3S (2|25|36): objs=170 size=118B /18/4N (2|25|36): objs=6316 size=27.57KiB /18/5S (2|25|36): objs=139 size=197B /18/6N (2|25|36): objs=28611 size=381.74KiB /18/7N (2|25|36): objs=6895 size=33.43KiB /18/8S (2|25|36): objs=169 size=222B /18/9N (2|25|36): objs=6118 size=28.24KiB /18/10S (2|25|36): objs=152 size=306B /18/11N (2|25|36): objs=1825 size=7.41KiB /18/12S (2|25|36): objs=148 size=196B /18/13S (2|25|36): objs=144 size=131B /18/14S (2|25|36): objs=141 size=222B /18/15N (2|25|36): objs=4179 size=18.91KiB /18/16S (2|25|36): objs=156 size=191B /18/17N (2|25|36): objs=2498 size=10.47KiB /18/18S (2|25|36): objs=165 size=311B /18/19N (2|25|36): objs=596 size=2.29KiB /18/20S (2|25|36): objs=158 size=237B /18/21N (2|25|36): objs=300 size=801B /18/22S (2|25|36): objs=154 size=277B /18/23N (2|25|36): objs=4481 size=21.65KiB /18/24S (2|25|36): objs=153 size=254B /18/25N (2|25|36): objs=577 size=2.03KiB /18/26S (2|25|36): objs=179 size=335B /18/27N (2|25|36): objs=1503 size=6.17KiB /18/28S (2|25|36): objs=143 size=278B /18/30S (2|25|36): objs=118 size=155B /18/31N (2|25|36): objs=8406 size=43.4KiB /18/32S (2|25|36): objs=149 size=127B /18/33S (2|25|36): objs=161 size=194B /18/34S (2|25|36): objs=161 size=330B /19/0N (2|25|36): objs=38616 size=845.28KiB /19/1N (2|25|36): objs=34440 size=614.71KiB /19/2N (2|25|36): objs=40129 size=954.58KiB /19/3N (2|25|36): objs=8827 size=45.25KiB /19/4S (2|25|36): objs=164 size=181B /19/5N (2|25|36): objs=3671 size=17.08KiB /19/6S (2|25|36): objs=137 size=204B /19/7N (2|25|36): objs=1078 size=4.3KiB /19/8S (2|25|36): objs=165 size=323B /19/10S (2|25|36): objs=164 size=264B /19/11N (2|25|36): objs=4584 size=20.23KiB /19/12S (2|25|36): objs=168 size=91B /19/14S (2|25|36): objs=164 size=219B /19/15N (2|25|36): objs=932 size=3.67KiB /19/16S (2|25|36): objs=166 size=346B /19/17N (2|25|36): objs=403 size=1.41KiB /19/18S (2|25|36): objs=134 size=232B /19/19N (2|25|36): objs=1534 size=6.28KiB /19/20S (2|25|36): objs=148 size=89B /19/21N (2|25|36): objs=2082 size=8.99KiB /19/22S (2|25|36): objs=144 size=106B /19/23N (2|25|36): objs=2712 size=11.65KiB /19/24S (2|25|36): objs=164 size=210B /19/25N (2|25|36): objs=4076 size=20.22KiB /19/26S (2|25|36): objs=173 size=304B /19/27N (2|25|36): objs=867 size=3.18KiB /19/28S (2|25|36): objs=138 size=339B /19/29N (2|25|36): objs=718 size=2.83KiB /19/30S (2|25|36): objs=148 size=121B /19/31N (2|25|36): objs=2167 size=9.13KiB /19/32S (2|25|36): objs=185 size=364B /19/33N (2|25|36): objs=1082 size=4.36KiB /19/34S (2|25|36): objs=155 size=102B /19/35N (2|25|36): objs=750 size=2.68KiB /20/0N (2|25|36): objs=40554 size=908.2KiB /20/1N (2|25|36): objs=37517 size=774.31KiB /20/2N (2|25|36): objs=40223 size=883.39KiB /20/3N (2|25|36): objs=6702 size=30.35KiB /20/4S (2|25|36): objs=143 size=285B /20/6S (2|25|36): objs=140 size=139B /20/7N (2|25|36): objs=4667 size=22.28KiB /20/8S (2|25|36): objs=148 size=280B /20/9N (2|25|36): objs=2480 size=10.42KiB /20/10S (2|25|36): objs=135 size=187B /20/11N (2|25|36): objs=605 size=2.05KiB /20/12S (2|25|36): objs=159 size=186B /20/13N (2|25|36): objs=902 size=3.44KiB /20/14S (2|25|36): objs=148 size=136B /20/15N (2|25|36): objs=4618 size=19.53KiB /20/16S (2|25|36): objs=138 size=320B /20/17N (2|25|36): objs=1679 size=6.76KiB /20/18S (2|25|36): objs=153 size=340B /20/19N (2|25|36): objs=775 size=2.81KiB /20/20S (2|25|36): objs=147 size=326B /20/21N (2|25|36): objs=880 size=3.59KiB /20/22S (2|25|36): objs=139 size=268B /20/23N (2|25|36): objs=473 size=1.56KiB /20/24S (2|25|36): objs=152 size=96B /20/25N (2|25|36): objs=923 size=3.73KiB /20/26S (2|25|36): objs=159 size=333B /20/27N (2|25|36): objs=295 size=932B /20/28S (2|25|36): objs=160 size=260B /20/29N (2|25|36): objs=9432 size=52KiB /20/30S (2|25|36): objs=165 size=301B /20/31S (2|25|36): objs=155 size=105B /20/32S (2|25|36): objs=168 size=313B /20/33N (2|25|36): objs=727 size=2.75KiB /20/34S (2|25|36): objs=165 size=334B /20/35N (2|25|36): objs=246 size=788B /21/0N (2|25|36): objs=41204 size=784.9KiB /21/1N (2|25|36): objs=38499 size=750.83KiB /21/2N (2|25|36): objs=40139 size=937.04KiB /21/3N (2|25|36): objs=2812 size=11.98KiB /21/4S (2|25|36): objs=145 size=100B /21/5N (2|25|36): objs=3474 size=16.51KiB /21/6S (2|25|36): objs=156 size=97B /21/7N (2|25|36): objs=2368 size=9.76KiB /21/8S (2|25|36): objs=156 size=211B /21/9N (2|25|36): objs=633 size=2.36KiB /21/10S (2|25|36): objs=146 size=208B /21/11N (2|25|36): objs=5684 size=26.37KiB /21/12S (2|25|36): objs=136 size=308B /21/14S (2|25|36): objs=159 size=225B /21/15N (2|25|36): objs=5467 size=25.63KiB /21/16S (2|25|36): objs=148 size=255B /21/17N (2|25|36): objs=1220 size=4.96KiB /21/18S (2|25|36): objs=157 size=165B /21/19N (2|25|36): objs=272 size=761B /21/20S (2|25|36): objs=184 size=155B /21/21N (2|25|36): objs=450 size=1.79KiB /21/22S (2|25|36): objs=163 size=106B /21/24S (2|25|36): objs=153 size=282B /21/25N (2|25|36): objs=906 size=3.4KiB /21/26S (2|25|36): objs=152 size=146B /21/27N (2|25|36): objs=297 size=835B /21/28S (2|25|36): objs=142 size=206B /21/29N (2|25|36): objs=7272 size=31.75KiB /21/30S (2|25|36): objs=160 size=179B /21/31N (2|25|36): objs=921 size=3.45KiB /21/32S (2|25|36): objs=135 size=204B /21/33N (2|25|36): objs=2040 size=8.21KiB /21/34S (2|25|36): objs=151 size=326B /21/35N (2|25|36): objs=3489 size=14.85KiB /22/0N (2|25|36): objs=38875 size=907.3KiB /22/1N (2|25|36): objs=37008 size=642.35KiB /22/2N (2|25|36): objs=40101 size=811.64KiB /22/3N (2|25|36): objs=6184 size=29.43KiB /22/4S (2|25|36): objs=143 size=258B /22/5N (2|25|36): objs=1330 size=5.64KiB /22/6S (2|25|36): objs=164 size=255B /22/7N (2|25|36): objs=3118 size=13.49KiB /22/8S (2|25|36): objs=181 size=190B /22/9S (2|25|36): objs=142 size=324B /22/10S (2|25|36): objs=167 size=201B /22/11N (2|25|36): objs=6547 size=30.18KiB /22/12S (2|25|36): objs=134 size=237B /22/13N (2|25|36): objs=1235 size=4.9KiB /22/14S (2|25|36): objs=151 size=140B /22/15N (2|25|36): objs=623 size=2.11KiB /22/16S (2|25|36): objs=142 size=114B /22/18S (2|25|36): objs=162 size=158B /22/19N (2|25|36): objs=461 size=1.53KiB /22/20S (2|25|36): objs=139 size=119B /22/21N (2|25|36): objs=1722 size=7.26KiB /22/22S (2|25|36): objs=157 size=152B /22/23N (2|25|36): objs=1035 size=4.05KiB /22/24S (2|25|36): objs=163 size=113B /22/25N (2|25|36): objs=815 size=3.14KiB /22/26S (2|25|36): objs=151 size=275B /22/27N (2|25|36): objs=1126 size=4.35KiB /22/28S (2|25|36): objs=167 size=208B /22/29N (2|25|36): objs=1209 size=5.15KiB /22/30S (2|25|36): objs=147 size=235B /22/31N (2|25|36): objs=914 size=3.51KiB /22/32S (2|25|36): objs=145 size=282B /22/33N (2|25|36): objs=6842 size=32KiB /22/34S (2|25|36): objs=127 size=100B /22/35N (2|25|36): objs=644 size=2.41KiB /23/0N (2|25|36): objs=36807 size=664.79KiB /23/1N (2|25|36): objs=38786 size=889.46KiB /23/2N (2|25|36): objs=40382 size=848.72KiB /23/3N (2|25|36): objs=8620 size=41.81KiB /23/4S (2|25|36): objs=149 size=220B /23/5N (2|25|36): objs=1403 size=5.82KiB /23/6S (2|25|36): objs=150 size=135B /23/7N (2|25|36): objs=7613 size=38.05KiB /23/8S (2|25|36): objs=156 size=310B /23/9N (2|25|36): objs=1632 size=6.8KiB /23/10S (2|25|36): objs=169 size=317B /23/11N (2|25|36): objs=744 size=2.56KiB /23/12S (2|25|36): objs=165 size=94B /23/13N (2|25|36): objs=1246 size=4.97KiB /23/14S (2|25|36): objs=166 size=307B /23/15N (2|25|36): objs=640 size=2.55KiB /23/16S (2|25|36): objs=138 size=272B /23/17N (2|25|36): objs=655 size=2.53KiB /23/18S (2|25|36): objs=179 size=275B /23/19N (2|25|36): objs=2082 size=8.44KiB /23/20S (2|25|36): objs=173 size=175B /23/21N (2|25|36): objs=471 size=1.68KiB /23/22S (2|25|36): objs=164 size=307B /23/23N (2|25|36): objs=3484 size=14.58KiB /23/24S (2|25|36): objs=154 size=159B /23/25N (2|25|36): objs=1790 size=7.44KiB /23/26S (2|25|36): objs=158 size=160B /23/27N (2|25|36): objs=1008 size=3.95KiB /23/28S (2|25|36): objs=160 size=258B /23/29N (2|25|36): objs=1351 size=5.38KiB /23/30S (2|25|36): objs=143 size=198B /23/31N (2|25|36): objs=589 size=2.29KiB /23/32S (2|25|36): objs=152 size=139B /23/33N (2|25|36): objs=2053 size=8.68KiB /23/34S (2|25|36): objs=158 size=255B /24/0N (2|25|36): objs=42764 size=1.03MiB /24/1N (2|25|36): objs=40928 size=829.62KiB /24/2N (2|25|36): objs=37591 size=769.49KiB /24/3N (2|25|36): objs=4442 size=19.88KiB /24/4S (2|25|36): objs=150 size=175B /24/5N (2|25|36): objs=455 size=1.47KiB /24/6S (2|25|36): objs=157 size=153B /24/7N (2|25|36): objs=1550 size=6.44KiB /24/8S (2|25|36): objs=165 size=329B /24/10S (2|25|36): objs=172 size=166B /24/11S (2|25|36): objs=142 size=182B /24/12S (2|25|36): objs=130 size=245B /24/14S (2|25|36): objs=134 size=124B /24/15N (2|25|36): objs=1831 size=7.65KiB /24/16S (2|25|36): objs=147 size=330B /24/17N (2|25|36): objs=729 size=2.75KiB /24/18S (2|25|36): objs=170 size=169B /24/19N (2|25|36): objs=2970 size=13.38KiB /24/20S (2|25|36): objs=161 size=183B /24/21N (2|25|36): objs=458 size=1.7KiB /24/22S (2|25|36): objs=169 size=99B /24/23N (2|25|36): objs=11804 size=67.25KiB /24/24S (2|25|36): objs=166 size=121B /24/25N (2|25|36): objs=916 size=3.62KiB /24/26S (2|25|36): objs=149 size=276B /24/27N (2|25|36): objs=466 size=1.64KiB /24/28S (2|25|36): objs=151 size=310B /24/29N (2|25|36): objs=4729 size=21.31KiB /24/30S (2|25|36): objs=154 size=126B /24/31N (2|25|36): objs=886 size=3.67KiB /24/32S (2|25|36): objs=149 size=154B /24/33N (2|25|36): objs=3641 size=17.4KiB /24/34S (2|25|36): objs=148 size=328B /24/35N (2|25|36): objs=760 size=2.92KiB /25/0N (2|25|36): objs=37482 size=714.13KiB /25/1N (2|25|36): objs=40982 size=910.9KiB /25/2N (2|25|36): objs=38217 size=860.38KiB /25/3N (2|25|36): objs=5566 size=25.56KiB /25/4S (2|25|36): objs=169 size=274B /25/5N (2|25|36): objs=618 size=2.26KiB /25/6S (2|25|36): objs=146 size=176B /25/8S (2|25|36): objs=174 size=244B /25/9N (2|25|36): objs=1709 size=7.01KiB /25/10S (2|25|36): objs=177 size=90B /25/11N (2|25|36): objs=1101 size=4.51KiB /25/12S (2|25|36): objs=165 size=92B /25/13N (2|25|36): objs=340 size=841B /25/14S (2|25|36): objs=142 size=207B /25/15N (2|25|36): objs=4062 size=17.61KiB /25/16S (2|25|36): objs=161 size=193B /25/17N (2|25|36): objs=1753 size=7.22KiB /25/18S (2|25|36): objs=159 size=170B /25/19S (2|25|36): objs=143 size=282B /25/20S (2|25|36): objs=161 size=307B /25/21N (2|25|36): objs=1365 size=5.51KiB /25/22S (2|25|36): objs=154 size=336B /25/23N (2|25|36): objs=318 size=942B /25/24S (2|25|36): objs=161 size=288B /25/25N (2|25|36): objs=3381 size=14.29KiB /25/26S (2|25|36): objs=161 size=285B /25/27N (2|25|36): objs=575 size=2.11KiB /25/28S (2|25|36): objs=160 size=317B /25/29N (2|25|36): objs=8483 size=42.36KiB /25/30S (2|25|36): objs=154 size=243B /25/31N (2|25|36): objs=5124 size=23.77KiB /25/32S (2|25|36): objs=143 size=113B /25/33N (2|25|36): objs=294 size=974B /25/34S (2|25|36): objs=148 size=299B /25/35N (2|25|36): objs=1252 size=5.26KiB /26/0N (2|25|36): objs=43743 size=1000.69KiB /26/1N (2|25|36): objs=36518 size=698.8KiB /26/2N (2|25|36): objs=34365 size=672.92KiB /26/3S (2|25|36): objs=160 size=216B /26/4N (2|25|36): objs=5005 size=23.35KiB /26/5N (2|25|36): objs=17389 size=111.41KiB /26/6S (2|25|36): objs=163 size=339B /26/7N (2|25|36): objs=3450 size=15.15KiB /26/8S (2|25|36): objs=159 size=220B /26/9S (2|25|36): objs=157 size=293B /26/10S (2|25|36): objs=163 size=162B /26/11N (2|25|36): objs=453 size=1.38KiB /26/12S (2|25|36): objs=164 size=256B /26/13N (2|25|36): objs=1059 size=4.37KiB /26/14S (2|25|36): objs=133 size=88B /26/15N (2|25|36): objs=3890 size=16.51KiB /26/16S (2|25|36): objs=164 size=350B /26/17N (2|25|36): objs=1663 size=6.68KiB /26/18S (2|25|36): objs=162 size=176B /26/19N (2|25|36): objs=618 size=2.31KiB /26/20S (2|25|36): objs=164 size=226B /26/21N (2|25|36): objs=1378 size=5.58KiB /26/22S (2|25|36): objs=163 size=233B /26/23N (2|25|36): objs=2561 size=10.67KiB /26/24S (2|25|36): objs=135 size=212B /26/25N (2|25|36): objs=1200 size=4.85KiB /26/26S (2|25|36): objs=156 size=87B /26/27N (2|25|36): objs=312 size=888B /26/28S (2|25|36): objs=152 size=97B /26/29N (2|25|36): objs=1348 size=5.53KiB /26/30S (2|25|36): objs=154 size=124B /26/32S (2|25|36): objs=143 size=197B /26/33N (2|25|36): objs=900 size=3.32KiB /26/34S (2|25|36): objs=138 size=280B /26/35N (2|25|36): objs=598 size=2.22KiB /27/0N (2|25|36): objs=41534 size=837.82KiB /27/1N (2|25|36): objs=37700 size=720.78KiB /27/2N (2|25|36): objs=36100 size=598.27KiB /27/3S (2|25|36): objs=149 size=205B /27/4N (2|25|36): objs=5738 size=27.2KiB /27/5N (2|25|36): objs=7155 size=39.82KiB /27/6S (2|25|36): objs=175 size=193B /27/7N (2|25|36): objs=797 size=2.76KiB /27/8S (2|25|36): objs=182 size=131B /27/9N (2|25|36): objs=3049 size=13.17KiB /27/10S (2|25|36): objs=154 size=151B /27/11N (2|25|36): objs=891 size=3.4KiB /27/12S (2|25|36): objs=169 size=132B /27/13N (2|25|36): objs=3086 size=13.23KiB /27/14S (2|25|36): objs=144 size=304B /27/15N (2|25|36): objs=5055 size=23.26KiB /27/16S (2|25|36): objs=166 size=211B /27/17N (2|25|36): objs=5083 size=23.28KiB /27/18S (2|25|36): objs=149 size=186B /27/19N (2|25|36): objs=822 size=3.25KiB /27/20S (2|25|36): objs=152 size=233B /27/21N (2|25|36): objs=921 size=3.46KiB /27/22S (2|25|36): objs=164 size=130B /27/23N (2|25|36): objs=1515 size=6.37KiB /27/24S (2|25|36): objs=152 size=302B /27/25N (2|25|36): objs=774 size=3.02KiB /27/26S (2|25|36): objs=149 size=340B /27/27N (2|25|36): objs=308 size=967B /27/28S (2|25|36): objs=156 size=202B /27/30S (2|25|36): objs=155 size=162B /27/31S (2|25|36): objs=139 size=152B /27/32S (2|25|36): objs=171 size=162B /27/33N (2|25|36): objs=4626 size=20.59KiB /27/34S (2|25|36): objs=169 size=269B /27/35N (2|25|36): objs=2471 size=10.66KiB /28/0N (2|25|36): objs=35574 size=743.92KiB /28/1N (2|25|36): objs=41162 size=964.38KiB /28/2N (2|25|36): objs=20870 size=173.62KiB /28/3S (2|25|36): objs=171 size=184B /28/4N (2|25|36): objs=14898 size=98.32KiB /28/5N (2|25|36): objs=1299 size=5.04KiB /28/6S (2|25|36): objs=148 size=257B /28/7N (2|25|36): objs=897 size=3.57KiB /28/8S (2|25|36): objs=150 size=96B /28/9N (2|25|36): objs=5531 size=25.49KiB /28/10S (2|25|36): objs=152 size=335B /28/11N (2|25|36): objs=602 size=2.44KiB /28/12S (2|25|36): objs=154 size=276B /28/13N (2|25|36): objs=1906 size=7.89KiB /28/14S (2|25|36): objs=175 size=282B /28/15N (2|25|36): objs=1061 size=4.1KiB /28/16S (2|25|36): objs=181 size=258B /28/18S (2|25|36): objs=159 size=261B /28/19N (2|25|36): objs=448 size=1.62KiB /28/20S (2|25|36): objs=150 size=151B /28/21N (2|25|36): objs=1498 size=6.06KiB /28/22S (2|25|36): objs=138 size=212B /28/23N (2|25|36): objs=2009 size=8.61KiB /28/24S (2|25|36): objs=154 size=97B /28/25S (2|25|36): objs=141 size=126B /28/26S (2|25|36): objs=152 size=170B /28/27N (2|25|36): objs=13493 size=86.78KiB /28/28S (2|25|36): objs=152 size=308B /28/30S (2|25|36): objs=157 size=295B /28/31N (2|25|36): objs=1288 size=4.98KiB /28/32S (2|25|36): objs=152 size=256B /28/33N (2|25|36): objs=801 size=3.11KiB /28/34S (2|25|36): objs=149 size=186B /28/35N (2|25|36): objs=5545 size=27.62KiB /29/0N (2|25|36): objs=40006 size=904.65KiB /29/1N (2|25|36): objs=12102 size=71.9KiB /29/2S (2|25|36): objs=156 size=113B /29/3N (2|25|36): objs=27110 size=320.58KiB /29/4N (2|25|36): objs=22370 size=201.78KiB /29/5S (2|25|36): objs=157 size=132B /29/6N (2|25|36): objs=17321 size=120.59KiB /29/7N (2|25|36): objs=15042 size=94.84KiB /29/8S (2|25|36): objs=145 size=87B /29/9N (2|25|36): objs=1497 size=6.4KiB /29/10S (2|25|36): objs=137 size=277B /29/11N (2|25|36): objs=897 size=3.32KiB /29/12S (2|25|36): objs=157 size=170B /29/13N (2|25|36): objs=2912 size=12.33KiB /29/14S (2|25|36): objs=159 size=229B /29/15N (2|25|36): objs=1396 size=5.58KiB /29/16S (2|25|36): objs=134 size=275B /29/17N (2|25|36): objs=4008 size=16.91KiB /29/18S (2|25|36): objs=161 size=193B /29/19N (2|25|36): objs=1839 size=7.59KiB /29/20S (2|25|36): objs=155 size=269B /29/21N (2|25|36): objs=462 size=1.48KiB /29/22S (2|25|36): objs=156 size=95B /29/23N (2|25|36): objs=2927 size=12.94KiB /29/24S (2|25|36): objs=145 size=269B /29/25N (2|25|36): objs=2113 size=9.16KiB /29/26S (2|25|36): objs=156 size=318B /29/27N (2|25|36): objs=3978 size=18.04KiB /29/28S (2|25|36): objs=153 size=313B /29/29N (2|25|36): objs=411 size=1.4KiB /29/30S (2|25|36): objs=167 size=294B /29/31N (2|25|36): objs=1389 size=5.73KiB /29/32S (2|25|36): objs=160 size=337B /29/34S (2|25|36): objs=131 size=281B /29/35N (2|25|36): objs=1097 size=4.25KiB /30/0N (2|25|36): objs=41468 size=973.85KiB /30/1N (2|25|36): objs=36555 size=673.77KiB /30/2N (2|25|36): objs=28734 size=366.83KiB /30/3S (2|25|36): objs=150 size=144B /30/5S (2|25|36): objs=144 size=334B /30/6N (2|25|36): objs=2156 size=8.82KiB /30/7S (2|25|36): objs=148 size=272B /30/8N (2|25|36): objs=3257 size=14.28KiB /30/9S (2|25|36): objs=148 size=258B /30/10N (2|25|36): objs=1026 size=4.29KiB /30/11N (2|25|36): objs=1230 size=4.97KiB /30/12S (2|25|36): objs=153 size=289B /30/13N (2|25|36): objs=429 size=1.47KiB /30/14S (2|25|36): objs=133 size=187B /30/15N (2|25|36): objs=6609 size=31.77KiB /30/16S (2|25|36): objs=165 size=115B /30/17N (2|25|36): objs=1042 size=4.32KiB /30/18S (2|25|36): objs=172 size=289B /30/19N (2|25|36): objs=6274 size=28.3KiB /30/20S (2|25|36): objs=150 size=291B /30/21N (2|25|36): objs=1788 size=7.61KiB /30/22S (2|25|36): objs=135 size=209B /30/23N (2|25|36): objs=3586 size=15.31KiB /30/24S (2|25|36): objs=124 size=146B /30/25N (2|25|36): objs=3250 size=14.94KiB /30/26S (2|25|36): objs=141 size=239B /30/27N (2|25|36): objs=1229 size=4.84KiB /30/28S (2|25|36): objs=165 size=299B /30/29N (2|25|36): objs=6545 size=35.75KiB /30/30S (2|25|36): objs=144 size=203B /30/32S (2|25|36): objs=153 size=283B /30/33N (2|25|36): objs=464 size=1.56KiB /30/34S (2|25|36): objs=152 size=105B /30/35N (2|25|36): objs=4848 size=22.26KiB /31/0N (2|25|36): objs=37294 size=695.54KiB /31/1N (2|25|36): objs=35338 size=743.69KiB /31/2N (2|25|36): objs=36314 size=686.5KiB /31/3N (2|25|36): objs=9731 size=63.61KiB /31/4S (2|25|36): objs=162 size=170B /31/5N (2|25|36): objs=787 size=2.95KiB /31/6S (2|25|36): objs=126 size=195B /31/7N (2|25|36): objs=468 size=1.69KiB /31/8S (2|25|36): objs=170 size=115B /31/9N (2|25|36): objs=5477 size=30.21KiB /31/10S (2|25|36): objs=136 size=173B /31/11N (2|25|36): objs=1018 size=4.34KiB /31/12S (2|25|36): objs=154 size=271B /31/13N (2|25|36): objs=1416 size=5.81KiB /31/14S (2|25|36): objs=143 size=300B /31/15N (2|25|36): objs=7942 size=35.42KiB /31/16S (2|25|36): objs=169 size=166B /31/17N (2|25|36): objs=316 size=875B /31/18S (2|25|36): objs=146 size=87B /31/19N (2|25|36): objs=942 size=3.85KiB /31/20S (2|25|36): objs=160 size=211B /31/21N (2|25|36): objs=4959 size=22.22KiB /31/22S (2|25|36): objs=143 size=327B /31/23N (2|25|36): objs=649 size=2.25KiB /31/24S (2|25|36): objs=152 size=104B /31/25N (2|25|36): objs=444 size=1.65KiB /31/26S (2|25|36): objs=158 size=207B /31/27N (2|25|36): objs=489 size=1.88KiB /31/28S (2|25|36): objs=165 size=114B /31/29N (2|25|36): objs=1184 size=4.92KiB /31/30S (2|25|36): objs=135 size=152B /31/31N (2|25|36): objs=717 size=2.81KiB /31/32S (2|25|36): objs=170 size=137B /31/33N (2|25|36): objs=1415 size=5.66KiB /31/34S (2|25|36): objs=138 size=107B /31/35N (2|25|36): objs=465 size=1.6KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 129.16ms Sorting: 56.46ms 1 217 41511 99511 99999 com.milaboratory.util.VersionInfoTest > test3 SKIPPED Gradle Test Executor 1 finished executing tests. Finished generating test XML results (0.059 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.097 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[#50,Task worker for ':',5,main]) completed. Took 2 mins 1.662 secs. BUILD SUCCESSFUL in 2m 15s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath Duplicate specification "version|V" for option "V" jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_arm64.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_arm64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/568993 and its subdirectories I: Current time: Mon Mar 24 22:18:28 -12 2025 I: pbuilder-time-stamp: 1742897908 Tue Mar 25 10:18:30 UTC 2025 I: 1st build successful. Starting 2nd build on remote node codethink03-arm64.debian.net. Tue Mar 25 10:18:30 UTC 2025 I: Preparing to do remote build '2' on codethink03-arm64.debian.net. Tue Mar 25 10:22:20 UTC 2025 I: Deleting $TMPDIR on codethink03-arm64.debian.net. Tue Mar 25 10:22:21 UTC 2025 I: milib_2.2.0+dfsg-1_arm64.changes: Format: 1.8 Date: Fri, 30 Dec 2022 14:38:35 +0100 Source: milib Binary: libmilib-java Architecture: all Version: 2.2.0+dfsg-1 Distribution: unstable Urgency: medium Maintainer: Debian Med Packaging Team Changed-By: Pierre Gruet Description: libmilib-java - library for Next Generation Sequencing (NGS) data processing Changes: milib (2.2.0+dfsg-1) unstable; urgency=medium . * New upstream version 2.2.0+dfsg * Refreshing patches * Raising Standards version to 4.6.2 (no change) Checksums-Sha1: afaa8b109948cd86d9c8064d7431f484dda7da43 779768 libmilib-java_2.2.0+dfsg-1_all.deb 3dec9e54c8a074ebce078043aa9d3ff1cbd48e76 16036 milib_2.2.0+dfsg-1_arm64.buildinfo Checksums-Sha256: cf8dc7019ece63567907a6544526d394dbebdedac4c60730b87bee330b333a69 779768 libmilib-java_2.2.0+dfsg-1_all.deb 9b365a91b085170fdfbe7542a64bf6f294e08b6e0f5d6c9e4185d7e9d0134d84 16036 milib_2.2.0+dfsg-1_arm64.buildinfo Files: ccbe347d52c9109b0bb4b0dd98a9dd28 779768 java optional libmilib-java_2.2.0+dfsg-1_all.deb 83864bd13794ca32d8973c43ba73f5a0 16036 java optional milib_2.2.0+dfsg-1_arm64.buildinfo Tue Mar 25 10:22:22 UTC 2025 I: diffoscope 291 will be used to compare the two builds: Running as unit: rb-diffoscope-arm64_12-88109.service # Profiling output for: /usr/bin/diffoscope --timeout 7200 --html /srv/reproducible-results/rbuild-debian/r-b-build.othEr4gc/milib_2.2.0+dfsg-1.diffoscope.html --text /srv/reproducible-results/rbuild-debian/r-b-build.othEr4gc/milib_2.2.0+dfsg-1.diffoscope.txt --json /srv/reproducible-results/rbuild-debian/r-b-build.othEr4gc/milib_2.2.0+dfsg-1.diffoscope.json --profile=- /srv/reproducible-results/rbuild-debian/r-b-build.othEr4gc/b1/milib_2.2.0+dfsg-1_arm64.changes /srv/reproducible-results/rbuild-debian/r-b-build.othEr4gc/b2/milib_2.2.0+dfsg-1_arm64.changes ## command (total time: 0.000s) 0.000s 1 call cmp (internal) ## has_same_content_as (total time: 0.000s) 0.000s 1 call diffoscope.comparators.binary.FilesystemFile ## main (total time: 0.003s) 0.003s 2 calls outputs 0.000s 1 call cleanup Finished with result: success Main processes terminated with: code=exited/status=0 Service runtime: 234ms CPU time consumed: 235ms Tue Mar 25 10:22:23 UTC 2025 I: diffoscope 291 found no differences in the changes files, and a .buildinfo file also exists. Tue Mar 25 10:22:23 UTC 2025 I: milib from unstable built successfully and reproducibly on arm64. Tue Mar 25 10:22:24 UTC 2025 I: Submitting .buildinfo files to external archives: Tue Mar 25 10:22:24 UTC 2025 I: Submitting 20K b1/milib_2.2.0+dfsg-1_arm64.buildinfo.asc Tue Mar 25 10:22:25 UTC 2025 I: Submitting 20K b2/milib_2.2.0+dfsg-1_arm64.buildinfo.asc Tue Mar 25 10:22:26 UTC 2025 I: Done submitting .buildinfo files to http://buildinfo.debian.net/api/submit. Tue Mar 25 10:22:26 UTC 2025 I: Done submitting .buildinfo files. Tue Mar 25 10:22:26 UTC 2025 I: Removing signed milib_2.2.0+dfsg-1_arm64.buildinfo.asc files: removed './b1/milib_2.2.0+dfsg-1_arm64.buildinfo.asc' removed './b2/milib_2.2.0+dfsg-1_arm64.buildinfo.asc'